F450229

General Info

Members Datasets Scaffolds Average Seq Length
469 398 221 236

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10001389|Ga0105237_1000138923
Length 260
Sequence MRRPNGRRKLLEPAMQLIVGLGNPGDKYARNRHNIGFMAVDVIATRHNFPAFRQKFSGLVSEGSIDGERVLLLKPQTFMNASGDSVVAAANFYKLTAADVTVFYDEIDLVPGKVRVKRGGGSGGHNGIRSIDPQIGPDYRRVRLGVGHPGHKDGVMPHVLGDFSKADQEWLVPVLDGVADNVGLLLKGDDNTFMNKLAIAVAGDGAERPQRPETADPTRPKAQSHIRGARPKAPQAKVPETGPMADMLRKLLGKKKDEEN

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
5 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
6 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
7 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
8 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
9 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
10 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
11 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
12 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
13 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
14 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
15 2516143018 Ensifer sp. BR816 Isolate Nodule
16 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
17 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
18 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
19 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
20 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
21 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
22 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
23 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
24 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
25 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
26 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
27 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
28 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
29 2643221557 Ensifer sp. Root558 Isolate Unclassified
30 2643221568 Rhizobium sp. Root564 Isolate Unclassified
31 2643221610 Ensifer sp. Root74 Isolate Unclassified
32 2643221618 Ensifer sp. Root231 Isolate Unclassified
33 2643221626 Ensifer sp. Root31 Isolate Unclassified
34 2643221629 Devosia sp. Root105 Isolate Unclassified
35 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
36 2643221655 Ensifer sp. Root1252 Isolate Unclassified
37 2643221659 Ensifer sp. Root127 Isolate Unclassified
38 2643221662 Devosia sp. Root413D1 Isolate Unclassified
39 2643221668 Ensifer sp. Root423 Isolate Unclassified
40 2643221675 Ensifer sp. Root1298 Isolate Unclassified
41 2643221680 Ensifer sp. Root1312 Isolate Unclassified
42 2643221698 Ensifer sp. Root142 Isolate Unclassified
43 2643221712 Ensifer sp. Root258 Isolate Unclassified
44 2643221726 Ensifer sp. Root954 Isolate Unclassified
45 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
46 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
47 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
48 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
49 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
50 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
51 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
52 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
53 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
54 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
55 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
56 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
57 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
58 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
59 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
60 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
61 2844163670 Ensifer sp. 1H6 Isolate Unclassified
62 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
63 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
64 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
65 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
66 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
67 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
68 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
69 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
70 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
71 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
72 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
73 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
74 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
75 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
76 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
77 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
78 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
79 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
80 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
81 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
82 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
83 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
84 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
85 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
86 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
87 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
88 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
89 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
90 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
91 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
92 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
93 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
94 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
95 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
96 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
97 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
98 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
99 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
100 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
101 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
102 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
103 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
104 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
105 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
106 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
107 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
108 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
109 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
110 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
111 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
112 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
113 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
114 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
115 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
116 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
117 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
118 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
119 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
120 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
121 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
122 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
123 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
124 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
