F450175
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 469 | 221 | 469 | 110 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_101142603|Ga0070680_1011426032 |
| Length | 113 |
| Sequence | MCRMKALKYLAIAAVAAFGVSSALADEGAIPLSLKDHKFTPVEIHVKANVANVLALTNADDTAEEFDSTSLKVEKVVASHSSGNVRLRPLAPGRYPFMGEYHADTAQGVVIAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 139 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 140 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 141 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 142 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 143 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 144 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 145 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 146 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 147 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 149 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 150 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 151 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 153 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 155 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 159 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 160 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 161 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 162 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 163 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 164 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 186 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 187 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 188 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 189 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 216 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 217 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 218 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 219 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 220 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.49 |
| Nodule | 0 |
| Rhizoplane | 1.07 |
| Rhizosphere | 96.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10006544 | 3300005327 | Bacteria | 9450 |
| 2 | Ga0070658_10040247 | 3300005327 | Bacteria | 3771 |
| 3 | Ga0070683_100078998 | 3300005329 | Bacteria | 3079 |
| 4 | Ga0070683_101038004 | 3300005329 | Bacteria | 787 |
| 5 | Ga0070670_100185581 | 3300005331 | Bacteria | 1806 |
| 6 | Ga0070670_100478130 | 3300005331 | Unclassified | 1106 |
| 7 | Ga0068869_100034305 | 3300005334 | Bacteria | 3588 |
| 8 | Ga0070666_10006798 | 3300005335 | Bacteria | 7046 |
| 9 | Ga0070666_10103805 | 3300005335 | Bacteria | 1961 |
| 10 | Ga0070680_100334338 | 3300005336 | Bacteria | 1287 |
| 11 | Ga0070680_101142603 | 3300005336 | Bacteria | 673 |
| 12 | Ga0070680_101588507 | 3300005336 | Bacteria | 567 |
| 13 | Ga0068868_100841024 | 3300005338 | Unclassified | 831 |
| 14 | Ga0068868_101038342 | 3300005338 | Unclassified | 751 |
| 15 | Ga0068868_102277480 | 3300005338 | Unclassified | 517 |
| 16 | Ga0070660_100055448 | 3300005339 | Bacteria | 3062 |
| 17 | Ga0070689_100921324 | 3300005340 | Bacteria | 774 |
| 18 | Ga0070691_10013912 | 3300005341 | Unclassified | 3693 |
| 19 | Ga0070661_100306402 | 3300005344 | Bacteria | 1237 |
| 20 | Ga0070661_100496478 | 3300005344 | Bacteria | 976 |
| 21 | Ga0070661_100817082 | 3300005344 | Bacteria | 766 |
| 22 | Ga0070669_102012672 | 3300005353 | Bacteria | 505 |
| 23 | Ga0070675_100044368 | 3300005354 | Bacteria | 3636 |
| 24 | Ga0070671_100364051 | 3300005355 | Unclassified | 1235 |
| 25 | Ga0070671_100888287 | 3300005355 | Bacteria | 778 |
| 26 | Ga0070671_101029001 | 3300005355 | Bacteria | 722 |
| 27 | Ga0070673_101281081 | 3300005364 | Bacteria | 688 |
| 28 | Ga0070659_100667325 | 3300005366 | Unclassified | 897 |
| 29 | Ga0070659_101549131 | 3300005366 | Unclassified | 591 |
| 30 | Ga0070667_100053625 | 3300005367 | Bacteria | 3403 |
| 31 | Ga0070709_10001661 | 3300005434 | Bacteria | 12067 |
| 32 | Ga0070714_100319652 | 3300005435 | Bacteria | 1451 |
| 33 | Ga0070713_100000008 | 3300005436 | Bacteria | 160153 |
| 34 | Ga0070710_10925302 | 3300005437 | Bacteria | 631 |
| 35 | Ga0070710_11283162 | 3300005437 | Bacteria | 544 |
| 36 | Ga0070701_10664557 | 3300005438 | Bacteria | 697 |
| 37 | Ga0070711_100322127 | 3300005439 | Bacteria | 1235 |
| 38 | Ga0070711_100578261 | 3300005439 | Bacteria | 935 |
| 39 | Ga0070705_100168848 | 3300005440 | Bacteria | 1470 |
| 40 | Ga0070694_101573869 | 3300005444 | Unclassified | 557 |
| 41 | Ga0070694_101807374 | 3300005444 | Bacteria | 521 |
| 42 | Ga0070708_101441379 | 3300005445 | Bacteria | 642 |
| 43 | Ga0070663_100499961 | 3300005455 | Bacteria | 1009 |
| 44 | Ga0070678_100009449 | 3300005456 | Bacteria | 5911 |
| 45 | Ga0070681_10166782 | 3300005458 | Bacteria | 2125 |
| 46 | Ga0070681_10667795 | 3300005458 | Unclassified | 954 |
| 47 | Ga0070681_10696653 | 3300005458 | Bacteria | 931 |
| 48 | Ga0070681_11228157 | 3300005458 | Bacteria | 672 |
| 49 | Ga0068867_100068675 | 3300005459 | Bacteria | 2645 |
| 50 | Ga0070706_100555279 | 3300005467 | Bacteria | 1068 |
| 51 | Ga0070707_100554103 | 3300005468 | Bacteria | 1112 |
| 52 | Ga0070679_100000062 | 3300005530 | Bacteria | 79849 |
| 53 | Ga0070679_100007554 | 3300005530 | Bacteria | 10168 |
| 54 | Ga0070679_100181382 | 3300005530 | Bacteria | 2078 |
| 55 | Ga0070684_100085580 | 3300005535 | Bacteria | 2796 |
| 56 | Ga0070684_100148818 | 3300005535 | Bacteria | 2120 |
| 57 | Ga0068853_100048135 | 3300005539 | Bacteria | 3661 |
| 58 | Ga0068853_100132572 | 3300005539 | Bacteria | 2232 |
| 59 | Ga0068853_100217237 | 3300005539 | Bacteria | 1745 |
| 60 | Ga0068853_100347206 | 3300005539 | Bacteria | 1380 |
| 61 | Ga0068853_100530372 | 3300005539 | Unclassified | 1114 |
| 62 | Ga0070672_100399963 | 3300005543 | Bacteria | 1177 |
| 63 | Ga0070672_100724717 | 3300005543 | Unclassified | 872 |
| 64 | Ga0070672_100995003 | 3300005543 | Bacteria | 743 |
| 65 | Ga0070695_100070767 | 3300005545 | Bacteria | 2283 |
| 66 | Ga0070693_100191458 | 3300005547 | Unclassified | 1323 |
| 67 | Ga0070693_100786431 | 3300005547 | Bacteria | 704 |
| 68 | Ga0070665_100000162 | 3300005548 | Bacteria | 122048 |
| 69 | Ga0070665_100022221 | 3300005548 | Bacteria | 6381 |
| 70 | Ga0070665_100042867 | 3300005548 | Bacteria | 4549 |
| 71 | Ga0070665_100078549 | 3300005548 | Bacteria | 3307 |
| 72 | Ga0070665_100176171 | 3300005548 | Bacteria | 2139 |
| 73 | Ga0070665_100976032 | 3300005548 | Unclassified | 860 |
| 74 | Ga0068855_100052376 | 3300005563 | Bacteria | 4805 |
| 75 | Ga0068855_100390133 | 3300005563 | Bacteria | 1527 |
| 76 | Ga0068855_100799551 | 3300005563 | Unclassified | 1002 |
| 77 | Ga0068855_101584107 | 3300005563 | Unclassified | 670 |
| 78 | Ga0070664_100182779 | 3300005564 | Bacteria | 1864 |
| 79 | Ga0070664_101424856 | 3300005564 | Unclassified | 655 |
| 80 | Ga0068857_100013915 | 3300005577 | Bacteria | 7003 |
| 81 | Ga0068857_100110600 | 3300005577 | Bacteria | 2469 |
| 82 | Ga0068857_100261971 | 3300005577 | Bacteria | 1587 |
| 83 | Ga0068854_100054518 | 3300005578 | Unclassified | 2876 |
| 84 | Ga0068854_101184110 | 3300005578 | Bacteria | 684 |
| 85 | Ga0068856_100000572 | 3300005614 | Bacteria | 40266 |
| 86 | Ga0068856_100015543 | 3300005614 | Bacteria | 7357 |
| 87 | Ga0068856_100067611 | 3300005614 | Unclassified | 3531 |
| 88 | Ga0068856_100504255 | 3300005614 | Unclassified | 1231 |
| 89 | Ga0068856_100558161 | 3300005614 | Bacteria | 1166 |
| 90 | Ga0068856_101595616 | 3300005614 | Unclassified | 666 |
| 91 | Ga0068852_100044610 | 3300005616 | Unclassified | 3767 |
| 92 | Ga0068852_100318083 | 3300005616 | Bacteria | 1511 |
| 93 | Ga0068859_100720335 | 3300005617 | Bacteria | 1088 |
| 94 | Ga0068859_101490677 | 3300005617 | Bacteria | 746 |
| 95 | Ga0068859_101774127 | 3300005617 | Unclassified | 682 |
| 96 | Ga0068864_100334521 | 3300005618 | Bacteria | 1425 |
| 97 | Ga0068866_10415624 | 3300005718 | Bacteria | 871 |
| 98 | Ga0068866_10427112 | 3300005718 | Bacteria | 861 |
| 99 | Ga0068861_100277549 | 3300005719 | Bacteria | 1442 |
| 100 | Ga0068870_10280417 | 3300005840 | Unclassified | 1044 |
| 101 | Ga0068870_11060237 | 3300005840 | Bacteria | 581 |