125 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
126 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
127 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
128 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
129 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
130 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
131 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
132 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
133 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
134 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
135 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
136 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
137 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
138 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
139 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
140 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
141 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
142 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
143 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
144 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
145 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
146 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
147 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
148 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
149 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
150 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
151 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
152 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
153 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
154 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
155 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
156 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
157 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
158 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
159 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
160 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
161 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
162 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
163 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
164 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
165 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
166 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
167 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
168 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
169 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
170 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
171 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
172 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
173 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
174 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
175 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
176 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
177 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
178 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
179 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
180 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
181 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
182 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
183 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
184 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
185 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
186 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
187 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
188 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
189 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
190 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
191 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
192 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
193 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
194 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
195 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
196 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
197 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
198 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
199 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
200 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
201 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
202 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
203 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
204 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
205 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
206 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
207 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
208 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
209 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
210 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
211 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
212 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
213 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
214 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
215 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
216 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
217 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
218 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
219 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
220 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
221 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
222 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
223 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
224 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
225 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
226 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
227 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
228 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
229 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
230 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
231 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
232 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
233 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
234 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
235 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
236 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
237 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
238 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
239 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
240 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
241 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
242 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
243 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
244 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
245 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
246 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
247 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
248 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
249 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
250 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
251 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
252 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
253 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
254 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
255 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
256 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
257 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
258 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
259 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
260 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
261 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
262 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
263 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
264 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
265 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
266 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
267 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
268 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
269 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
270 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
271 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
272 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
273 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
274 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
275 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
276 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
277 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
278 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
279 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
280 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
281 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
282 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
283 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
284 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
285 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
286 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
287 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
288 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
289 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
290 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
291 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
292 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
293 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
294 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
295 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
296 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
297 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
298 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
299 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
300 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
301 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
302 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
303 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
304 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
326 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
327 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
329 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
330 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
331 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
332 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
333 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
334 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
335 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
336 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
337 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
338 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
339 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
340 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
341 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
342 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
343 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
344 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
345 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
346 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
347 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
348 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
349 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
350 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
351 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
352 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
353 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
354 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
355 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
356 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
357 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
358 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
359 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
360 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
361 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
362 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
363 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
364 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
365 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
366 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
367 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
368 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
369 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
370 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
371 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
372 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
373 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
374 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
375 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
376 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
383 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
384 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
386 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
387 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
388 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
389 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
390 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
391 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
392 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
393 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
394 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
395 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
396 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
397 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
398 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 47.12
Metatranscriptomes 0
Isolates 52.88

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 4.69
Nodule 47.55
Rhizoplane 1.28
Rhizosphere 34.54
Stem 0
Stem Tuber 0.21
Unclassified 11.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000004 3300002987 Bacteria 215789
2 JGI25151J46595_10005712 3300003187 Bacteria 6383
3 JGI25165J46597_1003061 3300003214 Bacteria 4541
4 Ga0055524_1007216 3300003775 Bacteria 4751
5 Ga0070658_10028815 3300005327 Bacteria 4458
6 Ga0070676_10114729 3300005328 Bacteria 1682
7 Ga0070683_100887300 3300005329 Bacteria 855
8 Ga0070682_100149758 3300005337 Bacteria 1600
9 Ga0070660_100007312 3300005339 Bacteria 7696
10 Ga0070661_100087059 3300005344 Bacteria 2310
11 Ga0070661_100118284 3300005344 Bacteria 1983
12 Ga0070674_100018626 3300005356 Bacteria 4395
13 Ga0070673_100270425 3300005364 Bacteria 1487
14 Ga0070659_100134843 3300005366 Bacteria 2007
15 Ga0070678_100386811 3300005456 Bacteria 1212
16 Ga0070681_10481286 3300005458 Bacteria 1154
17 Ga0068867_100079216 3300005459 Bacteria 2472
18 Ga0068867_100688166 3300005459 Bacteria 901
19 Ga0070684_100472492 3300005535 Bacteria 1160
20 Ga0068853_100005868 3300005539 Bacteria 9678
21 Ga0068853_100021267 3300005539 Bacteria 5406
22 Ga0068853_100224233 3300005539 Bacteria 1718
23 Ga0070672_100280330 3300005543 Bacteria 1409
24 Ga0070693_100337257 3300005547 Bacteria 1028
25 Ga0070665_100079670 3300005548 Bacteria 3281
26 Ga0070665_100135251 3300005548 Bacteria 2467
27 Ga0068855_100134503 3300005563 Bacteria 2821
28 Ga0068855_100360869 3300005563 Bacteria 1599
29 Ga0070664_100044757 3300005564 Bacteria 3738
30 Ga0070664_100356701 3300005564 Bacteria 1331
31 Ga0068857_100135825 3300005577 Bacteria 2220
32 Ga0068854_100004119 3300005578 Bacteria 9134
33 Ga0068854_100183163 3300005578 Bacteria 1637
34 Ga0068856_100593170 3300005614 Bacteria 1129
35 Ga0068856_101245742 3300005614 Bacteria 760
36 Ga0068852_100011748 3300005616 Bacteria 6612
37 Ga0068852_100038885 3300005616 Bacteria 4002
38 Ga0068852_100739334 3300005616 Bacteria 995
39 Ga0068851_10001353 3300005834 Bacteria 10699
40 Ga0068851_10048837 3300005834 Bacteria 2145
41 Ga0075363_100021685 3300006048 Bacteria 3240
42 Ga0075364_10009213 3300006051 Bacteria 5916
43 Ga0075364_10286362 3300006051 Bacteria 1121
44 Ga0075362_10016771 3300006177 Bacteria 3005
45 Ga0068871_100532818 3300006358 Bacteria 1062
46 Ga0105240_10000014 3300009093 Bacteria 482033
47 Ga0105240_11109369 3300009093 Bacteria 841
48 Ga0105245_10577109 3300009098 Bacteria 1149
49 Ga0105243_10711639 3300009148 Bacteria 980
50 Ga0105241_10070538 3300009174 Bacteria 2711
51 Ga0105248_10116604 3300009177 Bacteria 3012
52 Ga0105237_10001173 3300009545 Bacteria 35022
53 Ga0105237_10001389 3300009545 Bacteria 31975
54 Ga0105237_10389907 3300009545 Bacteria 1398
55 Ga0105238_10055782 3300009551 Bacteria 3965
56 Ga0105238_10064718 3300009551 Bacteria 3656
57 Ga0105238_10142990 3300009551 Bacteria 2369
58 Ga0105239_10001103 3300010375 Bacteria 37309
59 Ga0105239_10012306 3300010375 Bacteria 9529
60 Ga0105239_10141721 3300010375 Bacteria 2679
61 Ga0105239_10339282 3300010375 Bacteria 1696
62 Ga0105239_10631506 3300010375 Bacteria 1223
63 Ga0157373_10094048 3300013100 Bacteria 2111
64 Ga0157371_10008701 3300013102 Bacteria 8057
65 Ga0157370_10007309 3300013104 Bacteria 12052
66 Ga0157370_10049755 3300013104 Bacteria 4010
67 Ga0157370_10106870 3300013104 Bacteria 2619
68 Ga0157369_10004287 3300013105 Bacteria 16862
69 Ga0157369_10107753 3300013105 Bacteria 2964
70 Ga0157369_10123294 3300013105 Bacteria 2749
71 Ga0157374_10004793 3300013296 Bacteria 11351
72 Ga0157374_10199631 3300013296 Bacteria 1958
73 Ga0157378_10314096 3300013297 Bacteria 1521
74 Ga0163162_10431026 3300013306 Bacteria 1450
75 Ga0157372_10307895 3300013307 Bacteria 1843
76 Ga0157375_11009931 3300013308 Bacteria 971
77 Ga0182008_10060560 3300014497 Bacteria 1866
78 Ga0157376_10291169 3300014969 Bacteria 1542
79 Ga0157376_10836668 3300014969 Bacteria 935
80 Ga0182007_10001370 3300015262 Bacteria 13106
81 Ga0182005_1041454 3300015265 Bacteria 1252
82 Ga0214544_1000010 3300021320 Bacteria 270164
83 Ga0214542_1000023 3300021321 Bacteria 191557
84 Ga0214543_1000019 3300021327 Bacteria 267908
85 Ga0214543_1000022 3300021327 Bacteria 241930
86 Ga0228711_1000026 3300022739 Bacteria 101497
87 Ga0228710_1000005 3300022740 Bacteria 233531
88 Ga0207427_102509 3300025231 Bacteria 4868
89 Ga0209677_102896 3300025253 Bacteria 6026
90 Ga0209233_1000113 3300025261 Bacteria 253455
91 Ga0209233_1005047 3300025261 Bacteria 4424
92 Ga0209233_1031225 3300025261 Bacteria 1246
93 Ga0209025_1038041 3300025294 Bacteria 2124
94 Ga0209256_1000153 3300025299 Bacteria 144736
95 Ga0207656_10036130 3300025321 Bacteria 2072
96 Ga0207656_10121371 3300025321 Bacteria 1217
97 Ga0207705_10074697 3300025909 Bacteria 2461
98 Ga0207654_10052187 3300025911 Bacteria 2356
99 Ga0207654_10390080 3300025911 Bacteria 966
100 Ga0207695_10000037 3300025913 Bacteria 476303
101 Ga0207671_10000168 3300025914 Bacteria 100117
102 Ga0207671_10003277 3300025914 Bacteria 16287
103 Ga0207649_10019256 3300025920 Bacteria 3898
104 Ga0207694_10151539 3300025924 Bacteria 1868
105 Ga0207687_10627778 3300025927 Bacteria 907
106 Ga0207690_10040882 3300025932 Bacteria 3034
107 Ga0207690_10144811 3300025932 Bacteria 1755
108 Ga0207709_10400876 3300025935 Bacteria 1049
109 Ga0207661_10010448 3300025944 Bacteria 6683
110 Ga0207679_10035646 3300025945 Bacteria 3522
111 Ga0207667_10002226 3300025949 Bacteria 24349
112 Ga0207667_10232240 3300025949 Bacteria 1888
113 Ga0207651_10018598 3300025960 Bacteria 4141
114 Ga0207640_10019140 3300025981 Bacteria 4039
115 Ga0207640_10163668 3300025981 Bacteria 1649
116 Ga0207639_10003202 3300026041 Bacteria 11005
117 Ga0207639_10016071 3300026041 Bacteria 5288
118 Ga0207639_10020528 3300026041 Bacteria 4729
119 Ga0207702_10177790 3300026078 Bacteria 1957
120 Ga0207648_10070458 3300026089 Bacteria 3048
121 Ga0207674_10008220 3300026116 Bacteria 12093
122 Ga0207683_10056409 3300026121 Bacteria 3445
123 Ga0207698_10902567 3300026142 Bacteria 891
124 Ga0209281_1000082 3300027111 Bacteria 257684
125 Ga0209281_1000380 3300027111 Bacteria 70330
126 Ga0209282_1000006 3300027666 Bacteria 276998
127 Ga0268266_10000974 3300028379 Bacteria 36355
128 Ga0268266_10695148 3300028379 Bacteria 980
129 Ga0265318_10008149 3300028577 Bacteria 4683
130 Ga0265338_10156663 3300028800 Bacteria 1763
131 Ga0265324_10011078 3300029957 Bacteria 3450
132 Ga0265332_10131949 3300031238 Bacteria 1048
133 Ga0265339_10173644 3300031249 Bacteria 1077
134 Ga0265331_10040447 3300031250 Bacteria 2267
135 Ga0265331_10116709 3300031250 Bacteria 1222
136 Ga0265327_10005849 3300031251 Bacteria 10066
137 Ga0265327_10025596 3300031251 Bacteria 3437
138 Ga0307513_10171826 3300031456 Bacteria 2044
139 Ga0265314_10014858 3300031711 Bacteria 6205
140 Ga0265314_10041700 3300031711 Bacteria 3282
141 Ga0265314_10113565 3300031711 Bacteria 1717
142 Ga0307412_10055162 3300031911 Bacteria 2642
143 Ga0315914_1000003 3300031967 Bacteria 314370
144 Ga0315913_1000001 3300033430 Bacteria 284459
145 Ga0315915_1000008 3300033464 Bacteria 258517
146 Ga0373949_0028647 3300035090 Bacteria 1316
147 Ga0373932_0007615 3300035112 Bacteria 2582
148 Ga0373942_0019812 3300035207 Bacteria 1683
149 Ga0316574_0433464 3300035398 Unclassified 825
150 Ga0373931_0048228 3300035691 Bacteria 2257
151 Ga0373925_0235424 3300037068 Bacteria 1465
152 Ga0395899_0000242 3300037312 Bacteria 72733
153 Ga0395899_0008248 3300037312 Bacteria 8027
154 Ga0395900_0000318 3300037418 Bacteria 71328
155 Ga0395898_0000547 3300037466 Bacteria 71322
156 Ga0395905_0000305 3300037471 Bacteria 71315
157 Ga0395905_0285946 3300037471 Bacteria 1536
158 Ga0395901_0000093 3300038443 Bacteria 120300
159 Ga0395901_0044713 3300038443 Bacteria 4592
160 Ga0395901_0096270 3300038443 Bacteria 3102