| 102 | Ga0068863_100049744 | 3300005841 | Bacteria | 3974 |
| 103 | Ga0068858_100015988 | 3300005842 | Bacteria | 7047 |
| 104 | Ga0068860_101371197 | 3300005843 | Bacteria | 728 |
| 105 | Ga0068862_102291891 | 3300005844 | Bacteria | 552 |
| 106 | Ga0070716_100522956 | 3300006173 | Bacteria | 879 |
| 107 | Ga0070712_100000202 | 3300006175 | Bacteria | 33503 |
| 108 | Ga0097621_100028354 | 3300006237 | Bacteria | 4413 |
| 109 | Ga0097621_100028776 | 3300006237 | Bacteria | 4382 |
| 110 | Ga0097621_100177464 | 3300006237 | Bacteria | 1839 |
| 111 | Ga0097621_100327616 | 3300006237 | Bacteria | 1358 |
| 112 | Ga0097621_100427531 | 3300006237 | Bacteria | 1190 |
| 113 | Ga0097621_100487497 | 3300006237 | Unclassified | 1115 |
| 114 | Ga0097621_100597927 | 3300006237 | Bacteria | 1008 |
| 115 | Ga0097621_100652746 | 3300006237 | Unclassified | 965 |
| 116 | Ga0068871_100001780 | 3300006358 | Bacteria | 14513 |
| 117 | Ga0068871_100042958 | 3300006358 | Bacteria | 3631 |
| 118 | Ga0068871_100077839 | 3300006358 | Bacteria | 2741 |
| 119 | Ga0068871_100145317 | 3300006358 | Bacteria | 2018 |
| 120 | Ga0068871_100151664 | 3300006358 | Bacteria | 1977 |
| 121 | Ga0068871_100378533 | 3300006358 | Unclassified | 1257 |
| 122 | Ga0068871_101901506 | 3300006358 | Bacteria | 566 |
| 123 | Ga0068871_102310066 | 3300006358 | Unclassified | 513 |
| 124 | Ga0075434_100095266 | 3300006871 | Bacteria | 2982 |
| 125 | Ga0068865_100046430 | 3300006881 | Bacteria | 2980 |
| 126 | Ga0068865_100121596 | 3300006881 | Bacteria | 1942 |
| 127 | Ga0068865_100174416 | 3300006881 | Bacteria | 1651 |
| 128 | Ga0075436_100000053 | 3300006914 | Bacteria | 69483 |
| 129 | Ga0075436_100096140 | 3300006914 | Bacteria | 2061 |
| 130 | Ga0075436_100698944 | 3300006914 | Bacteria | 751 |
| 131 | Ga0097620_100720306 | 3300006931 | Bacteria | 1088 |
| 132 | Ga0097620_101490753 | 3300006931 | Bacteria | 746 |
| 133 | Ga0097620_101774106 | 3300006931 | Unclassified | 682 |
| 134 | Ga0075435_100187090 | 3300007076 | Unclassified | 1751 |
| 135 | Ga0105240_10022148 | 3300009093 | Bacteria | 8432 |
| 136 | Ga0105240_10056354 | 3300009093 | Bacteria | 4919 |
| 137 | Ga0105240_10173084 | 3300009093 | Bacteria | 2555 |
| 138 | Ga0105240_10184284 | 3300009093 | Bacteria | 2460 |
| 139 | Ga0105240_10323719 | 3300009093 | Bacteria | 1756 |
| 140 | Ga0105240_10423820 | 3300009093 | Bacteria | 1494 |
| 141 | Ga0105240_12348579 | 3300009093 | Bacteria | 552 |
| 142 | Ga0105245_10149270 | 3300009098 | Unclassified | 2209 |
| 143 | Ga0105245_10905530 | 3300009098 | Bacteria | 924 |
| 144 | Ga0105245_10956167 | 3300009098 | Bacteria | 900 |
| 145 | Ga0105245_11867282 | 3300009098 | Unclassified | 654 |
| 146 | Ga0105247_10950345 | 3300009101 | Unclassified | 667 |
| 147 | Ga0105243_10014852 | 3300009148 | Bacteria | 5892 |
| 148 | Ga0105243_10082244 | 3300009148 | Bacteria | 2631 |
| 149 | Ga0105241_10089324 | 3300009174 | Unclassified | 2427 |
| 150 | Ga0105241_10193152 | 3300009174 | Bacteria | 1695 |
| 151 | Ga0105241_10194581 | 3300009174 | Unclassified | 1690 |
| 152 | Ga0105241_10293765 | 3300009174 | Bacteria | 1392 |
| 153 | Ga0105241_10317230 | 3300009174 | Unclassified | 1343 |
| 154 | Ga0105241_10576172 | 3300009174 | Bacteria | 1014 |
| 155 | Ga0105241_10947444 | 3300009174 | Bacteria | 802 |
| 156 | Ga0105242_10019128 | 3300009176 | Bacteria | 5365 |
| 157 | Ga0105242_10166737 | 3300009176 | Unclassified | 1933 |
| 158 | Ga0105242_10219179 | 3300009176 | Bacteria | 1699 |
| 159 | Ga0105242_10392234 | 3300009176 | Bacteria | 1293 |
| 160 | Ga0105242_10406682 | 3300009176 | Unclassified | 1272 |
| 161 | Ga0105242_11119308 | 3300009176 | Bacteria | 802 |
| 162 | Ga0105242_11761678 | 3300009176 | Bacteria | 657 |
| 163 | Ga0105248_10028228 | 3300009177 | Bacteria | 6250 |
| 164 | Ga0105248_10161295 | 3300009177 | Bacteria | 2529 |
| 165 | Ga0105248_10573885 | 3300009177 | Bacteria | 1273 |
| 166 | Ga0105248_10846506 | 3300009177 | Bacteria | 1032 |
| 167 | Ga0105237_10231864 | 3300009545 | Bacteria | 1847 |
| 168 | Ga0105237_10299045 | 3300009545 | Bacteria | 1612 |
| 169 | Ga0105237_10467518 | 3300009545 | Bacteria | 1267 |
| 170 | Ga0105237_10623863 | 3300009545 | Unclassified | 1085 |
| 171 | Ga0105237_10962954 | 3300009545 | Unclassified | 860 |
| 172 | Ga0105237_12309962 | 3300009545 | Bacteria | 548 |
| 173 | Ga0105238_10002176 | 3300009551 | Bacteria | 19789 |
| 174 | Ga0105238_10271473 | 3300009551 | Bacteria | 1676 |
| 175 | Ga0105238_10821584 | 3300009551 | Bacteria | 946 |
| 176 | Ga0105238_11640282 | 3300009551 | Unclassified | 673 |
| 177 | Ga0105238_11992130 | 3300009551 | Unclassified | 614 |
| 178 | Ga0105238_12411923 | 3300009551 | Unclassified | 562 |
| 179 | Ga0105249_10033055 | 3300009553 | Bacteria | 4683 |
| 180 | Ga0105239_10000400 | 3300010375 | Bacteria | 63699 |
| 181 | Ga0105239_10116436 | 3300010375 | Plasmid | 2966 |
| 182 | Ga0105239_10336369 | 3300010375 | Bacteria | 1704 |
| 183 | Ga0105239_10411292 | 3300010375 | Unclassified | 1532 |
| 184 | Ga0105239_11283323 | 3300010375 | Unclassified | 845 |
| 185 | Ga0105239_11778736 | 3300010375 | Bacteria | 714 |
| 186 | Ga0105246_10055476 | 3300011119 | Unclassified | 2734 |
| 187 | Ga0105246_10073239 | 3300011119 | Unclassified | 2418 |
| 188 | Ga0105246_11708264 | 3300011119 | Unclassified | 598 |
| 189 | Ga0157373_10013979 | 3300013100 | Bacteria | 5886 |
| 190 | Ga0157373_10078924 | 3300013100 | Unclassified | 2321 |
| 191 | Ga0157370_10014830 | 3300013104 | Bacteria | 7953 |
| 192 | Ga0157370_11111593 | 3300013104 | Bacteria | 714 |
| 193 | Ga0157369_10041905 | 3300013105 | Unclassified | 4996 |
| 194 | Ga0157369_10104810 | 3300013105 | Bacteria | 3011 |
| 195 | Ga0157369_10109236 | 3300013105 | Bacteria | 2941 |
| 196 | Ga0157369_10344048 | 3300013105 | Bacteria | 1549 |
| 197 | Ga0157369_10446314 | 3300013105 | Bacteria | 1340 |
| 198 | Ga0157369_12694310 | 3300013105 | Unclassified | 501 |
| 199 | Ga0157374_10108049 | 3300013296 | Bacteria | 2674 |
| 200 | Ga0157374_10252724 | 3300013296 | Bacteria | 1735 |
| 201 | Ga0157374_10656849 | 3300013296 | Bacteria | 1060 |
| 202 | Ga0157374_10876954 | 3300013296 | Bacteria | 915 |
| 203 | Ga0157378_10109029 | 3300013297 | Bacteria | 2536 |
| 204 | Ga0157378_10210952 | 3300013297 | Bacteria | 1841 |
| 205 | Ga0157378_10261092 | 3300013297 | Bacteria | 1662 |
| 206 | Ga0157378_10472086 | 3300013297 | Bacteria | 1248 |
| 207 | Ga0157378_10615012 | 3300013297 | Bacteria | 1099 |
| 208 | Ga0157378_11320052 | 3300013297 | Bacteria | 763 |
| 209 | Ga0163162_10032167 | 3300013306 | Bacteria | 5208 |
| 210 | Ga0163162_10214583 | 3300013306 | Bacteria | 2054 |
| 211 | Ga0163162_10563663 | 3300013306 | Unclassified | 1266 |
| 212 | Ga0163162_10565746 | 3300013306 | Bacteria | 1264 |
| 213 | Ga0163162_11016194 | 3300013306 | Bacteria | 938 |
| 214 | Ga0157372_10111793 | 3300013307 | Bacteria | 3130 |
| 215 | Ga0157372_10254033 | 3300013307 | Bacteria | 2041 |
| 216 | Ga0157372_10576043 | 3300013307 | Bacteria | 1312 |
| 217 | Ga0157372_11212643 | 3300013307 | Bacteria | 872 |
| 218 | Ga0157372_12692474 | 3300013307 | Unclassified | 571 |
| 219 | Ga0157372_12854445 | 3300013307 | Unclassified | 554 |
| 220 | Ga0157375_10049592 | 3300013308 | Bacteria | 4115 |
| 221 | Ga0157375_11526700 | 3300013308 | Bacteria | 789 |
| 222 | Ga0157375_11545527 | 3300013308 | Bacteria | 784 |
| 223 | Ga0163163_10000002 | 3300014325 | Bacteria | 609846 |
| 224 | Ga0163163_10255226 | 3300014325 | Bacteria | 1804 |
| 225 | Ga0163163_10348214 | 3300014325 | Bacteria | 1537 |
| 226 | Ga0163163_10565052 | 3300014325 | Bacteria | 1200 |
| 227 | Ga0157377_10080869 | 3300014745 | Bacteria | 1899 |
| 228 | Ga0157379_10031995 | 3300014968 | Unclassified | 4688 |
| 229 | Ga0157379_10049747 | 3300014968 | Bacteria | 3742 |
| 230 | Ga0157379_10063225 | 3300014968 | Bacteria | 3310 |
| 231 | Ga0157379_10149907 | 3300014968 | Bacteria | 2103 |
| 232 | Ga0157379_10915661 | 3300014968 | Unclassified | 832 |
| 233 | Ga0157376_10021304 | 3300014969 | Bacteria | 5033 |
| 234 | Ga0157376_10138855 | 3300014969 | Bacteria | 2178 |
| 235 | Ga0157376_10490117 | 3300014969 | Bacteria | 1206 |
| 236 | Ga0157376_10520946 | 3300014969 | Bacteria | 1172 |
| 237 | Ga0157376_10534183 | 3300014969 | Unclassified | 1158 |
| 238 | Ga0157376_10996141 | 3300014969 | Unclassified | 860 |
| 239 | Ga0207642_10427665 | 3300025899 | Bacteria | 798 |
| 240 | Ga0207680_10043432 | 3300025903 | Bacteria | 2636 |
| 241 | Ga0207680_10223103 | 3300025903 | Unclassified | 1293 |
| 242 | Ga0207699_10000115 | 3300025906 | Bacteria | 56719 |
| 243 | Ga0207645_10011595 | 3300025907 | Bacteria | 6011 |
| 244 | Ga0207645_10204363 | 3300025907 | Bacteria | 1300 |
| 245 | Ga0207705_10012953 | 3300025909 | Bacteria | 6019 |
| 246 | Ga0207705_10407147 | 3300025909 | Bacteria | 1052 |
| 247 | Ga0207654_10275698 | 3300025911 | Bacteria | 1136 |
| 248 | Ga0207654_10452955 | 3300025911 | Bacteria | 900 |
| 249 | Ga0207654_10647621 | 3300025911 | Unclassified | 757 |
| 250 | Ga0207707_10000002 | 3300025912 | Bacteria | 1142054 |
| 251 | Ga0207707_10100569 | 3300025912 | Bacteria | 2527 |
| 252 | Ga0207707_10128952 | 3300025912 | Bacteria | 2212 |
| 253 | Ga0207707_10280025 | 3300025912 | Bacteria | 1445 |
| 254 | Ga0207707_10838708 | 3300025912 | Bacteria | 763 |
| 255 | Ga0207695_10113494 | 3300025913 | Unclassified | 2686 |
| 256 | Ga0207695_10277986 | 3300025913 | Bacteria | 1568 |
| 257 | Ga0207695_10279645 | 3300025913 | Bacteria | 1563 |
| 258 | Ga0207695_11354913 | 3300025913 | Bacteria | 592 |
| 259 | Ga0207671_10148854 | 3300025914 | Bacteria | 1808 |
| 260 | Ga0207671_10194062 | 3300025914 | Unclassified | 1584 |
| 261 | Ga0207671_10452244 | 3300025914 | Bacteria | 1023 |
| 262 | Ga0207671_10532665 | 3300025914 | Bacteria | 936 |
| 263 | Ga0207671_10715973 | 3300025914 | Bacteria | 796 |
| 264 | Ga0207693_10000149 | 3300025915 | Bacteria | 64155 |
| 265 | Ga0207663_10227578 | 3300025916 | Bacteria | 1360 |
| 266 | Ga0207663_10321542 | 3300025916 | Bacteria | 1163 |
| 267 | Ga0207660_10000025 | 3300025917 | Bacteria | 69889 |
| 268 | Ga0207660_10257272 | 3300025917 | Bacteria | 1379 |
| 269 | Ga0207657_10029592 | 3300025919 | Bacteria | 4983 |
| 270 | Ga0207649_10000287 | 3300025920 | Bacteria | 39380 |
| 271 | Ga0207649_10171431 | 3300025920 | Bacteria | 1512 |
| 272 | Ga0207649_10749564 | 3300025920 | Unclassified | 760 |
| 273 | Ga0207649_10781787 | 3300025920 | Bacteria | 744 |
| 274 | Ga0207652_10000712 | 3300025921 | Bacteria | 32307 |
| 275 | Ga0207652_10039420 | 3300025921 | Bacteria | 4009 |
| 276 | Ga0207652_11612519 | 3300025921 | Bacteria | 553 |
| 277 | Ga0207652_11664481 | 3300025921 | Bacteria | 543 |
| 278 | Ga0207646_10477166 | 3300025922 | Bacteria | 1125 |
| 279 | Ga0207694_10207354 | 3300025924 | Bacteria | 1596 |
| 280 | Ga0207694_10287249 | 3300025924 | Bacteria | 1352 |
| 281 | Ga0207650_10386482 | 3300025925 | Bacteria | 1156 |
| 282 | Ga0207659_10038455 | 3300025926 | Bacteria | 3328 |
| 283 | Ga0207659_10288419 | 3300025926 | Unclassified | 1344 |
| 284 | Ga0207687_10079348 | 3300025927 | Unclassified | 2366 |
| 285 | Ga0207687_10146288 | 3300025927 | Bacteria | 1798 |
| 286 | Ga0207687_10605026 | 3300025927 | Bacteria | 924 |
| 287 | Ga0207700_10000017 | 3300025928 | Bacteria | 195983 |
| 288 | Ga0207700_10469444 | 3300025928 | Unclassified | 1111 |
| 289 | Ga0207644_10277087 | 3300025931 | Bacteria | 1346 |
| 290 | Ga0207644_10287216 | 3300025931 | Bacteria | 1322 |
| 291 | Ga0207644_10849238 | 3300025931 | Bacteria | 764 |
| 292 | Ga0207706_10709061 | 3300025933 | Bacteria | 859 |
| 293 | Ga0207686_10158062 | 3300025934 | Bacteria | 1586 |
| 294 | Ga0207686_10210353 | 3300025934 | Unclassified | 1398 |
| 295 | Ga0207709_10026699 | 3300025935 | Bacteria | 3319 |
| 296 | Ga0207704_10217276 | 3300025938 | Bacteria | 1412 |
| 297 | Ga0207704_10291720 | 3300025938 | Bacteria | 1245 |
| 298 | Ga0207665_10720621 | 3300025939 | Bacteria | 785 |
| 299 | Ga0207691_10480322 | 3300025940 | Bacteria | 1056 |
| 300 | Ga0207711_11146963 | 3300025941 | Unclassified | 718 |
| 301 | Ga0207689_10006791 | 3300025942 | Bacteria | 10072 |
| 302 | Ga0207689_10120773 | 3300025942 | Bacteria | 2155 |
| 303 | Ga0207679_10359616 | 3300025945 | Unclassified | 1271 |
| 304 | Ga0207679_10746913 | 3300025945 | Unclassified | 890 |
| 305 | Ga0207667_10223471 | 3300025949 | Bacteria | 1929 |
| 306 | Ga0207667_10595461 | 3300025949 | Bacteria | 1115 |
| 307 | Ga0207667_10634147 | 3300025949 | Bacteria | 1075 |
| 308 | Ga0207651_10007945 | 3300025960 | Bacteria | 5688 |
| 309 | Ga0207712_11723552 | 3300025961 | Bacteria | 562 |
| 310 | Ga0207640_11119972 | 3300025981 | Bacteria | 697 |
| 311 | Ga0207658_10158151 | 3300025986 | Unclassified | 1854 |
| 312 | Ga0207658_11163230 | 3300025986 | Bacteria | 705 |
| 313 | Ga0207677_10006801 | 3300026023 | Bacteria | 6278 |
| 314 | Ga0207677_10372439 | 3300026023 | Bacteria | 1203 |
| 315 | Ga0207703_10208803 | 3300026035 | Unclassified | 1740 |
| 316 | Ga0207703_11436622 | 3300026035 | Unclassified | 664 |
| 317 | Ga0207639_10213268 | 3300026041 | Bacteria | 1663 |
| 318 | Ga0207639_10232978 | 3300026041 | Bacteria | 1597 |
| 319 | Ga0207639_10421964 | 3300026041 | Bacteria | 1206 |
| 320 | Ga0207639_10618580 | 3300026041 | Bacteria | 1000 |
| 321 | Ga0207708_11200790 | 3300026075 | Bacteria | 663 |
| 322 | Ga0207702_10018397 | 3300026078 | Bacteria | 5780 |
| 323 | Ga0207702_10153045 | 3300026078 | Bacteria | 2100 |
| 324 | Ga0207702_10261132 | 3300026078 | Bacteria | 1631 |
| 325 | Ga0207702_10457114 | 3300026078 | Unclassified | 1240 |
| 326 | Ga0207702_11020837 | 3300026078 | Unclassified | 821 |
| 327 | Ga0207641_10326025 | 3300026088 | Unclassified | 1457 |
| 328 | Ga0207641_11185548 | 3300026088 | Bacteria | 763 |
| 329 | Ga0207648_10041671 | 3300026089 | Bacteria | 4032 |
| 330 | Ga0207674_10019953 | 3300026116 | Bacteria | 7253 |
| 331 | Ga0207674_10704251 | 3300026116 | Unclassified | 975 |
| 332 | Ga0207674_11362420 | 3300026116 | Bacteria | 679 |
| 333 | Ga0207674_11560016 | 3300026116 | Unclassified | 629 |
| 334 | Ga0207675_100370315 | 3300026118 | Bacteria | 1407 |
| 335 | Ga0207698_10071675 | 3300026142 | Bacteria | 2750 |
| 336 | Ga0268266_10003361 | 3300028379 | Bacteria | 16020 |
| 337 | Ga0268266_10008917 | 3300028379 | Bacteria | 8876 |
| 338 | Ga0268266_10090112 | 3300028379 | Bacteria | 2687 |
| 339 | Ga0268266_10292393 | 3300028379 | Bacteria | 1517 |
| 340 | Ga0268266_11488820 | 3300028379 | Unclassified | 652 |
| 341 | Ga0268265_11039004 | 3300028380 | Bacteria | 811 |
| 342 | Ga0268264_11028617 | 3300028381 | Bacteria | 831 |
| 343 | Ga0265338_10027063 | 3300028800 | Bacteria | 5763 |
| 344 | Ga0265330_10032808 | 3300031235 | Bacteria | 2326 |
| 345 | Ga0265330_10046154 | 3300031235 | Bacteria | 1920 |
| 346 | Ga0265332_10026666 | 3300031238 | Bacteria | 2534 |
| 347 | Ga0265332_10413437 | 3300031238 | Bacteria | 557 |
| 348 | Ga0265328_10117655 | 3300031239 | Bacteria | 990 |
| 349 | Ga0265320_10000042 | 3300031240 | Bacteria | 124844 |
| 350 | Ga0265325_10077334 | 3300031241 | Bacteria | 1659 |
| 351 | Ga0265325_10193009 | 3300031241 | Bacteria | 943 |
| 352 | Ga0265325_10334443 | 3300031241 | Bacteria | 671 |
| 353 | Ga0265340_10223253 | 3300031247 | Bacteria | 844 |
| 354 | Ga0265339_10045200 | 3300031249 | Bacteria | 2425 |
| 355 | Ga0265339_10301211 | 3300031249 | Unclassified | 764 |
| 356 | Ga0265331_10106136 | 3300031250 | Bacteria | 1290 |
| 357 | Ga0265316_10354917 | 3300031344 | Bacteria | 1061 |
| 358 | Ga0265314_10048205 | 3300031711 | Bacteria | 2991 |
| 359 | Ga0265314_10058474 | 3300031711 | Bacteria | 2641 |
| 360 | Ga0265314_10108192 | 3300031711 | Bacteria | 1772 |
| 361 | Ga0265342_10021183 | 3300031712 | Bacteria | 4156 |
| 362 | Ga0265342_10425268 | 3300031712 | Unclassified | 684 |
| 363 | Ga0307516_10140238 | 3300031730 | Bacteria | 2188 |
| 364 | Ga0373940_0259782 | 3300035088 | Bacteria | 588 |
| 365 | Ga0373932_0134646 | 3300035112 | Bacteria | 835 |
| 366 | Ga0373955_0179034 | 3300035172 | Bacteria | 1257 |
| 367 | Ga0373942_0040355 | 3300035207 | Unclassified | 1273 |
| 368 | Ga0373962_0177049 | 3300035242 | Unclassified | 711 |
| 369 | Ga0373935_0618069 | 3300035692 | Unclassified | 793 |
| 370 | Ga0373935_0638434 | 3300035692 | Bacteria | 780 |
| 371 | Ga0373933_0079387 | 3300035724 | Bacteria | 2009 |
| 372 | Ga0373937_0018988 | 3300036401 | Bacteria | 6149 |