161 Ga0439449_0002534 3300042007 Bacteria 7143
162 Ga0495585_0013349 3300046492 Bacteria 4812
163 Ga0495606_0114458 3300046507 Bacteria 1622
164 Ga0495628_0407252 3300046516 Bacteria 993
165 Ga0495633_0074988 3300046558 Bacteria 1576
166 Ga0495625_0042696 3300046660 Bacteria 3293
167 Ga0495661_0067901 3300046665 Bacteria 2093
168 Ga0495686_0027154 3300047472 Bacteria 3740
169 Ga0496100_0520417 3300048903 Bacteria 918
170 Ga0496105_0009555 3300048908 Bacteria 7592
171 Ga0496106_0081775 3300048909 Bacteria 2482
172 Ga0496107_0133725 3300048910 Bacteria 1832
173 Ga0496109_0161319 3300048912 Bacteria 2101
174 Ga0496115_0036800 3300048918 Bacteria 3876
175 Ga0496116_0000345 3300048919 Bacteria 73956
176 Ga0496116_0060687 3300048919 Bacteria 2451
177 Ga0496117_0013185 3300048920 Bacteria 7225
178 Ga0496117_0021339 3300048920 Bacteria 5243
179 Ga0496117_0029331 3300048920 Bacteria 4243
180 Ga0496118_0001992 3300048921 Bacteria 28962
181 Ga0496118_0115277 3300048921 Bacteria 1769
182 Ga0496120_0004673 3300048923 Bacteria 11308
183 Ga0496121_0002066 3300048924 Bacteria 31785
184 Ga0496121_0169411 3300048924 Bacteria 1588
185 Ga0496121_0380103 3300048924 Bacteria 931
186 Ga0496122_0002992 3300048925 Bacteria 23005
187 Ga0496122_0031671 3300048925 Bacteria 4394
188 Ga0496123_0077959 3300048926 Bacteria 2032
189 Ga0496124_0007874 3300048927 Bacteria 11224
190 Ga0496124_0124925 3300048927 Bacteria 2051
191 Ga0496124_0164358 3300048927 Bacteria 1726
192 Ga0496125_0000039 3300048928 Bacteria 318665
193 Ga0496125_0118615 3300048928 Bacteria 1894
194 Ga0496126_0000166 3300048929 Bacteria 152470
195 Ga0496126_0442401 3300048929 Bacteria 1047
196 Ga0501032_0114135 3300049569 Bacteria 1787
197 Ga0501033_0225398 3300049570 Bacteria 1333
198 Ga0501034_0019924 3300049571 Bacteria 6850
199 Ga0501034_0025963 3300049571 Bacteria 5967
200 Ga0501034_0035274 3300049571 Bacteria 5071
201 Ga0501034_0116216 3300049571 Bacteria 2663
202 Ga0501034_0183692 3300049571 Bacteria 2055
203 Ga0501034_0242820 3300049571 Bacteria 1747
204 Ga0501036_0228560 3300049572 Bacteria 1562
205 Ga0501046_0032021 3300049580 Bacteria 4260
206 Ga0501046_0334904 3300049580 Bacteria 1101
207 Ga0501047_0064169 3300049581 Bacteria 3542
208 Ga0501070_0049465 3300049586 Bacteria 3491
209 Ga0501070_0153238 3300049586 Bacteria 1901
210 Ga0501074_0374145 3300049590 Bacteria 1011
211 Ga0501035_0014092 3300049822 Bacteria 7375
212 Ga0501035_0018805 3300049822 Bacteria 6364
213 Ga0501044_0014586 3300049823 Bacteria 8475
214 Ga0501044_0081265 3300049823 Bacteria 3281
215 nmdc:mga03n38_161274_c1 3300050490 Bacteria 1135
216 nmdc:mga03n38_5289_c1 3300050490 Bacteria 4379
217 nmdc:mga00v17_310968_c1 3300050491 Bacteria 1024
218 nmdc:mga06z11_405858_c1 3300050494 Bacteria 820
219 nmdc:mga07m45_94480_c1 3300050496 Bacteria 1714
220 Ga0500562_018177 3300053108 Bacteria 1815
221 Ga0500622_0001343 3300053156 Bacteria 19917

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_10431026 Ga0163162_104310262 193
2 3300014969 Ga0157376_10836668 Ga0157376_108366682 193
3 iso_pu_bacteria 8002060224 8002060296 194
4 3300028379 Ga0268266_10695148 Ga0268266_106951481 195
5 3300028800 Ga0265338_10156663 Ga0265338_101566632 195
6 3300029957 Ga0265324_10011078 Ga0265324_100110783 195
7 3300031251 Ga0265327_10005849 Ga0265327_100058499 195
8 3300031711 Ga0265314_10014858 Ga0265314_100148583 195
9 3300037471 Ga0395905_0285946 Ga0395905_0285946_209_814 195
10 3300038443 Ga0395901_0096270 Ga0395901_0096270_1855_2460 195
11 3300048910 Ga0496107_0133725 Ga0496107_0133725_356_961 195
12 3300005564 Ga0070664_100356701 Ga0070664_1003567012 197
13 3300005614 Ga0068856_101245742 Ga0068856_1012457421 197
14 3300013296 Ga0157374_10199631 Ga0157374_101996313 197
15 3300049572 Ga0501036_0228560 Ga0501036_0228560_26_697 202
16 3300006051 Ga0075364_10286362 Ga0075364_102863622 203
17 3300050490 nmdc:mga03n38_161274_c1 nmdc:mga03n38_161274_c1_13_645 203
18 3300048924 Ga0496121_0169411 Ga0496121_0169411_179_910 207
19 3300025261 Ga0209233_1031225 Ga0209233_10312252 209
20 3300053108 Ga0500562_018177 Ga0500562_018177_30_740 209
21 3300048903 Ga0496100_0520417 Ga0496100_0520417_37_753 211
22 3300048908 Ga0496105_0009555 Ga0496105_0009555_947_1663 211
23 3300048918 Ga0496115_0036800 Ga0496115_0036800_1420_2136 211
24 iso_pu_bacteria 8057132660 8057134888 211
25 3300046516 Ga0495628_0407252 Ga0495628_0407252_217_948 213
26 3300005329 Ga0070683_100887300 Ga0070683_1008873001 216
27 3300005337 Ga0070682_100149758 Ga0070682_1001497581 216
28 3300005459 Ga0068867_100688166 Ga0068867_1006881661 216
29 3300009148 Ga0105243_10711639 Ga0105243_107116391 216
30 3300048912 Ga0496109_0161319 Ga0496109_0161319_239_961 216
31 3300049569 Ga0501032_0114135 Ga0501032_0114135_188_925 217
32 3300049570 Ga0501033_0225398 Ga0501033_0225398_147_884 217
33 3300049580 Ga0501046_0334904 Ga0501046_0334904_29_766 217
34 3300049581 Ga0501047_0064169 Ga0501047_0064169_1211_1948 217
35 3300049586 Ga0501070_0049465 Ga0501070_0049465_2106_2843 217
36 3300049822 Ga0501035_0014092 Ga0501035_0014092_4911_5648 217
37 3300049823 Ga0501044_0081265 Ga0501044_0081265_409_1146 218
38 iso_pu_bacteria 2834578030 2834580247 218
39 iso_pu_bacteria 2855020534 2855022764 218
40 3300049571 Ga0501034_0035274 Ga0501034_0035274_2507_3250 222
41 3300013296 Ga0157374_10004793 Ga0157374_1000479311 223
42 3300048909 Ga0496106_0081775 Ga0496106_0081775_1213_1950 223
43 3300005563 Ga0068855_100360869 Ga0068855_1003608691 224
44 3300013105 Ga0157369_10123294 Ga0157369_101232943 224
45 3300025231 Ga0207427_102509 Ga0207427_1025096 224
46 3300025261 Ga0209233_1005047 Ga0209233_10050472 224
47 3300031456 Ga0307513_10171826 Ga0307513_101718262 224
48 3300037312 Ga0395899_0008248 Ga0395899_0008248_7160_7888 224
49 3300038443 Ga0395901_0044713 Ga0395901_0044713_103_831 224
50 iso_pu_bacteria 2917554339 2917556688 224
51 3300031249 Ga0265339_10173644 Ga0265339_101736442 226
52 3300031250 Ga0265331_10040447 Ga0265331_100404472 226
53 3300031711 Ga0265314_10041700 Ga0265314_100417001 226
54 3300049571 Ga0501034_0019924 Ga0501034_0019924_5982_6719 226
55 3300049571 Ga0501034_0116216 Ga0501034_0116216_1181_1891 228
56 iso_pu_bacteria 2551306091 2551730078 228
57 3300005614 Ga0068856_100593170 Ga0068856_1005931702 229
58 3300035398 Ga0316574_0433464 Ga0316574_0433464_102_794 229
59 3300003214 JGI25165J46597_1003061 JGI25165J46597_10030612 230
60 3300005563 Ga0068855_100134503 Ga0068855_1001345033 230
61 3300005616 Ga0068852_100038885 Ga0068852_1000388853 230
62 3300015265 Ga0182005_1041454 Ga0182005_10414542 230
63 3300025253 Ga0209677_102896 Ga0209677_1028965 230
64 3300025261 Ga0209233_1000113 Ga0209233_1000113208 230
65 3300025913 Ga0207695_10000037 Ga0207695_10000037356 230
66 3300025914 Ga0207671_10003277 Ga0207671_100032774 230
67 3300048920 Ga0496117_0021339 Ga0496117_0021339_3639_4355 230
68 3300048921 Ga0496118_0001992 Ga0496118_0001992_1480_2196 230
69 3300048925 Ga0496122_0002992 Ga0496122_0002992_20863_21579 230
70 3300049571 Ga0501034_0025963 Ga0501034_0025963_4885_5613 231
71 3300049571 Ga0501034_0242820 Ga0501034_0242820_595_1335 231
72 3300053156 Ga0500622_0001343 Ga0500622_0001343_9729_10445 231
73 iso_pu_bacteria 2643221629 2644167168 232
74 iso_pu_bacteria 2643221662 2644349684 232
75 3300021327 Ga0214543_1000022 Ga0214543_100002263 233
76 3300037312 Ga0395899_0000242 Ga0395899_0000242_35858_36586 233
77 3300037418 Ga0395900_0000318 Ga0395900_0000318_34746_35474 233
78 3300037466 Ga0395898_0000547 Ga0395898_0000547_35849_36577 233
79 3300037471 Ga0395905_0000305 Ga0395905_0000305_34746_35474 233
80 3300038443 Ga0395901_0000093 Ga0395901_0000093_35830_36558 233
81 3300013104 Ga0157370_10106870 Ga0157370_101068703 234
82 3300049580 Ga0501046_0032021 Ga0501046_0032021_1452_2177 234
83 3300049586 Ga0501070_0153238 Ga0501070_0153238_38_763 234
84 3300049590 Ga0501074_0374145 Ga0501074_0374145_53_778 234
85 3300049822 Ga0501035_0018805 Ga0501035_0018805_3282_4007 234
86 3300049823 Ga0501044_0014586 Ga0501044_0014586_5428_6153 234
87 3300050494 nmdc:mga06z11_405858_c1 nmdc:mga06z11_405858_c1_17_742 234
88 iso_pu_bacteria 2643221568 2643856631 234
89 iso_pu_bacteria 2919166419 2919169446 234
90 iso_pu_bacteria 2978969890 2978971853 234
91 iso_pu_bacteria 2984587000 2984590136 234
92 iso_pu_bacteria 2508501122 2509108183 235
93 iso_pu_bacteria 2509276019 2509376639 235
94 iso_pu_bacteria 2510065057 2510305288 235
95 iso_pu_bacteria 2511231052 2511502426 235
96 iso_pu_bacteria 2512047086 2512533806 235
97 iso_pu_bacteria 2512875026 2512970447 235
98 iso_pu_bacteria 2513237086 2513585038 235
99 iso_pu_bacteria 2513237089 2513601512 235
100 iso_pu_bacteria 2513237091 2513618117 235
101 iso_pu_bacteria 2513237140 2513884505 235
102 iso_pu_bacteria 2513237143 2513904453 235
103 iso_pu_bacteria 2513237156 2513983709 235
104 iso_pu_bacteria 2513237160 2514003043 235
105 iso_pu_bacteria 2515154107 2515609225 235
106 iso_pu_bacteria 2516143018 2516206226 235
107 iso_pu_bacteria 2516653046 2516893803 235
108 iso_pu_bacteria 2517487022 2517570515 235
109 iso_pu_bacteria 2524023207 2524448374 235
110 iso_pu_bacteria 2551306084 2551675988 235
111 iso_pu_bacteria 2551306085 2551683568 235
112 iso_pu_bacteria 2551306085 2551688258 235
113 iso_pu_bacteria 2551306086 2551693851 235
114 iso_pu_bacteria 2551306087 2551703422 235
115 iso_pu_bacteria 2551306089 2551713288 235
116 iso_pu_bacteria 2551306090 2551723748 235
117 iso_pu_bacteria 2551306092 2551738259 235
118 iso_pu_bacteria 2551306093 2551742930 235
119 iso_pu_bacteria 2558860100 2558864000 235
120 iso_pu_bacteria 2643221557 2643804243 235
121 iso_pu_bacteria 2643221610 2644064983 235
122 iso_pu_bacteria 2643221618 2644107007 235
123 iso_pu_bacteria 2643221626 2644148751 235
124 iso_pu_bacteria 2643221634 2644193693 235
125 iso_pu_bacteria 2643221655 2644309967 235
126 iso_pu_bacteria 2643221659 2644331113 235
127 iso_pu_bacteria 2643221668 2644376608 235
128 iso_pu_bacteria 2643221675 2644416656 235
129 iso_pu_bacteria 2643221680 2644449696 235
130 iso_pu_bacteria 2643221698 2644543843 235
131 iso_pu_bacteria 2643221712 2644616422 235
132 iso_pu_bacteria 2643221726 2644689828 235
133 iso_pu_bacteria 2657244999 2657681695 235
134 iso_pu_bacteria 2690316117 2692315323 235
135 iso_pu_bacteria 2751185821 2753462325 235
136 iso_pu_bacteria 2791355082 2792581409 235
137 iso_pu_bacteria 2791355091 2792620612 235
138 iso_pu_bacteria 2791355092 2792625971 235
139 iso_pu_bacteria 2791355094 2792638910 235
140 iso_pu_bacteria 2802428858 2802716804 235
141 iso_pu_bacteria 2802428859 2802725616 235
142 iso_pu_bacteria 2802428860 2802730294 235
143 iso_pu_bacteria 2802428861 2802737735 235
144 iso_pu_bacteria 2802428862 2802742875 235
145 iso_pu_bacteria 2802428863 2802750299 235
146 iso_pu_bacteria 2802429268 2804752884 235
147 iso_pu_bacteria 2838074704 2838076686 235
148 iso_pu_bacteria 2844163670 2844164070 235
149 iso_pu_bacteria 2847417321 2847419616 235
150 iso_pu_bacteria 2848992105 2848994617 235
151 iso_pu_bacteria 2850079185 2850081638 235
152 iso_pu_bacteria 2855825444 2855826528 235
153 iso_pu_bacteria 2855839649 2855841919 235
154 iso_pu_bacteria 2855872281 2855877549 235
155 iso_pu_bacteria 2858800743 2858803718 235
156 iso_pu_bacteria 2896384573 2896392126 235
157 iso_pu_bacteria 2913295892 2913299148 235
158 iso_pu_bacteria 2915980308 2915982916 235
159 iso_pu_bacteria 2915986958 2915989517 235
160 iso_pu_bacteria 2915993759 2916000035 235
161 iso_pu_bacteria 2916000859 2916003877 235
162 iso_pu_bacteria 2916007675 2916011801 235
163 iso_pu_bacteria 2916014648 2916020036 235
164 iso_pu_bacteria 2916021584 2916023759 235
165 iso_pu_bacteria 2916028427 2916031907 235
166 iso_pu_bacteria 2916035215 2916037647 235
167 iso_pu_bacteria 2916041962 2916046084 235
168 iso_pu_bacteria 2916048683 2916050343 235
169 iso_pu_bacteria 2916055098 2916058032 235
170 iso_pu_bacteria 2916061851 2916065428 235
171 iso_pu_bacteria 2916068649 2916069126 235
172 iso_pu_bacteria 2916076590 2916079044 235
173 iso_pu_bacteria 2921201388 2921203532 235
174 iso_pu_bacteria 2921208531 2921211799 235
175 iso_pu_bacteria 2921237296 2921243021 235
176 iso_pu_bacteria 2921244191 2921246030 235
177 iso_pu_bacteria 2921250672 2921253765 235
178 iso_pu_bacteria 2921257292 2921260873 235
179 iso_pu_bacteria 2921263974 2921266893 235
180 iso_pu_bacteria 2921282425 2921289119 235
181 iso_pu_bacteria 2921289301 2921296600 235
182 iso_pu_bacteria 2921296804 2921297938 235
183 iso_pu_bacteria 2924144063 2924147493 235
184 iso_pu_bacteria 2924150972 2924156789 235
185 iso_pu_bacteria 2924158325 2924160888 235
186 iso_pu_bacteria 2924165586 2924166469 235
187 iso_pu_bacteria 2924172951 2924175413 235
188 iso_pu_bacteria 2924179722 2924182578 235
189 iso_pu_bacteria 2924186466 2924189204 235
190 iso_pu_bacteria 2924193448 2924197006 235
191 iso_pu_bacteria 2924200457 2924206921 235
192 iso_pu_bacteria 2924207177 2924208045 235
193 iso_pu_bacteria 2924221636 2924224479 235
194 iso_pu_bacteria 2924228884 2924232227 235
195 iso_pu_bacteria 2936996657 2937002688 235
196 iso_pu_bacteria 2937002841 2937005701 235
197 iso_pu_bacteria 2937009748 2937012244 235
198 iso_pu_bacteria 2937016420 2937019239 235
199 iso_pu_bacteria 2937023124 2937027257 235
200 iso_pu_bacteria 2937029754 2937033423 235
201 iso_pu_bacteria 2937042894 2937044311 235
202 iso_pu_bacteria 2937049772 2937054462 235
203 iso_pu_bacteria 2937056579 2937061129 235
204 iso_pu_bacteria 2937063883 2937069019 235
205 iso_pu_bacteria 2937071275 2937074590 235
206 iso_pu_bacteria 2937078374 2937080607 235
207 iso_pu_bacteria 2937084907 2937086210 235
208 iso_pu_bacteria 2937091812 2937092198 235
209 iso_pu_bacteria 2937098957 2937102347 235
210 iso_pu_bacteria 2937106411 2937111966 235
211 iso_pu_bacteria 2937113482 2937117768 235
212 iso_pu_bacteria 2937119839 2937122944 235
213 iso_pu_bacteria 2937126314 2937130696 235
214 iso_pu_bacteria 2941499720 2941504780 235
215 iso_pu_bacteria 2957375807 2957380779 235
216 iso_pu_bacteria 2957382221 2957385365 235
217 iso_pu_bacteria 2957388812 2957392055 235
218 iso_pu_bacteria 2957395598 2957397174 235
219 iso_pu_bacteria 2957402308 2957405831 235
220 iso_pu_bacteria 2957408893 2957414390 235
221 iso_pu_bacteria 2957415311 2957419039 235
222 iso_pu_bacteria 2957422303 2957424009 235
223 iso_pu_bacteria 2957430029 2957433453 235
224 iso_pu_bacteria 2957437181 2957440600 235
225 iso_pu_bacteria 2957443900 2957445599 235
226 iso_pu_bacteria 2957450854 2957455816 235
227 iso_pu_bacteria 2957457609 2957460510 235
228 iso_pu_bacteria 2957464669 2957469026 235
229 iso_pu_bacteria 2957471148 2957473022 235
230 iso_pu_bacteria 2957478035 2957481363 235