| 373 | Ga0373937_1516330 | 3300036401 | Bacteria | 618 |
| 374 | Ga0395898_0056743 | 3300037466 | Bacteria | 3817 |
| 375 | Ga0395901_0364277 | 3300038443 | Bacteria | 1490 |
| 376 | Ga0436365_0725141 | 3300039437 | Bacteria | 824 |
| 377 | Ga0451795_1570088 | 3300041456 | Bacteria | 908 |
| 378 | Ga0451802_1918129 | 3300041460 | Bacteria | 630 |
| 379 | Ga0466967_0136809 | 3300045976 | Bacteria | 2279 |
| 380 | Ga0466967_0207816 | 3300045976 | Bacteria | 1856 |
| 381 | Ga0466967_1707679 | 3300045976 | Unclassified | 627 |
| 382 | Ga0495592_0838595 | 3300046454 | Bacteria | 544 |
| 383 | Ga0495653_0665204 | 3300046463 | Bacteria | 635 |
| 384 | Ga0495650_0052164 | 3300046471 | Bacteria | 1680 |
| 385 | Ga0495580_0334903 | 3300046472 | Bacteria | 1027 |
| 386 | Ga0495580_0503369 | 3300046472 | Bacteria | 808 |
| 387 | Ga0495594_0710724 | 3300046499 | Unclassified | 568 |
| 388 | Ga0495606_0316263 | 3300046507 | Bacteria | 840 |
| 389 | Ga0495616_0150963 | 3300046513 | Bacteria | 1051 |
| 390 | Ga0495628_0868322 | 3300046516 | Unclassified | 628 |
| 391 | Ga0495644_0151113 | 3300046523 | Bacteria | 889 |
| 392 | Ga0495652_0561929 | 3300046529 | Bacteria | 783 |
| 393 | Ga0495586_0395596 | 3300046535 | Bacteria | 795 |
| 394 | Ga0495587_0016626 | 3300046536 | Bacteria | 4576 |
| 395 | Ga0495622_0024612 | 3300046557 | Bacteria | 2811 |
| 396 | Ga0495667_0079645 | 3300046559 | Unclassified | 2130 |
| 397 | Ga0495634_0436686 | 3300046642 | Bacteria | 774 |
| 398 | Ga0495611_0112080 | 3300046648 | Bacteria | 1270 |
| 399 | Ga0495599_0240544 | 3300046678 | Bacteria | 1104 |
| 400 | Ga0495623_0185365 | 3300046679 | Bacteria | 1206 |
| 401 | Ga0495600_0867106 | 3300046809 | Bacteria | 534 |
| 402 | Ga0495675_0282594 | 3300047444 | Bacteria | 989 |
| 403 | Ga0495602_0280671 | 3300048088 | Unclassified | 1227 |
| 404 | Ga0496106_0739331 | 3300048909 | Bacteria | 783 |
| 405 | Ga0496107_0574618 | 3300048910 | Bacteria | 834 |
| 406 | Ga0496110_1298741 | 3300048913 | Bacteria | 637 |
| 407 | Ga0496126_0134801 | 3300048929 | Bacteria | 2131 |
| 408 | Ga0501031_0778878 | 3300049568 | Bacteria | 613 |
| 409 | Ga0501032_0041486 | 3300049569 | Bacteria | 3125 |
| 410 | Ga0501032_0500608 | 3300049569 | Unclassified | 776 |
| 411 | Ga0501033_0206647 | 3300049570 | Bacteria | 1401 |
| 412 | Ga0501033_0304450 | 3300049570 | Bacteria | 1121 |
| 413 | Ga0501034_0283104 | 3300049571 | Bacteria | 1597 |
| 414 | Ga0501034_0386258 | 3300049571 | Bacteria | 1324 |
| 415 | Ga0501036_0049607 | 3300049572 | Bacteria | 3554 |
| 416 | Ga0501037_0211885 | 3300049573 | Bacteria | 1366 |
| 417 | Ga0501038_0317811 | 3300049574 | Bacteria | 1219 |
| 418 | Ga0501038_0573027 | 3300049574 | Bacteria | 857 |
| 419 | Ga0501043_0076420 | 3300049579 | Bacteria | 2631 |
| 420 | Ga0501046_0558949 | 3300049580 | Bacteria | 815 |
| 421 | Ga0501046_0856915 | 3300049580 | Bacteria | 635 |
| 422 | Ga0501047_0037616 | 3300049581 | Bacteria | 4679 |
| 423 | Ga0501047_0061983 | 3300049581 | Bacteria | 3608 |
| 424 | Ga0501047_0143961 | 3300049581 | Bacteria | 2261 |
| 425 | Ga0501048_0029414 | 3300049582 | Bacteria | 3985 |
| 426 | Ga0501067_0010118 | 3300049583 | Bacteria | 5217 |
| 427 | Ga0501067_0018086 | 3300049583 | Bacteria | 3902 |
| 428 | Ga0501069_0005873 | 3300049585 | Bacteria | 6393 |
| 429 | Ga0501070_0033022 | 3300049586 | Bacteria | 4328 |
| 430 | Ga0501070_0357591 | 3300049586 | Unclassified | 1185 |
| 431 | Ga0501072_0059970 | 3300049588 | Bacteria | 3000 |
| 432 | Ga0501073_0022208 | 3300049589 | Bacteria | 4572 |
| 433 | Ga0501073_0025133 | 3300049589 | Bacteria | 4274 |
| 434 | Ga0501073_0061256 | 3300049589 | Bacteria | 2626 |
| 435 | Ga0501073_0621007 | 3300049589 | Unclassified | 746 |
| 436 | Ga0501074_0024317 | 3300049590 | Bacteria | 4402 |
| 437 | Ga0501079_0099807 | 3300049741 | Bacteria | 2250 |
| 438 | Ga0501079_0676818 | 3300049741 | Bacteria | 812 |
| 439 | Ga0501080_0101490 | 3300049742 | Bacteria | 2669 |
| 440 | Ga0501080_0325160 | 3300049742 | Bacteria | 1391 |
| 441 | Ga0501080_0360500 | 3300049742 | Bacteria | 1312 |
| 442 | Ga0501080_0464069 | 3300049742 | Bacteria | 1134 |
| 443 | Ga0501083_0260949 | 3300049744 | Bacteria | 1127 |
| 444 | Ga0501083_0459758 | 3300049744 | Bacteria | 828 |
| 445 | Ga0501035_0005667 | 3300049822 | Bacteria | 11792 |
| 446 | Ga0501035_0014394 | 3300049822 | Bacteria | 7301 |
| 447 | Ga0501035_0184264 | 3300049822 | Bacteria | 1797 |
| 448 | Ga0501035_0488243 | 3300049822 | Bacteria | 1015 |
| 449 | Ga0501044_0067624 | 3300049823 | Bacteria | 3640 |
| 450 | Ga0501044_0104294 | 3300049823 | Bacteria | 2849 |
| 451 | Ga0501044_0166521 | 3300049823 | Bacteria | 2178 |
| 452 | Ga0501045_0778742 | 3300049824 | Bacteria | 705 |
| 453 | nmdc:mga0n895_123408_c1 | 3300050512 | Bacteria | 2612 |
| 454 | nmdc:mga0n895_171124_c1 | 3300050512 | Bacteria | 2204 |
| 455 | nmdc:mga0rr50_394205_c1 | 3300050513 | Unclassified | 1169 |
| 456 | nmdc:mga0rr50_617122_c1 | 3300050513 | Bacteria | 925 |
| 457 | nmdc:mga08x19_406325_c1 | 3300050514 | Unclassified | 956 |
| 458 | nmdc:mga08x19_82_c1 | 3300050514 | Bacteria | 86410 |
| 459 | Ga0500595_012074 | 3300053119 | Bacteria | 3351 |
| 460 | Ga0500597_139117 | 3300053120 | Bacteria | 1047 |
| 461 | Ga0500597_277951 | 3300053120 | Bacteria | 676 |
| 462 | Ga0500642_0288341 | 3300053130 | Bacteria | 744 |
| 463 | Ga0500559_0037192 | 3300053136 | Bacteria | 2109 |
| 464 | Ga0500559_0133089 | 3300053136 | Bacteria | 1162 |
| 465 | Ga0500577_0027064 | 3300053142 | Bacteria | 1960 |
| 466 | Ga0501084_0021067 | 3300054114 | Bacteria | 5437 |
| 467 | Ga0501084_0051491 | 3300054114 | Bacteria | 3446 |
| 468 | Ga0501082_0384722 | 3300060353 | Bacteria | 1224 |
| 469 | Ga0501082_0419784 | 3300060353 | Bacteria | 1168 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005355 | Ga0070671_101029001 | Ga0070671_1010290012 | 98 |
| 2 | 3300005614 | Ga0068856_100504255 | Ga0068856_1005042552 | 98 |
| 3 | 3300005614 | Ga0068856_100558161 | Ga0068856_1005581611 | 98 |
| 4 | 3300006237 | Ga0097621_100487497 | Ga0097621_1004874972 | 98 |
| 5 | 3300006237 | Ga0097621_100597927 | Ga0097621_1005979272 | 98 |
| 6 | 3300006358 | Ga0068871_100042958 | Ga0068871_1000429584 | 98 |
| 7 | 3300006358 | Ga0068871_102310066 | Ga0068871_1023100661 | 98 |
| 8 | 3300013307 | Ga0157372_10111793 | Ga0157372_101117934 | 98 |
| 9 | 3300013307 | Ga0157372_10254033 | Ga0157372_102540333 | 98 |
| 10 | 3300013307 | Ga0157372_10576043 | Ga0157372_105760432 | 98 |
| 11 | 3300014969 | Ga0157376_10520946 | Ga0157376_105209462 | 98 |
| 12 | 3300014969 | Ga0157376_10996141 | Ga0157376_109961412 | 98 |
| 13 | 3300025931 | Ga0207644_10849238 | Ga0207644_108492381 | 98 |
| 14 | 3300026078 | Ga0207702_10457114 | Ga0207702_104571143 | 98 |
| 15 | 3300026078 | Ga0207702_11020837 | Ga0207702_110208372 | 98 |
| 16 | 3300045976 | Ga0466967_1707679 | Ga0466967_1707679_217_546 | 98 |
| 17 | 3300031730 | Ga0307516_10140238 | Ga0307516_101402382 | 103 |
| 18 | 3300046559 | Ga0495667_0079645 | Ga0495667_0079645_156_488 | 103 |
| 19 | 3300047444 | Ga0495675_0282594 | Ga0495675_0282594_365_697 | 103 |
| 20 | 3300049574 | Ga0501038_0317811 | Ga0501038_0317811_473_808 | 104 |
| 21 | 3300049822 | Ga0501035_0488243 | Ga0501035_0488243_418_753 | 104 |
| 22 | 3300005336 | Ga0070680_101142603 | Ga0070680_1011426032 | 105 |
| 23 | 3300005341 | Ga0070691_10013912 | Ga0070691_100139122 | 105 |
| 24 | 3300005344 | Ga0070661_100496478 | Ga0070661_1004964782 | 105 |
| 25 | 3300005366 | Ga0070659_100667325 | Ga0070659_1006673252 | 105 |
| 26 | 3300005434 | Ga0070709_10001661 | Ga0070709_100016619 | 105 |
| 27 | 3300005435 | Ga0070714_100319652 | Ga0070714_1003196521 | 105 |
| 28 | 3300005436 | Ga0070713_100000008 | Ga0070713_10000000852 | 105 |
| 29 | 3300005439 | Ga0070711_100322127 | Ga0070711_1003221272 | 105 |
| 30 | 3300005440 | Ga0070705_100168848 | Ga0070705_1001688482 | 105 |
| 31 | 3300005444 | Ga0070694_101573869 | Ga0070694_1015738691 | 105 |
| 32 | 3300005445 | Ga0070708_101441379 | Ga0070708_1014413792 | 105 |
| 33 | 3300005458 | Ga0070681_10667795 | Ga0070681_106677952 | 105 |
| 34 | 3300005467 | Ga0070706_100555279 | Ga0070706_1005552792 | 105 |
| 35 | 3300005468 | Ga0070707_100554103 | Ga0070707_1005541032 | 105 |