231 iso_pu_bacteria 2957484790 2957487906 235
232 iso_pu_bacteria 2957491536 2957493043 235
233 iso_pu_bacteria 2957498199 2957500021 235
234 iso_pu_bacteria 2957505466 2957511329 235
235 iso_pu_bacteria 2960584000 2960590940 235
236 iso_pu_bacteria 2960591022 2960594104 235
237 iso_pu_bacteria 2960597568 2960603795 235
238 iso_pu_bacteria 2960603979 2960606351 235
239 iso_pu_bacteria 2960610863 2960613188 235
240 iso_pu_bacteria 2960617483 2960619793 235
241 iso_pu_bacteria 2960624210 2960627345 235
242 iso_pu_bacteria 2960631154 2960635138 235
243 iso_pu_bacteria 2960637947 2960643849 235
244 iso_pu_bacteria 2960645483 2960648918 235
245 iso_pu_bacteria 2960652885 2960658211 235
246 iso_pu_bacteria 2960660292 2960663006 235
247 iso_pu_bacteria 2960667422 2960668085 235
248 iso_pu_bacteria 2960674078 2960675308 235
249 iso_pu_bacteria 2960680706 2960680895 235
250 iso_pu_bacteria 2960687367 2960688117 235
251 iso_pu_bacteria 2960693952 2960697354 235
252 iso_pu_bacteria 2964607997 2964608818 235
253 iso_pu_bacteria 2964615318 2964618094 235
254 iso_pu_bacteria 2964621998 2964625605 235
255 iso_pu_bacteria 2964628898 2964635461 235
256 iso_pu_bacteria 2964636051 2964642864 235
257 iso_pu_bacteria 2964643177 2964643810 235
258 iso_pu_bacteria 2964649959 2964652401 235
259 iso_pu_bacteria 2964656573 2964659909 235
260 iso_pu_bacteria 2964663802 2964665417 235
261 iso_pu_bacteria 2964670856 2964675475 235
262 iso_pu_bacteria 2964678106 2964679655 235
263 iso_pu_bacteria 2964685014 2964685386 235
264 iso_pu_bacteria 2964691889 2964697481 235
265 iso_pu_bacteria 2964698721 2964700933 235
266 iso_pu_bacteria 2964705432 2964707851 235
267 iso_pu_bacteria 2964712639 2964717694 235
268 iso_pu_bacteria 2964719344 2964724188 235
269 iso_pu_bacteria 2967664464 2967667814 235
270 iso_pu_bacteria 2967671571 2967673899 235
271 iso_pu_bacteria 2967678726 2967680393 235
272 iso_pu_bacteria 2967686174 2967689242 235
273 iso_pu_bacteria 2967693043 2967695920 235
274 iso_pu_bacteria 2967699805 2967701812 235
275 iso_pu_bacteria 2967706974 2967709964 235
276 iso_pu_bacteria 2967714385 2967717436 235
277 iso_pu_bacteria 2967721400 2967725480 235
278 iso_pu_bacteria 2967728569 2967729409 235
279 iso_pu_bacteria 2967735183 2967735813 235
280 iso_pu_bacteria 2967742019 2967744568 235
281 iso_pu_bacteria 2967748971 2967750778 235
282 iso_pu_bacteria 2967755722 2967758588 235
283 iso_pu_bacteria 2967762386 2967764937 235
284 iso_pu_bacteria 2967769361 2967774969 235
285 iso_pu_bacteria 2967775926 2967779484 235
286 iso_pu_bacteria 2970019648 2970025579 235
287 iso_pu_bacteria 2970026789 2970028101 235
288 iso_pu_bacteria 2970033650 2970036892 235
289 iso_pu_bacteria 2970040964 2970043788 235
290 iso_pu_bacteria 2970047711 2970049907 235
291 iso_pu_bacteria 2970054988 2970058533 235
292 iso_pu_bacteria 2970061556 2970066786 235
293 iso_pu_bacteria 2970068827 2970073554 235
294 iso_pu_bacteria 2970076120 2970078552 235
295 iso_pu_bacteria 2970082768 2970086535 235
296 iso_pu_bacteria 2970088815 2970090578 235
297 iso_pu_bacteria 2970095765 2970098492 235
298 iso_pu_bacteria 2970102677 2970104051 235
299 iso_pu_bacteria 2970109326 2970111711 235
300 iso_pu_bacteria 2970116247 2970118802 235
301 iso_pu_bacteria 2970122695 2970126131 235
302 iso_pu_bacteria 2970129317 2970132017 235
303 iso_pu_bacteria 2970136068 2970139164 235
304 iso_pu_bacteria 2970143518 2970145768 235
305 iso_pu_bacteria 2970149975 2970152370 235
306 iso_pu_bacteria 2970156795 2970161480 235
307 iso_pu_bacteria 2970164137 2970164451 235
308 iso_pu_bacteria 2970170962 2970175256 235
309 iso_pu_bacteria 2970177841 2970180631 235
310 iso_pu_bacteria 2970184632 2970187047 235
311 iso_pu_bacteria 2970191845 2970194755 235
312 iso_pu_bacteria 2977516862 2977523163 235
313 iso_pu_bacteria 2977523885 2977524782 235
314 iso_pu_bacteria 2977530762 2977536484 235
315 iso_pu_bacteria 2977537788 2977541163 235
316 iso_pu_bacteria 2977544691 2977550446 235
317 iso_pu_bacteria 2977551784 2977553739 235
318 iso_pu_bacteria 2977558990 2977562567 235
319 iso_pu_bacteria 2977565890 2977566657 235
320 iso_pu_bacteria 2977572785 2977576027 235
321 iso_pu_bacteria 2977579622 2977584802 235
322 iso_pu_bacteria 643692032 643826518 235
323 iso_pu_bacteria 648276728 648738151 235
324 iso_pu_bacteria 8003992118 8003994350 235
325 iso_pu_bacteria 8003999396 8004002050 235
326 iso_pu_bacteria 8049293176 8049295490 235
327 3300005548 Ga0070665_100079670 Ga0070665_1000796704 236
328 3300009545 Ga0105237_10389907 Ga0105237_103899072 236
329 3300010375 Ga0105239_10631506 Ga0105239_106315061 236
330 3300025914 Ga0207671_10000168 Ga0207671_100001684 236
331 3300028379 Ga0268266_10000974 Ga0268266_1000097421 236
332 3300028577 Ga0265318_10008149 Ga0265318_100081493 236
333 3300031238 Ga0265332_10131949 Ga0265332_101319491 236
334 3300031250 Ga0265331_10116709 Ga0265331_101167091 236
335 3300031711 Ga0265314_10113565 Ga0265314_101135652 236
336 3300005539 Ga0068853_100005868 Ga0068853_1000058683 237
337 3300009093 Ga0105240_11109369 Ga0105240_111093691 237
338 3300025935 Ga0207709_10400876 Ga0207709_104008761 237
339 3300026041 Ga0207639_10003202 Ga0207639_100032028 237
340 3300031251 Ga0265327_10025596 Ga0265327_100255962 237
341 3300005344 Ga0070661_100087059 Ga0070661_1000870592 238
342 3300005539 Ga0068853_100021267 Ga0068853_1000212673 238
343 3300005547 Ga0070693_100337257 Ga0070693_1003372571 238
344 3300005578 Ga0068854_100004119 Ga0068854_1000041194 238
345 3300005616 Ga0068852_100739334 Ga0068852_1007393341 238
346 3300005834 Ga0068851_10001353 Ga0068851_100013535 238
347 3300009551 Ga0105238_10142990 Ga0105238_101429902 238
348 3300010375 Ga0105239_10339282 Ga0105239_103392821 238
349 3300013102 Ga0157371_10008701 Ga0157371_100087017 238
350 3300013105 Ga0157369_10107753 Ga0157369_101077533 238
351 3300025321 Ga0207656_10036130 Ga0207656_100361303 238
352 3300025920 Ga0207649_10019256 Ga0207649_100192565 238
353 3300025924 Ga0207694_10151539 Ga0207694_101515392 238
354 3300025981 Ga0207640_10019140 Ga0207640_100191404 238
355 3300026041 Ga0207639_10016071 Ga0207639_100160713 238
356 3300048919 Ga0496116_0000345 Ga0496116_0000345_55736_56452 238
357 3300048925 Ga0496122_0031671 Ga0496122_0031671_1632_2348 238
358 3300048927 Ga0496124_0124925 Ga0496124_0124925_390_1106 238
359 3300048929 Ga0496126_0000166 Ga0496126_0000166_110090_110806 238
360 3300003775 Ga0055524_1007216 Ga0055524_10072164 239
361 3300005327 Ga0070658_10028815 Ga0070658_100288153 239
362 3300005328 Ga0070676_10114729 Ga0070676_101147291 239
363 3300005339 Ga0070660_100007312 Ga0070660_1000073122 239
364 3300005344 Ga0070661_100118284 Ga0070661_1001182841 239
365 3300005356 Ga0070674_100018626 Ga0070674_1000186266 239
366 3300005364 Ga0070673_100270425 Ga0070673_1002704252 239
367 3300005366 Ga0070659_100134843 Ga0070659_1001348432 239
368 3300005456 Ga0070678_100386811 Ga0070678_1003868112 239
369 3300005458 Ga0070681_10481286 Ga0070681_104812861 239
370 3300005459 Ga0068867_100079216 Ga0068867_1000792162 239
371 3300005535 Ga0070684_100472492 Ga0070684_1004724921 239
372 3300005539 Ga0068853_100224233 Ga0068853_1002242332 239
373 3300005543 Ga0070672_100280330 Ga0070672_1002803302 239
374 3300005548 Ga0070665_100135251 Ga0070665_1001352513 239
375 3300005564 Ga0070664_100044757 Ga0070664_1000447572 239
376 3300005577 Ga0068857_100135825 Ga0068857_1001358252 239