| 36 | 3300005535 | Ga0070684_100148818 | Ga0070684_1001488181 | 105 |
| 37 | 3300005539 | Ga0068853_100048135 | Ga0068853_1000481352 | 105 |
| 38 | 3300005545 | Ga0070695_100070767 | Ga0070695_1000707673 | 105 |
| 39 | 3300005547 | Ga0070693_100786431 | Ga0070693_1007864311 | 105 |
| 40 | 3300005563 | Ga0068855_100052376 | Ga0068855_1000523764 | 105 |
| 41 | 3300005564 | Ga0070664_101424856 | Ga0070664_1014248562 | 105 |
| 42 | 3300005577 | Ga0068857_100013915 | Ga0068857_1000139153 | 105 |
| 43 | 3300005578 | Ga0068854_100054518 | Ga0068854_1000545183 | 105 |
| 44 | 3300005614 | Ga0068856_100000572 | Ga0068856_10000057236 | 105 |
| 45 | 3300005614 | Ga0068856_100067611 | Ga0068856_1000676114 | 105 |
| 46 | 3300005616 | Ga0068852_100044610 | Ga0068852_1000446102 | 105 |
| 47 | 3300006173 | Ga0070716_100522956 | Ga0070716_1005229561 | 105 |
| 48 | 3300006175 | Ga0070712_100000202 | Ga0070712_10000020235 | 105 |
| 49 | 3300006871 | Ga0075434_100095266 | Ga0075434_1000952661 | 105 |
| 50 | 3300006914 | Ga0075436_100000053 | Ga0075436_10000005343 | 105 |
| 51 | 3300006914 | Ga0075436_100096140 | Ga0075436_1000961403 | 105 |
| 52 | 3300006914 | Ga0075436_100698944 | Ga0075436_1006989441 | 105 |
| 53 | 3300007076 | Ga0075435_100187090 | Ga0075435_1001870902 | 105 |
| 54 | 3300009093 | Ga0105240_10022148 | Ga0105240_100221488 | 105 |
| 55 | 3300009174 | Ga0105241_10194581 | Ga0105241_101945812 | 105 |
| 56 | 3300009174 | Ga0105241_10293765 | Ga0105241_102937651 | 105 |
| 57 | 3300009174 | Ga0105241_10947444 | Ga0105241_109474441 | 105 |
| 58 | 3300009545 | Ga0105237_10467518 | Ga0105237_104675182 | 105 |
| 59 | 3300009545 | Ga0105237_10962954 | Ga0105237_109629542 | 105 |
| 60 | 3300009551 | Ga0105238_10002176 | Ga0105238_100021763 | 105 |
| 61 | 3300010375 | Ga0105239_10116436 | Ga0105239_101164362 | 105 |
| 62 | 3300011119 | Ga0105246_11708264 | Ga0105246_117082641 | 105 |
| 63 | 3300013100 | Ga0157373_10013979 | Ga0157373_100139794 | 105 |
| 64 | 3300013105 | Ga0157369_10041905 | Ga0157369_100419055 | 105 |
| 65 | 3300013296 | Ga0157374_10656849 | Ga0157374_106568492 | 105 |
| 66 | 3300013296 | Ga0157374_10876954 | Ga0157374_108769542 | 105 |
| 67 | 3300013306 | Ga0163162_11016194 | Ga0163162_110161942 | 105 |
| 68 | 3300013307 | Ga0157372_11212643 | Ga0157372_112126431 | 105 |
| 69 | 3300013308 | Ga0157375_11526700 | Ga0157375_115267001 | 105 |
| 70 | 3300014325 | Ga0163163_10565052 | Ga0163163_105650522 | 105 |
| 71 | 3300014968 | Ga0157379_10031995 | Ga0157379_100319952 | 105 |
| 72 | 3300014968 | Ga0157379_10149907 | Ga0157379_101499072 | 105 |
| 73 | 3300025906 | Ga0207699_10000115 | Ga0207699_1000011517 | 105 |
| 74 | 3300025911 | Ga0207654_10275698 | Ga0207654_102756982 | 105 |
| 75 | 3300025911 | Ga0207654_10452955 | Ga0207654_104529552 | 105 |
| 76 | 3300025912 | Ga0207707_10128952 | Ga0207707_101289521 | 105 |
| 77 | 3300025913 | Ga0207695_10113494 | Ga0207695_101134943 | 105 |
| 78 | 3300025914 | Ga0207671_10148854 | Ga0207671_101488543 | 105 |
| 79 | 3300025915 | Ga0207693_10000149 | Ga0207693_1000014946 | 105 |
| 80 | 3300025916 | Ga0207663_10321542 | Ga0207663_103215422 | 105 |
| 81 | 3300025922 | Ga0207646_10477166 | Ga0207646_104771662 | 105 |
| 82 | 3300025924 | Ga0207694_10287249 | Ga0207694_102872492 | 105 |
| 83 | 3300025928 | Ga0207700_10000017 | Ga0207700_100000178 | 105 |
| 84 | 3300025939 | Ga0207665_10720621 | Ga0207665_107206211 | 105 |
| 85 | 3300025949 | Ga0207667_10223471 | Ga0207667_102234711 | 105 |
| 86 | 3300026035 | Ga0207703_11436622 | Ga0207703_114366222 | 105 |
| 87 | 3300026041 | Ga0207639_10232978 | Ga0207639_102329783 | 105 |
| 88 | 3300026078 | Ga0207702_10018397 | Ga0207702_100183972 | 105 |
| 89 | 3300026078 | Ga0207702_10261132 | Ga0207702_102611323 | 105 |
| 90 | 3300026116 | Ga0207674_10019953 | Ga0207674_100199534 | 105 |
| 91 | 3300026142 | Ga0207698_10071675 | Ga0207698_100716753 | 105 |
| 92 | 3300031241 | Ga0265325_10193009 | Ga0265325_101930092 | 105 |
| 93 | 3300035088 | Ga0373940_0259782 | Ga0373940_0259782_23_355 | 105 |
| 94 | 3300035112 | Ga0373932_0134646 | Ga0373932_0134646_228_560 | 105 |
| 95 | 3300035172 | Ga0373955_0179034 | Ga0373955_0179034_157_489 | 105 |
| 96 | 3300035207 | Ga0373942_0040355 | Ga0373942_0040355_659_991 | 105 |
| 97 | 3300035242 | Ga0373962_0177049 | Ga0373962_0177049_361_693 | 105 |
| 98 | 3300035692 | Ga0373935_0618069 | Ga0373935_0618069_444_776 | 105 |
| 99 | 3300035724 | Ga0373933_0079387 | Ga0373933_0079387_545_877 | 105 |
| 100 | 3300036401 | Ga0373937_0018988 | Ga0373937_0018988_5607_5939 | 105 |
| 101 | 3300046463 | Ga0495653_0665204 | Ga0495653_0665204_109_435 | 105 |
| 102 | 3300046472 | Ga0495580_0334903 | Ga0495580_0334903_428_760 | 105 |
| 103 | 3300046472 | Ga0495580_0503369 | Ga0495580_0503369_331_663 | 105 |
| 104 | 3300046678 | Ga0495599_0240544 | Ga0495599_0240544_313_639 | 105 |
| 105 | 3300046679 | Ga0495623_0185365 | Ga0495623_0185365_529_861 | 105 |
| 106 | 3300046809 | Ga0495600_0867106 | Ga0495600_0867106_157_483 | 105 |
| 107 | 3300048909 | Ga0496106_0739331 | Ga0496106_0739331_178_513 | 105 |
| 108 | 3300048913 | Ga0496110_1298741 | Ga0496110_1298741_197_532 | 105 |
| 109 | 3300048929 | Ga0496126_0134801 | Ga0496126_0134801_1301_1657 | 105 |
| 110 | 3300049568 | Ga0501031_0778878 | Ga0501031_0778878_132_461 | 105 |
| 111 | 3300049569 | Ga0501032_0500608 | Ga0501032_0500608_408_737 | 105 |
| 112 | 3300049570 | Ga0501033_0304450 | Ga0501033_0304450_609_938 | 105 |
| 113 | 3300049574 | Ga0501038_0573027 | Ga0501038_0573027_213_542 | 105 |
| 114 | 3300049581 | Ga0501047_0143961 | Ga0501047_0143961_678_1007 | 105 |
| 115 | 3300049586 | Ga0501070_0357591 | Ga0501070_0357591_834_1160 | 105 |
| 116 | 3300049822 | Ga0501035_0005667 | Ga0501035_0005667_4839_5168 | 105 |
| 117 | 3300049823 | Ga0501044_0067624 | Ga0501044_0067624_2903_3232 | 105 |
| 118 | 3300050512 | nmdc:mga0n895_123408_c1 | nmdc:mga0n895_123408_c1_220_552 | 105 |
| 119 | 3300050512 | nmdc:mga0n895_171124_c1 | nmdc:mga0n895_171124_c1_156_491 | 105 |
| 120 | 3300050513 | nmdc:mga0rr50_394205_c1 | nmdc:mga0rr50_394205_c1_763_1095 | 105 |
| 121 | 3300050513 | nmdc:mga0rr50_617122_c1 | nmdc:mga0rr50_617122_c1_383_718 | 105 |
| 122 | 3300050514 | nmdc:mga08x19_406325_c1 | nmdc:mga08x19_406325_c1_125_457 | 105 |
| 123 | 3300050514 | nmdc:mga08x19_82_c1 | nmdc:mga08x19_82_c1_29028_29363 | 105 |
| 124 | 3300005338 | Ga0068868_101038342 | Ga0068868_1010383421 | 106 |
| 125 | 3300005455 | Ga0070663_100499961 | Ga0070663_1004999612 | 106 |
| 126 | 3300005456 | Ga0070678_100009449 | Ga0070678_1000094497 | 106 |
| 127 | 3300005535 | Ga0070684_100085580 | Ga0070684_1000855801 | 106 |
| 128 | 3300005539 | Ga0068853_100530372 | Ga0068853_1005303722 | 106 |
| 129 | 3300005563 | Ga0068855_100390133 | Ga0068855_1003901332 | 106 |
| 130 | 3300005564 | Ga0070664_100182779 | Ga0070664_1001827792 | 106 |
| 131 | 3300005614 | Ga0068856_100015543 | Ga0068856_1000155435 | 106 |
| 132 | 3300005616 | Ga0068852_100318083 | Ga0068852_1003180833 | 106 |
| 133 | 3300005617 | Ga0068859_101490677 | Ga0068859_1014906772 | 106 |
| 134 | 3300005618 | Ga0068864_100334521 | Ga0068864_1003345212 | 106 |
| 135 | 3300005718 | Ga0068866_10415624 | Ga0068866_104156242 | 106 |
| 136 | 3300005840 | Ga0068870_10280417 | Ga0068870_102804172 | 106 |
| 137 | 3300005844 | Ga0068862_102291891 | Ga0068862_1022918912 | 106 |
| 138 | 3300006237 | Ga0097621_100177464 | Ga0097621_1001774642 | 106 |
| 139 | 3300006237 | Ga0097621_100652746 | Ga0097621_1006527462 | 106 |
| 140 | 3300006358 | Ga0068871_100077839 | Ga0068871_1000778393 | 106 |
| 141 | 3300006881 | Ga0068865_100121596 | Ga0068865_1001215962 | 106 |
| 142 | 3300006931 | Ga0097620_101490753 | Ga0097620_1014907532 | 106 |
| 143 | 3300009093 | Ga0105240_10184284 | Ga0105240_101842842 | 106 |
| 144 | 3300009093 | Ga0105240_10423820 | Ga0105240_104238202 | 106 |
| 145 | 3300009098 | Ga0105245_11867282 | Ga0105245_118672822 | 106 |
| 146 | 3300009174 | Ga0105241_10089324 | Ga0105241_100893242 | 106 |
| 147 | 3300009176 | Ga0105242_11119308 | Ga0105242_111193082 | 106 |
| 148 | 3300009177 | Ga0105248_10573885 | Ga0105248_105738851 | 106 |
| 149 | 3300009551 | Ga0105238_10271473 | Ga0105238_102714733 | 106 |
| 150 | 3300010375 | Ga0105239_10336369 | Ga0105239_103363692 | 106 |
| 151 | 3300010375 | Ga0105239_10411292 | Ga0105239_104112923 | 106 |
| 152 | 3300011119 | Ga0105246_10055476 | Ga0105246_100554762 | 106 |
| 153 | 3300013105 | Ga0157369_10109236 | Ga0157369_101092362 | 106 |
| 154 | 3300013296 | Ga0157374_10252724 | Ga0157374_102527242 | 106 |
| 155 | 3300013297 | Ga0157378_10472086 | Ga0157378_104720862 | 106 |
| 156 | 3300013306 | Ga0163162_10032167 | Ga0163162_100321676 | 106 |
| 157 | 3300013306 | Ga0163162_10214583 | Ga0163162_102145833 | 106 |
| 158 | 3300013307 | Ga0157372_12854445 | Ga0157372_128544452 | 106 |
| 159 | 3300013308 | Ga0157375_10049592 | Ga0157375_100495922 | 106 |
| 160 | 3300014325 | Ga0163163_10255226 | Ga0163163_102552263 | 106 |
| 161 | 3300014969 | Ga0157376_10021304 | Ga0157376_100213046 | 106 |
| 162 | 3300025920 | Ga0207649_10000287 | Ga0207649_1000028747 | 106 |
| 163 | 3300028800 | Ga0265338_10027063 | Ga0265338_100270632 | 106 |
| 164 | 3300031240 | Ga0265320_10000042 | Ga0265320_1000004282 | 106 |
| 165 | 3300031241 | Ga0265325_10334443 | Ga0265325_103344432 | 106 |
| 166 | 3300031247 | Ga0265340_10223253 | Ga0265340_102232531 | 106 |
| 167 | 3300031250 | Ga0265331_10106136 | Ga0265331_101061361 | 106 |
| 168 | 3300031711 | Ga0265314_10058474 | Ga0265314_100584743 | 106 |
| 169 | 3300031711 | Ga0265314_10108192 | Ga0265314_101081922 | 106 |
| 170 | 3300031712 | Ga0265342_10425268 | Ga0265342_104252682 | 106 |
| 171 | 3300041456 | Ga0451795_1570088 | Ga0451795_1570088_380_715 | 106 |
| 172 | 3300046513 | Ga0495616_0150963 | Ga0495616_0150963_397_723 | 106 |
| 173 | 3300005327 | Ga0070658_10040247 | Ga0070658_100402474 | 107 |
| 174 | 3300005331 | Ga0070670_100185581 | Ga0070670_1001855812 | 107 |
| 175 | 3300005331 | Ga0070670_100478130 | Ga0070670_1004781302 | 107 |
| 176 | 3300005334 | Ga0068869_100034305 | Ga0068869_1000343052 | 107 |
| 177 | 3300005335 | Ga0070666_10103805 | Ga0070666_101038052 | 107 |
| 178 | 3300005338 | Ga0068868_100841024 | Ga0068868_1008410241 | 107 |
| 179 | 3300005338 | Ga0068868_102277480 | Ga0068868_1022774801 | 107 |
| 180 | 3300005339 | Ga0070660_100055448 | Ga0070660_1000554483 | 107 |
| 181 | 3300005340 | Ga0070689_100921324 | Ga0070689_1009213241 | 107 |
| 182 | 3300005344 | Ga0070661_100817082 | Ga0070661_1008170821 | 107 |
| 183 | 3300005353 | Ga0070669_102012672 | Ga0070669_1020126721 | 107 |
| 184 | 3300005354 | Ga0070675_100044368 | Ga0070675_1000443682 | 107 |
| 185 | 3300005355 | Ga0070671_100888287 | Ga0070671_1008882872 | 107 |
| 186 | 3300005364 | Ga0070673_101281081 | Ga0070673_1012810812 | 107 |
| 187 | 3300005437 | Ga0070710_10925302 | Ga0070710_109253022 | 107 |
| 188 | 3300005438 | Ga0070701_10664557 | Ga0070701_106645571 | 107 |
| 189 | 3300005439 | Ga0070711_100578261 | Ga0070711_1005782612 | 107 |
| 190 | 3300005444 | Ga0070694_101807374 | Ga0070694_1018073741 | 107 |
| 191 | 3300005458 | Ga0070681_11228157 | Ga0070681_112281572 | 107 |
| 192 | 3300005459 | Ga0068867_100068675 | Ga0068867_1000686753 | 107 |
| 193 | 3300005530 | Ga0070679_100000062 | Ga0070679_10000006230 | 107 |
| 194 | 3300005530 | Ga0070679_100181382 | Ga0070679_1001813822 | 107 |
| 195 | 3300005539 | Ga0068853_100347206 | Ga0068853_1003472062 | 107 |
| 196 | 3300005543 | Ga0070672_100399963 | Ga0070672_1003999632 | 107 |
| 197 | 3300005548 | Ga0070665_100022221 | Ga0070665_1000222212 | 107 |
| 198 | 3300005548 | Ga0070665_100042867 | Ga0070665_1000428671 | 107 |
| 199 | 3300005548 | Ga0070665_100976032 | Ga0070665_1009760321 | 107 |
| 200 | 3300005578 | Ga0068854_101184110 | Ga0068854_1011841101 | 107 |
| 201 | 3300005617 | Ga0068859_100720335 | Ga0068859_1007203351 | 107 |
| 202 | 3300005718 | Ga0068866_10427112 | Ga0068866_104271121 | 107 |
| 203 | 3300005840 | Ga0068870_11060237 | Ga0068870_110602372 | 107 |
| 204 | 3300006237 | Ga0097621_100028354 | Ga0097621_1000283543 | 107 |
| 205 | 3300006237 | Ga0097621_100028776 | Ga0097621_1000287766 | 107 |
| 206 | 3300006237 | Ga0097621_100327616 | Ga0097621_1003276162 | 107 |
| 207 | 3300006237 | Ga0097621_100427531 | Ga0097621_1004275312 | 107 |
| 208 | 3300006358 | Ga0068871_100145317 | Ga0068871_1001453173 | 107 |
| 209 | 3300006358 | Ga0068871_100151664 | Ga0068871_1001516643 | 107 |
| 210 | 3300006358 | Ga0068871_100378533 | Ga0068871_1003785332 | 107 |
| 211 | 3300006881 | Ga0068865_100046430 | Ga0068865_1000464303 | 107 |
| 212 | 3300006881 | Ga0068865_100174416 | Ga0068865_1001744162 | 107 |
| 213 | 3300006931 | Ga0097620_100720306 | Ga0097620_1007203061 | 107 |
| 214 | 3300009098 | Ga0105245_10149270 | Ga0105245_101492701 | 107 |
| 215 | 3300009098 | Ga0105245_10905530 | Ga0105245_109055302 | 107 |
| 216 | 3300009098 | Ga0105245_10956167 | Ga0105245_109561671 | 107 |
| 217 | 3300009148 | Ga0105243_10014852 | Ga0105243_100148525 | 107 |
| 218 | 3300009148 | Ga0105243_10082244 | Ga0105243_100822442 | 107 |
| 219 | 3300009174 | Ga0105241_10193152 | Ga0105241_101931523 | 107 |
| 220 | 3300009174 | Ga0105241_10317230 | Ga0105241_103172302 | 107 |
| 221 | 3300009176 | Ga0105242_10019128 | Ga0105242_100191283 | 107 |
| 222 | 3300009176 | Ga0105242_10166737 | Ga0105242_101667371 | 107 |
| 223 | 3300009176 | Ga0105242_10219179 | Ga0105242_102191793 | 107 |
| 224 | 3300009176 | Ga0105242_10392234 | Ga0105242_103922342 | 107 |
| 225 | 3300009176 | Ga0105242_11761678 | Ga0105242_117616782 | 107 |
| 226 | 3300009177 | Ga0105248_10161295 | Ga0105248_101612954 | 107 |
| 227 | 3300009177 | Ga0105248_10846506 | Ga0105248_108465062 | 107 |
| 228 | 3300009545 | Ga0105237_12309962 | Ga0105237_123099621 | 107 |
| 229 | 3300009551 | Ga0105238_12411923 | Ga0105238_124119232 | 107 |
| 230 | 3300010375 | Ga0105239_10000400 | Ga0105239_1000040047 | 107 |
| 231 | 3300011119 | Ga0105246_10073239 | Ga0105246_100732393 | 107 |
| 232 | 3300013100 | Ga0157373_10078924 | Ga0157373_100789243 | 107 |
| 233 | 3300013105 | Ga0157369_10344048 | Ga0157369_103440482 | 107 |
| 234 | 3300013297 | Ga0157378_10109029 | Ga0157378_101090292 | 107 |
| 235 | 3300013297 | Ga0157378_10210952 | Ga0157378_102109523 | 107 |
| 236 | 3300013297 | Ga0157378_10615012 | Ga0157378_106150122 | 107 |
| 237 | 3300013297 | Ga0157378_11320052 | Ga0157378_113200522 | 107 |
| 238 | 3300013306 | Ga0163162_10565746 | Ga0163162_105657462 | 107 |
| 239 | 3300013308 | Ga0157375_11545527 | Ga0157375_115455272 | 107 |
| 240 | 3300014325 | Ga0163163_10000002 | Ga0163163_1000000249 | 107 |
| 241 | 3300014745 | Ga0157377_10080869 | Ga0157377_100808691 | 107 |
| 242 | 3300014968 | Ga0157379_10049747 | Ga0157379_100497473 | 107 |
| 243 | 3300014968 | Ga0157379_10915661 | Ga0157379_109156613 | 107 |
| 244 | 3300014969 | Ga0157376_10138855 | Ga0157376_101388552 | 107 |
| 245 | 3300014969 | Ga0157376_10490117 | Ga0157376_104901172 | 107 |
| 246 | 3300014969 | Ga0157376_10534183 | Ga0157376_105341832 | 107 |
| 247 | 3300025899 | Ga0207642_10427665 | Ga0207642_104276652 | 107 |
| 248 | 3300025903 | Ga0207680_10043432 | Ga0207680_100434322 | 107 |
| 249 | 3300025907 | Ga0207645_10011595 | Ga0207645_100115953 | 107 |
| 250 | 3300025907 | Ga0207645_10204363 | Ga0207645_102043631 | 107 |
| 251 | 3300025912 | Ga0207707_10000002 | Ga0207707_10000002626 | 107 |
| 252 | 3300025912 | Ga0207707_10838708 | Ga0207707_108387081 | 107 |
| 253 | 3300025914 | Ga0207671_10532665 | Ga0207671_105326652 | 107 |
| 254 | 3300025916 | Ga0207663_10227578 | Ga0207663_102275782 | 107 |
| 255 | 3300025917 | Ga0207660_10000025 | Ga0207660_1000002580 | 107 |
| 256 | 3300025919 | Ga0207657_10029592 | Ga0207657_100295924 | 107 |
| 257 | 3300025920 | Ga0207649_10781787 | Ga0207649_107817872 | 107 |
| 258 | 3300025921 | Ga0207652_10000712 | Ga0207652_1000071230 | 107 |
| 259 | 3300025921 | Ga0207652_11612519 | Ga0207652_116125192 | 107 |
| 260 | 3300025924 | Ga0207694_10207354 | Ga0207694_102073543 | 107 |
| 261 | 3300025925 | Ga0207650_10386482 | Ga0207650_103864822 | 107 |
| 262 | 3300025926 | Ga0207659_10038455 | Ga0207659_100384554 | 107 |
| 263 | 3300025926 | Ga0207659_10288419 | Ga0207659_102884192 | 107 |
| 264 | 3300025927 | Ga0207687_10079348 | Ga0207687_100793483 | 107 |
| 265 | 3300025927 | Ga0207687_10605026 | Ga0207687_106050262 | 107 |
| 266 | 3300025931 | Ga0207644_10287216 | Ga0207644_102872162 | 107 |