377 3300005578 Ga0068854_100183163 Ga0068854_1001831631 239
378 3300005616 Ga0068852_100011748 Ga0068852_1000117482 239
379 3300005834 Ga0068851_10048837 Ga0068851_100488372 239
380 3300006048 Ga0075363_100021685 Ga0075363_1000216853 239
381 3300006051 Ga0075364_10009213 Ga0075364_100092133 239
382 3300006177 Ga0075362_10016771 Ga0075362_100167714 239
383 3300006358 Ga0068871_100532818 Ga0068871_1005328182 239
384 3300009098 Ga0105245_10577109 Ga0105245_105771092 239
385 3300009174 Ga0105241_10070538 Ga0105241_100705382 239
386 3300009551 Ga0105238_10055782 Ga0105238_100557823 239
387 3300009551 Ga0105238_10064718 Ga0105238_100647185 239
388 3300010375 Ga0105239_10141721 Ga0105239_101417213 239
389 3300013100 Ga0157373_10094048 Ga0157373_100940482 239
390 3300013104 Ga0157370_10049755 Ga0157370_100497552 239
391 3300013105 Ga0157369_10004287 Ga0157369_1000428724 239
392 3300013297 Ga0157378_10314096 Ga0157378_103140962 239
393 3300013307 Ga0157372_10307895 Ga0157372_103078953 239
394 3300013308 Ga0157375_11009931 Ga0157375_110099312 239
395 3300021320 Ga0214544_1000010 Ga0214544_100001095 239
396 3300021321 Ga0214542_1000023 Ga0214542_1000023157 239
397 3300021327 Ga0214543_1000019 Ga0214543_1000019232 239
398 3300022739 Ga0228711_1000026 Ga0228711_100002658 239
399 3300022740 Ga0228710_1000005 Ga0228710_100000570 239
400 3300025294 Ga0209025_1038041 Ga0209025_10380412 239
401 3300025321 Ga0207656_10121371 Ga0207656_101213712 239
402 3300025909 Ga0207705_10074697 Ga0207705_100746972 239
403 3300025911 Ga0207654_10052187 Ga0207654_100521872 239
404 3300025911 Ga0207654_10390080 Ga0207654_103900801 239
405 3300025927 Ga0207687_10627778 Ga0207687_106277781 239
406 3300025932 Ga0207690_10040882 Ga0207690_100408823 239
407 3300025932 Ga0207690_10144811 Ga0207690_101448112 239
408 3300025944 Ga0207661_10010448 Ga0207661_100104482 239
409 3300025945 Ga0207679_10035646 Ga0207679_100356462 239
410 3300025949 Ga0207667_10002226 Ga0207667_1000222616 239
411 3300025949 Ga0207667_10232240 Ga0207667_102322402 239
412 3300025960 Ga0207651_10018598 Ga0207651_100185982 239
413 3300025981 Ga0207640_10163668 Ga0207640_101636681 239
414 3300026041 Ga0207639_10020528 Ga0207639_100205282 239
415 3300026078 Ga0207702_10177790 Ga0207702_101777902 239
416 3300026089 Ga0207648_10070458 Ga0207648_100704583 239
417 3300026116 Ga0207674_10008220 Ga0207674_1000822017 239
418 3300026121 Ga0207683_10056409 Ga0207683_100564096 239
419 3300026142 Ga0207698_10902567 Ga0207698_109025671 239
420 3300027111 Ga0209281_1000082 Ga0209281_100008218 239
421 3300027111 Ga0209281_1000380 Ga0209281_100038028 239
422 3300027666 Ga0209282_1000006 Ga0209282_100000640 239
423 3300031911 Ga0307412_10055162 Ga0307412_100551623 239
424 3300031967 Ga0315914_1000003 Ga0315914_100000395 239
425 3300033430 Ga0315913_1000001 Ga0315913_100000147 239
426 3300033464 Ga0315915_1000008 Ga0315915_1000008241 239
427 3300035090 Ga0373949_0028647 Ga0373949_0028647_506_1261 239
428 3300035112 Ga0373932_0007615 Ga0373932_0007615_1434_2189 239
429 3300035207 Ga0373942_0019812 Ga0373942_0019812_666_1421 239
430 3300035691 Ga0373931_0048228 Ga0373931_0048228_446_1201 239
431 3300037068 Ga0373925_0235424 Ga0373925_0235424_281_1024 239
432 3300046492 Ga0495585_0013349 Ga0495585_0013349_3103_3822 239
433 3300046507 Ga0495606_0114458 Ga0495606_0114458_762_1481 239
434 3300046558 Ga0495633_0074988 Ga0495633_0074988_371_1090 239
435 3300046660 Ga0495625_0042696 Ga0495625_0042696_1022_1741 239
436 3300046665 Ga0495661_0067901 Ga0495661_0067901_379_1098 239
437 3300047472 Ga0495686_0027154 Ga0495686_0027154_991_1710 239
438 3300048920 Ga0496117_0013185 Ga0496117_0013185_30_749 239
439 3300048920 Ga0496117_0029331 Ga0496117_0029331_157_876 239
440 3300048921 Ga0496118_0115277 Ga0496118_0115277_365_1084 239
441 3300048923 Ga0496120_0004673 Ga0496120_0004673_9301_10020 239
442 3300048924 Ga0496121_0380103 Ga0496121_0380103_196_915 239
443 3300048926 Ga0496123_0077959 Ga0496123_0077959_1169_1888 239
444 3300048927 Ga0496124_0007874 Ga0496124_0007874_8253_8972 239
445 3300048928 Ga0496125_0000039 Ga0496125_0000039_296128_296847 239
446 3300048929 Ga0496126_0442401 Ga0496126_0442401_267_986 239
447 3300049571 Ga0501034_0183692 Ga0501034_0183692_871_1626 239
448 3300050490 nmdc:mga03n38_5289_c1 nmdc:mga03n38_5289_c1_703_1452 239
449 3300050491 nmdc:mga00v17_310968_c1 nmdc:mga00v17_310968_c1_75_794 239
450 3300050496 nmdc:mga07m45_94480_c1 nmdc:mga07m45_94480_c1_649_1398 239
451 3300009093 Ga0105240_10000014 Ga0105240_10000014354 242
452 3300009177 Ga0105248_10116604 Ga0105248_101166043 242
453 3300009545 Ga0105237_10001173 Ga0105237_1000117328 242
454 3300010375 Ga0105239_10012306 Ga0105239_100123064 242
455 3300013104 Ga0157370_10007309 Ga0157370_1000730910 242
456 3300014497 Ga0182008_10060560 Ga0182008_100605602 242
457 3300015262 Ga0182007_10001370 Ga0182007_1000137010 242
458 3300048919 Ga0496116_0060687 Ga0496116_0060687_1379_2131 242
459 3300048924 Ga0496121_0002066 Ga0496121_0002066_27220_27972 242
460 3300048927 Ga0496124_0164358 Ga0496124_0164358_502_1254 242
461 3300025299 Ga0209256_1000153 Ga0209256_100015333 243
462 3300048928 Ga0496125_0118615 Ga0496125_0118615_31_786 243
463 iso_pu_bacteria 2937036028 2937038400 244
464 3300042007 Ga0439449_0002534 Ga0439449_0002534_4632_5369 245
465 3300009545 Ga0105237_10001389 Ga0105237_1000138923 250
466 3300010375 Ga0105239_10001103 Ga0105239_1000110329 250
467 3300014969 Ga0157376_10291169 Ga0157376_102911692 250
468 3300002987 JGI25159J45721_1000004 JGI25159J45721_1000004113 254
469 3300003187 JGI25151J46595_10005712 JGI25151J46595_100057128 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

17

198

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nea-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from francisella tularensis 0.944 16 190
1ryb-assembly1.cif.gz_A crystal structure of the chloroplast group ii intron splicing factor crs2 0.9389 16 191
3ofv-assembly1.cif.gz_C crystal structure of peptidyl-trna hydrolase from escherichia coli, i222 crystal form 0.9371 15 187
4zxp-assembly3.cif.gz_A crystal structure of peptidyl- trna hydrolase from vibrio cholerae 0.933 16 198
8axp-assembly1.cif.gz_B neisseria gonorrhoeae peptidyl-trna hydrolase complexed with an xchem hit. 0.9316 17 198
ID Description Score Start End Superfamily
3neaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.944 16 190 3.40.50.1470
af_F1M8A9_28_144_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9351 16 122 3.40.50.1470
5ektA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9263 16 198 3.40.50.1470
5zx8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9181 16 188 3.40.50.1470
af_Q86Y79_27_209_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9168 16 191 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A527ZGE1-F1-model_v4 Peptidyl-tRNA hydrolase 0.9965 16 94 GO:0004045
AF-A0A7C5PJ52-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9933 16 123 GO:0004045
AF-A0A434SHI8-F1-model_v4 Peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9901 16 193 GO:0004045
AF-A0A7C1P4V1-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9889 16 166 GO:0004045
GO:0005737
GO:0006412
AF-A0A3D6AAE0-F1-model_v4 deleted 0.9851 16 118

Feature Viewer

pLDDT pTM Quality
83.48 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map