| 267 | 3300025933 | Ga0207706_10709061 | Ga0207706_107090612 | 107 |
| 268 | 3300025934 | Ga0207686_10158062 | Ga0207686_101580623 | 107 |
| 269 | 3300025934 | Ga0207686_10210353 | Ga0207686_102103531 | 107 |
| 270 | 3300025935 | Ga0207709_10026699 | Ga0207709_100266993 | 107 |
| 271 | 3300025938 | Ga0207704_10217276 | Ga0207704_102172762 | 107 |
| 272 | 3300025938 | Ga0207704_10291720 | Ga0207704_102917203 | 107 |
| 273 | 3300025940 | Ga0207691_10480322 | Ga0207691_104803222 | 107 |
| 274 | 3300025942 | Ga0207689_10006791 | Ga0207689_100067916 | 107 |
| 275 | 3300025942 | Ga0207689_10120773 | Ga0207689_101207733 | 107 |
| 276 | 3300025945 | Ga0207679_10359616 | Ga0207679_103596162 | 107 |
| 277 | 3300025960 | Ga0207651_10007945 | Ga0207651_100079457 | 107 |
| 278 | 3300026023 | Ga0207677_10006801 | Ga0207677_100068016 | 107 |
| 279 | 3300026023 | Ga0207677_10372439 | Ga0207677_103724392 | 107 |
| 280 | 3300026041 | Ga0207639_10213268 | Ga0207639_102132682 | 107 |
| 281 | 3300026075 | Ga0207708_11200790 | Ga0207708_112007902 | 107 |
| 282 | 3300026088 | Ga0207641_11185548 | Ga0207641_111855481 | 107 |
| 283 | 3300026089 | Ga0207648_10041671 | Ga0207648_100416713 | 107 |
| 284 | 3300026116 | Ga0207674_11362420 | Ga0207674_113624202 | 107 |
| 285 | 3300028379 | Ga0268266_10008917 | Ga0268266_1000891710 | 107 |
| 286 | 3300028379 | Ga0268266_10292393 | Ga0268266_102923933 | 107 |
| 287 | 3300028380 | Ga0268265_11039004 | Ga0268265_110390042 | 107 |
| 288 | 3300031238 | Ga0265332_10413437 | Ga0265332_104134372 | 107 |
| 289 | 3300035692 | Ga0373935_0638434 | Ga0373935_0638434_388_714 | 107 |
| 290 | 3300041460 | Ga0451802_1918129 | Ga0451802_1918129_167_496 | 107 |
| 291 | 3300046454 | Ga0495592_0838595 | Ga0495592_0838595_77_403 | 107 |
| 292 | 3300046507 | Ga0495606_0316263 | Ga0495606_0316263_172_504 | 107 |
| 293 | 3300046535 | Ga0495586_0395596 | Ga0495586_0395596_145_474 | 107 |
| 294 | 3300046557 | Ga0495622_0024612 | Ga0495622_0024612_602_928 | 107 |
| 295 | 3300046642 | Ga0495634_0436686 | Ga0495634_0436686_129_455 | 107 |
| 296 | 3300046648 | Ga0495611_0112080 | Ga0495611_0112080_659_985 | 107 |
| 297 | 3300048910 | Ga0496107_0574618 | Ga0496107_0574618_314_688 | 107 |
| 298 | 3300049569 | Ga0501032_0041486 | Ga0501032_0041486_859_1188 | 107 |
| 299 | 3300049571 | Ga0501034_0283104 | Ga0501034_0283104_311_640 | 107 |
| 300 | 3300049571 | Ga0501034_0386258 | Ga0501034_0386258_908_1237 | 107 |
| 301 | 3300049572 | Ga0501036_0049607 | Ga0501036_0049607_71_400 | 107 |
| 302 | 3300049573 | Ga0501037_0211885 | Ga0501037_0211885_392_721 | 107 |
| 303 | 3300049579 | Ga0501043_0076420 | Ga0501043_0076420_1544_1873 | 107 |
| 304 | 3300049580 | Ga0501046_0856915 | Ga0501046_0856915_188_517 | 107 |
| 305 | 3300049581 | Ga0501047_0037616 | Ga0501047_0037616_3156_3485 | 107 |
| 306 | 3300049582 | Ga0501048_0029414 | Ga0501048_0029414_502_831 | 107 |
| 307 | 3300049583 | Ga0501067_0010118 | Ga0501067_0010118_1020_1349 | 107 |
| 308 | 3300049583 | Ga0501067_0018086 | Ga0501067_0018086_81_410 | 107 |
| 309 | 3300049585 | Ga0501069_0005873 | Ga0501069_0005873_5332_5661 | 107 |
| 310 | 3300049586 | Ga0501070_0033022 | Ga0501070_0033022_3020_3349 | 107 |
| 311 | 3300049588 | Ga0501072_0059970 | Ga0501072_0059970_499_828 | 107 |
| 312 | 3300049589 | Ga0501073_0022208 | Ga0501073_0022208_2784_3113 | 107 |
| 313 | 3300049589 | Ga0501073_0025133 | Ga0501073_0025133_76_405 | 107 |
| 314 | 3300049589 | Ga0501073_0621007 | Ga0501073_0621007_212_541 | 107 |
| 315 | 3300049590 | Ga0501074_0024317 | Ga0501074_0024317_3870_4199 | 107 |
| 316 | 3300049741 | Ga0501079_0099807 | Ga0501079_0099807_968_1297 | 107 |
| 317 | 3300049741 | Ga0501079_0676818 | Ga0501079_0676818_403_732 | 107 |
| 318 | 3300049742 | Ga0501080_0101490 | Ga0501080_0101490_1370_1699 | 107 |
| 319 | 3300049742 | Ga0501080_0325160 | Ga0501080_0325160_235_564 | 107 |
| 320 | 3300049742 | Ga0501080_0464069 | Ga0501080_0464069_786_1112 | 107 |
| 321 | 3300049744 | Ga0501083_0459758 | Ga0501083_0459758_473_802 | 107 |
| 322 | 3300049822 | Ga0501035_0014394 | Ga0501035_0014394_3155_3484 | 107 |
| 323 | 3300049823 | Ga0501044_0104294 | Ga0501044_0104294_1528_1857 | 107 |
| 324 | 3300049824 | Ga0501045_0778742 | Ga0501045_0778742_328_657 | 107 |
| 325 | 3300053120 | Ga0500597_139117 | Ga0500597_139117_688_1014 | 107 |
| 326 | 3300053120 | Ga0500597_277951 | Ga0500597_277951_52_378 | 107 |
| 327 | 3300053130 | Ga0500642_0288341 | Ga0500642_0288341_68_397 | 107 |
| 328 | 3300053136 | Ga0500559_0133089 | Ga0500559_0133089_715_1041 | 107 |
| 329 | 3300053142 | Ga0500577_0027064 | Ga0500577_0027064_360_689 | 107 |
| 330 | 3300054114 | Ga0501084_0021067 | Ga0501084_0021067_1314_1643 | 107 |
| 331 | 3300054114 | Ga0501084_0051491 | Ga0501084_0051491_1107_1436 | 107 |
| 332 | 3300060353 | Ga0501082_0384722 | Ga0501082_0384722_862_1191 | 107 |
| 333 | 3300060353 | Ga0501082_0419784 | Ga0501082_0419784_391_720 | 107 |
| 334 | 3300005335 | Ga0070666_10006798 | Ga0070666_100067983 | 108 |
| 335 | 3300005355 | Ga0070671_100364051 | Ga0070671_1003640512 | 108 |
| 336 | 3300005367 | Ga0070667_100053625 | Ga0070667_1000536253 | 108 |
| 337 | 3300005437 | Ga0070710_11283162 | Ga0070710_112831621 | 108 |
| 338 | 3300005539 | Ga0068853_100132572 | Ga0068853_1001325723 | 108 |
| 339 | 3300005543 | Ga0070672_100724717 | Ga0070672_1007247171 | 108 |
| 340 | 3300005548 | Ga0070665_100078549 | Ga0070665_1000785493 | 108 |
| 341 | 3300005548 | Ga0070665_100176171 | Ga0070665_1001761714 | 108 |
| 342 | 3300005617 | Ga0068859_101774127 | Ga0068859_1017741272 | 108 |
| 343 | 3300005719 | Ga0068861_100277549 | Ga0068861_1002775493 | 108 |
| 344 | 3300005841 | Ga0068863_100049744 | Ga0068863_1000497445 | 108 |
| 345 | 3300005842 | Ga0068858_100015988 | Ga0068858_1000159884 | 108 |
| 346 | 3300006931 | Ga0097620_101774106 | Ga0097620_1017741062 | 108 |
| 347 | 3300009101 | Ga0105247_10950345 | Ga0105247_109503451 | 108 |
| 348 | 3300009174 | Ga0105241_10576172 | Ga0105241_105761722 | 108 |
| 349 | 3300009176 | Ga0105242_10406682 | Ga0105242_104066823 | 108 |
| 350 | 3300009177 | Ga0105248_10028228 | Ga0105248_100282288 | 108 |
| 351 | 3300009545 | Ga0105237_10299045 | Ga0105237_102990452 | 108 |
| 352 | 3300009545 | Ga0105237_10623863 | Ga0105237_106238632 | 108 |
| 353 | 3300009553 | Ga0105249_10033055 | Ga0105249_100330552 | 108 |
| 354 | 3300010375 | Ga0105239_11778736 | Ga0105239_117787362 | 108 |
| 355 | 3300013104 | Ga0157370_10014830 | Ga0157370_100148303 | 108 |
| 356 | 3300013296 | Ga0157374_10108049 | Ga0157374_101080492 | 108 |
| 357 | 3300013297 | Ga0157378_10261092 | Ga0157378_102610922 | 108 |
| 358 | 3300013306 | Ga0163162_10563663 | Ga0163162_105636632 | 108 |
| 359 | 3300014325 | Ga0163163_10348214 | Ga0163163_103482142 | 108 |
| 360 | 3300014968 | Ga0157379_10063225 | Ga0157379_100632253 | 108 |
| 361 | 3300025903 | Ga0207680_10223103 | Ga0207680_102231032 | 108 |
| 362 | 3300025909 | Ga0207705_10407147 | Ga0207705_104071472 | 108 |
| 363 | 3300025911 | Ga0207654_10647621 | Ga0207654_106476212 | 108 |
| 364 | 3300025914 | Ga0207671_10194062 | Ga0207671_101940622 | 108 |
| 365 | 3300025914 | Ga0207671_10715973 | Ga0207671_107159732 | 108 |
| 366 | 3300025927 | Ga0207687_10146288 | Ga0207687_101462882 | 108 |
| 367 | 3300025931 | Ga0207644_10277087 | Ga0207644_102770872 | 108 |
| 368 | 3300025941 | Ga0207711_11146963 | Ga0207711_111469631 | 108 |
| 369 | 3300025961 | Ga0207712_11723552 | Ga0207712_117235522 | 108 |
| 370 | 3300025986 | Ga0207658_10158151 | Ga0207658_101581513 | 108 |
| 371 | 3300025986 | Ga0207658_11163230 | Ga0207658_111632302 | 108 |
| 372 | 3300026035 | Ga0207703_10208803 | Ga0207703_102088031 | 108 |
| 373 | 3300026088 | Ga0207641_10326025 | Ga0207641_103260252 | 108 |
| 374 | 3300026116 | Ga0207674_10704251 | Ga0207674_107042512 | 108 |
| 375 | 3300026118 | Ga0207675_100370315 | Ga0207675_1003703151 | 108 |
| 376 | 3300028379 | Ga0268266_10090112 | Ga0268266_100901123 | 108 |
| 377 | 3300028379 | Ga0268266_11488820 | Ga0268266_114888202 | 108 |
| 378 | 3300031235 | Ga0265330_10032808 | Ga0265330_100328083 | 108 |
| 379 | 3300031239 | Ga0265328_10117655 | Ga0265328_101176552 | 108 |
| 380 | 3300031249 | Ga0265339_10301211 | Ga0265339_103012111 | 108 |
| 381 | 3300031344 | Ga0265316_10354917 | Ga0265316_103549172 | 108 |
| 382 | 3300036401 | Ga0373937_1516330 | Ga0373937_1516330_256_594 | 108 |
| 383 | 3300037466 | Ga0395898_0056743 | Ga0395898_0056743_1791_2117 | 108 |
| 384 | 3300038443 | Ga0395901_0364277 | Ga0395901_0364277_701_1027 | 108 |
| 385 | 3300039437 | Ga0436365_0725141 | Ga0436365_0725141_229_555 | 108 |
| 386 | 3300046471 | Ga0495650_0052164 | Ga0495650_0052164_48_377 | 108 |
| 387 | 3300046516 | Ga0495628_0868322 | Ga0495628_0868322_277_612 | 108 |
| 388 | 3300046523 | Ga0495644_0151113 | Ga0495644_0151113_19_360 | 108 |
| 389 | 3300046536 | Ga0495587_0016626 | Ga0495587_0016626_3644_3979 | 108 |
| 390 | 3300048088 | Ga0495602_0280671 | Ga0495602_0280671_565_900 | 108 |
| 391 | 3300049570 | Ga0501033_0206647 | Ga0501033_0206647_773_1114 | 108 |
| 392 | 3300049580 | Ga0501046_0558949 | Ga0501046_0558949_83_415 | 108 |
| 393 | 3300049581 | Ga0501047_0061983 | Ga0501047_0061983_526_867 | 108 |
| 394 | 3300049589 | Ga0501073_0061256 | Ga0501073_0061256_1491_1817 | 108 |
| 395 | 3300049742 | Ga0501080_0360500 | Ga0501080_0360500_555_881 | 108 |
| 396 | 3300049744 | Ga0501083_0260949 | Ga0501083_0260949_774_1100 | 108 |
| 397 | 3300049822 | Ga0501035_0184264 | Ga0501035_0184264_395_736 | 108 |
| 398 | 3300049823 | Ga0501044_0166521 | Ga0501044_0166521_271_612 | 108 |
| 399 | 3300005543 | Ga0070672_100995003 | Ga0070672_1009950032 | 109 |
| 400 | 3300005843 | Ga0068860_101371197 | Ga0068860_1013711972 | 109 |
| 401 | 3300006358 | Ga0068871_100001780 | Ga0068871_10000178017 | 109 |
| 402 | 3300006358 | Ga0068871_101901506 | Ga0068871_1019015061 | 109 |
| 403 | 3300028381 | Ga0268264_11028617 | Ga0268264_110286172 | 109 |
| 404 | 3300045976 | Ga0466967_0136809 | Ga0466967_0136809_1692_2021 | 109 |
| 405 | 3300046499 | Ga0495594_0710724 | Ga0495594_0710724_126_506 | 109 |
| 406 | 3300046529 | Ga0495652_0561929 | Ga0495652_0561929_160_528 | 109 |
| 407 | 3300053119 | Ga0500595_012074 | Ga0500595_012074_1231_1611 | 109 |
| 408 | 3300053136 | Ga0500559_0037192 | Ga0500559_0037192_142_522 | 109 |
| 409 | 3300005327 | Ga0070658_10006544 | Ga0070658_100065448 | 110 |
| 410 | 3300005329 | Ga0070683_100078998 | Ga0070683_1000789983 | 110 |
| 411 | 3300005329 | Ga0070683_101038004 | Ga0070683_1010380042 | 110 |
| 412 | 3300005336 | Ga0070680_100334338 | Ga0070680_1003343383 | 110 |
| 413 | 3300005336 | Ga0070680_101588507 | Ga0070680_1015885072 | 110 |
| 414 | 3300005344 | Ga0070661_100306402 | Ga0070661_1003064021 | 110 |
| 415 | 3300005366 | Ga0070659_101549131 | Ga0070659_1015491311 | 110 |
| 416 | 3300005458 | Ga0070681_10166782 | Ga0070681_101667823 | 110 |
| 417 | 3300005458 | Ga0070681_10696653 | Ga0070681_106966532 | 110 |
| 418 | 3300005530 | Ga0070679_100007554 | Ga0070679_1000075547 | 110 |
| 419 | 3300005539 | Ga0068853_100217237 | Ga0068853_1002172372 | 110 |
| 420 | 3300005547 | Ga0070693_100191458 | Ga0070693_1001914582 | 110 |
| 421 | 3300005548 | Ga0070665_100000162 | Ga0070665_10000016292 | 110 |
| 422 | 3300005563 | Ga0068855_100799551 | Ga0068855_1007995512 | 110 |
| 423 | 3300005563 | Ga0068855_101584107 | Ga0068855_1015841071 | 110 |
| 424 | 3300005577 | Ga0068857_100110600 | Ga0068857_1001106003 | 110 |
| 425 | 3300005577 | Ga0068857_100261971 | Ga0068857_1002619712 | 110 |
| 426 | 3300005614 | Ga0068856_101595616 | Ga0068856_1015956162 | 110 |
| 427 | 3300009093 | Ga0105240_10056354 | Ga0105240_100563544 | 110 |
| 428 | 3300009093 | Ga0105240_10173084 | Ga0105240_101730844 | 110 |
| 429 | 3300009093 | Ga0105240_10323719 | Ga0105240_103237193 | 110 |
| 430 | 3300009093 | Ga0105240_12348579 | Ga0105240_123485792 | 110 |
| 431 | 3300009545 | Ga0105237_10231864 | Ga0105237_102318642 | 110 |
| 432 | 3300009551 | Ga0105238_10821584 | Ga0105238_108215842 | 110 |
| 433 | 3300009551 | Ga0105238_11640282 | Ga0105238_116402821 | 110 |
| 434 | 3300009551 | Ga0105238_11992130 | Ga0105238_119921302 | 110 |
| 435 | 3300010375 | Ga0105239_11283323 | Ga0105239_112833232 | 110 |
| 436 | 3300013104 | Ga0157370_11111593 | Ga0157370_111115932 | 110 |
| 437 | 3300013105 | Ga0157369_10104810 | Ga0157369_101048102 | 110 |
| 438 | 3300013105 | Ga0157369_10446314 | Ga0157369_104463142 | 110 |
| 439 | 3300013105 | Ga0157369_12694310 | Ga0157369_126943101 | 110 |
| 440 | 3300013307 | Ga0157372_12692474 | Ga0157372_126924741 | 110 |
| 441 | 3300025909 | Ga0207705_10012953 | Ga0207705_100129534 | 110 |
| 442 | 3300025912 | Ga0207707_10100569 | Ga0207707_101005692 | 110 |
| 443 | 3300025912 | Ga0207707_10280025 | Ga0207707_102800253 | 110 |
| 444 | 3300025913 | Ga0207695_10277986 | Ga0207695_102779863 | 110 |
| 445 | 3300025913 | Ga0207695_10279645 | Ga0207695_102796452 | 110 |
| 446 | 3300025913 | Ga0207695_11354913 | Ga0207695_113549132 | 110 |
| 447 | 3300025914 | Ga0207671_10452244 | Ga0207671_104522442 | 110 |
| 448 | 3300025917 | Ga0207660_10257272 | Ga0207660_102572722 | 110 |
| 449 | 3300025920 | Ga0207649_10171431 | Ga0207649_101714313 | 110 |
| 450 | 3300025920 | Ga0207649_10749564 | Ga0207649_107495642 | 110 |
| 451 | 3300025921 | Ga0207652_10039420 | Ga0207652_100394203 | 110 |
| 452 | 3300025921 | Ga0207652_11664481 | Ga0207652_116644812 | 110 |
| 453 | 3300025928 | Ga0207700_10469444 | Ga0207700_104694441 | 110 |
| 454 | 3300025945 | Ga0207679_10746913 | Ga0207679_107469132 | 110 |
| 455 | 3300025949 | Ga0207667_10595461 | Ga0207667_105954612 | 110 |
| 456 | 3300025949 | Ga0207667_10634147 | Ga0207667_106341472 | 110 |
| 457 | 3300025981 | Ga0207640_11119972 | Ga0207640_111199722 | 110 |
| 458 | 3300026041 | Ga0207639_10421964 | Ga0207639_104219642 | 110 |
| 459 | 3300026041 | Ga0207639_10618580 | Ga0207639_106185802 | 110 |
| 460 | 3300026078 | Ga0207702_10153045 | Ga0207702_101530453 | 110 |
| 461 | 3300026116 | Ga0207674_11560016 | Ga0207674_115600162 | 110 |
| 462 | 3300028379 | Ga0268266_10003361 | Ga0268266_1000336115 | 110 |
| 463 | 3300031235 | Ga0265330_10046154 | Ga0265330_100461543 | 110 |
| 464 | 3300031238 | Ga0265332_10026666 | Ga0265332_100266663 | 110 |
| 465 | 3300031241 | Ga0265325_10077334 | Ga0265325_100773342 | 110 |
| 466 | 3300031249 | Ga0265339_10045200 | Ga0265339_100452001 | 110 |
| 467 | 3300031711 | Ga0265314_10048205 | Ga0265314_100482054 | 110 |
| 468 | 3300031712 | Ga0265342_10021183 | Ga0265342_100211834 | 110 |
| 469 | 3300045976 | Ga0466967_0207816 | Ga0466967_0207816_995_1327 | 110 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hcf-assembly2.cif.gz_B | crystal structure of uncharacterized cupredoxin-like domain protein cupredoxin_1 with copper bound from bacillus anthracis | 0.9125 | 23 | 110 |
| 5tk2-assembly3.cif.gz_C | crystal structure of uncharacterized cupredoxin-like domain protein from bacillus anthracis | 0.9118 | 25 | 110 |
| 5u7n-assembly7.cif.gz_G | crystal structure of a chimeric cua domain (subunit ii) of cytochrome ba3 from thermus thermophilus with the amicyanin loop | 0.9116 | 26 | 110 |
| 1iby-assembly1.cif.gz_C | red copper protein nitrosocyanin from nitrosomonas europaea | 0.9073 | 35 | 109 |
| 1fwx-assembly2.cif.gz_D | crystal structure of nitrous oxide reductase from p. denitrificans | 0.9064 | 26 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4hcfA00 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9315 | 27 | 110 | 2.60.40.420 |
| 5u7nF00 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9081 | 26 | 110 | 2.60.40.420 |
| 1ibyB00 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9049 | 35 | 109 | 2.60.40.420 |
| 4hcfA00 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.8915 | 27 | 110 | 2.60.40.420 |
| 4f2eA00 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.8877 | 26 | 110 | 2.60.40.420 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0F3MBZ7-F1-model_v4 | Cupredoxin-like domain protein | 0.9906 | 30 | 110 |
|
| AF-A0A7W8D273-F1-model_v4 | Heme/copper-type cytochrome/quinol oxidase subunit 2 | 0.9874 | 25 | 110 |
|
| AF-A0A3B8T3B5-F1-model_v4 | Cupredoxin domain-containing protein | 0.9862 | 28 | 110 |
|
| AF-A0A525IDU3-F1-model_v4 | Cupredoxin domain-containing protein | 0.9758 | 27 | 110 |
|
| AF-A0A178MZS9-F1-model_v4 | EfeO-type cupredoxin-like domain-containing protein | 0.9749 | 25 | 110 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar