F450175

General Info

Members Datasets Scaffolds Average Seq Length
469 221 469 110

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_101142603|Ga0070680_1011426032
Length 113
Sequence MCRMKALKYLAIAAVAAFGVSSALADEGAIPLSLKDHKFTPVEIHVKANVANVLALTNADDTAEEFDSTSLKVEKVVASHSSGNVRLRPLAPGRYPFMGEYHADTAQGVVIAE

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
141 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
150 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
154 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
162 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
216 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
217 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
218 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
219 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.49
Nodule 0
Rhizoplane 1.07
Rhizosphere 96.8
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10006544 3300005327 Bacteria 9450
2 Ga0070658_10040247 3300005327 Bacteria 3771
3 Ga0070683_100078998 3300005329 Bacteria 3079
4 Ga0070683_101038004 3300005329 Bacteria 787
5 Ga0070670_100185581 3300005331 Bacteria 1806
6 Ga0070670_100478130 3300005331 Unclassified 1106
7 Ga0068869_100034305 3300005334 Bacteria 3588
8 Ga0070666_10006798 3300005335 Bacteria 7046
9 Ga0070666_10103805 3300005335 Bacteria 1961
10 Ga0070680_100334338 3300005336 Bacteria 1287
11 Ga0070680_101142603 3300005336 Bacteria 673
12 Ga0070680_101588507 3300005336 Bacteria 567
13 Ga0068868_100841024 3300005338 Unclassified 831
14 Ga0068868_101038342 3300005338 Unclassified 751
15 Ga0068868_102277480 3300005338 Unclassified 517
16 Ga0070660_100055448 3300005339 Bacteria 3062
17 Ga0070689_100921324 3300005340 Bacteria 774
18 Ga0070691_10013912 3300005341 Unclassified 3693
19 Ga0070661_100306402 3300005344 Bacteria 1237
20 Ga0070661_100496478 3300005344 Bacteria 976
21 Ga0070661_100817082 3300005344 Bacteria 766
22 Ga0070669_102012672 3300005353 Bacteria 505
23 Ga0070675_100044368 3300005354 Bacteria 3636
24 Ga0070671_100364051 3300005355 Unclassified 1235
25 Ga0070671_100888287 3300005355 Bacteria 778
26 Ga0070671_101029001 3300005355 Bacteria 722
27 Ga0070673_101281081 3300005364 Bacteria 688
28 Ga0070659_100667325 3300005366 Unclassified 897
29 Ga0070659_101549131 3300005366 Unclassified 591
30 Ga0070667_100053625 3300005367 Bacteria 3403
31 Ga0070709_10001661 3300005434 Bacteria 12067
32 Ga0070714_100319652 3300005435 Bacteria 1451
33 Ga0070713_100000008 3300005436 Bacteria 160153
34 Ga0070710_10925302 3300005437 Bacteria 631
35 Ga0070710_11283162 3300005437 Bacteria 544
36 Ga0070701_10664557 3300005438 Bacteria 697
37 Ga0070711_100322127 3300005439 Bacteria 1235
38 Ga0070711_100578261 3300005439 Bacteria 935
39 Ga0070705_100168848 3300005440 Bacteria 1470
40 Ga0070694_101573869 3300005444 Unclassified 557
41 Ga0070694_101807374 3300005444 Bacteria 521
42 Ga0070708_101441379 3300005445 Bacteria 642
43 Ga0070663_100499961 3300005455 Bacteria 1009
44 Ga0070678_100009449 3300005456 Bacteria 5911
45 Ga0070681_10166782 3300005458 Bacteria 2125
46 Ga0070681_10667795 3300005458 Unclassified 954
47 Ga0070681_10696653 3300005458 Bacteria 931
48 Ga0070681_11228157 3300005458 Bacteria 672
49 Ga0068867_100068675 3300005459 Bacteria 2645
50 Ga0070706_100555279 3300005467 Bacteria 1068
51 Ga0070707_100554103 3300005468 Bacteria 1112
52 Ga0070679_100000062 3300005530 Bacteria 79849
53 Ga0070679_100007554 3300005530 Bacteria 10168
54 Ga0070679_100181382 3300005530 Bacteria 2078
55 Ga0070684_100085580 3300005535 Bacteria 2796
56 Ga0070684_100148818 3300005535 Bacteria 2120
57 Ga0068853_100048135 3300005539 Bacteria 3661
58 Ga0068853_100132572 3300005539 Bacteria 2232
59 Ga0068853_100217237 3300005539 Bacteria 1745
60 Ga0068853_100347206 3300005539 Bacteria 1380
61 Ga0068853_100530372 3300005539 Unclassified 1114
62 Ga0070672_100399963 3300005543 Bacteria 1177
63 Ga0070672_100724717 3300005543 Unclassified 872
64 Ga0070672_100995003 3300005543 Bacteria 743
65 Ga0070695_100070767 3300005545 Bacteria 2283
66 Ga0070693_100191458 3300005547 Unclassified 1323
67 Ga0070693_100786431 3300005547 Bacteria 704
68 Ga0070665_100000162 3300005548 Bacteria 122048
69 Ga0070665_100022221 3300005548 Bacteria 6381
70 Ga0070665_100042867 3300005548 Bacteria 4549
71 Ga0070665_100078549 3300005548 Bacteria 3307
72 Ga0070665_100176171 3300005548 Bacteria 2139
73 Ga0070665_100976032 3300005548 Unclassified 860
74 Ga0068855_100052376 3300005563 Bacteria 4805
75 Ga0068855_100390133 3300005563 Bacteria 1527
76 Ga0068855_100799551 3300005563 Unclassified 1002
77 Ga0068855_101584107 3300005563 Unclassified 670
78 Ga0070664_100182779 3300005564 Bacteria 1864
79 Ga0070664_101424856 3300005564 Unclassified 655
80 Ga0068857_100013915 3300005577 Bacteria 7003
81 Ga0068857_100110600 3300005577 Bacteria 2469
82 Ga0068857_100261971 3300005577 Bacteria 1587
83 Ga0068854_100054518 3300005578 Unclassified 2876
84 Ga0068854_101184110 3300005578 Bacteria 684
85 Ga0068856_100000572 3300005614 Bacteria 40266
86 Ga0068856_100015543 3300005614 Bacteria 7357
87 Ga0068856_100067611 3300005614 Unclassified 3531
88 Ga0068856_100504255 3300005614 Unclassified 1231
89 Ga0068856_100558161 3300005614 Bacteria 1166
90 Ga0068856_101595616 3300005614 Unclassified 666
91 Ga0068852_100044610 3300005616 Unclassified 3767
92 Ga0068852_100318083 3300005616 Bacteria 1511
93 Ga0068859_100720335 3300005617 Bacteria 1088
94 Ga0068859_101490677 3300005617 Bacteria 746
95 Ga0068859_101774127 3300005617 Unclassified 682
96 Ga0068864_100334521 3300005618 Bacteria 1425
97 Ga0068866_10415624 3300005718 Bacteria 871
98 Ga0068866_10427112 3300005718 Bacteria 861
99 Ga0068861_100277549 3300005719 Bacteria 1442
100 Ga0068870_10280417 3300005840 Unclassified 1044
101 Ga0068870_11060237 3300005840 Bacteria 581
102 Ga0068863_100049744 3300005841 Bacteria 3974
103 Ga0068858_100015988 3300005842 Bacteria 7047
104 Ga0068860_101371197 3300005843 Bacteria 728
105 Ga0068862_102291891 3300005844 Bacteria 552
106 Ga0070716_100522956 3300006173 Bacteria 879
107 Ga0070712_100000202 3300006175 Bacteria 33503
108 Ga0097621_100028354 3300006237 Bacteria 4413
109 Ga0097621_100028776 3300006237 Bacteria 4382
110 Ga0097621_100177464 3300006237 Bacteria 1839
111 Ga0097621_100327616 3300006237 Bacteria 1358
112 Ga0097621_100427531 3300006237 Bacteria 1190
113 Ga0097621_100487497 3300006237 Unclassified 1115
114 Ga0097621_100597927 3300006237 Bacteria 1008
115 Ga0097621_100652746 3300006237 Unclassified 965
116 Ga0068871_100001780 3300006358 Bacteria 14513
117 Ga0068871_100042958 3300006358 Bacteria 3631
118 Ga0068871_100077839 3300006358 Bacteria 2741
119 Ga0068871_100145317 3300006358 Bacteria 2018
120 Ga0068871_100151664 3300006358 Bacteria 1977
121 Ga0068871_100378533 3300006358 Unclassified 1257
122 Ga0068871_101901506 3300006358 Bacteria 566
123 Ga0068871_102310066 3300006358 Unclassified 513
124 Ga0075434_100095266 3300006871 Bacteria 2982
125 Ga0068865_100046430 3300006881 Bacteria 2980
126 Ga0068865_100121596 3300006881 Bacteria 1942
127 Ga0068865_100174416 3300006881 Bacteria 1651
128 Ga0075436_100000053 3300006914 Bacteria 69483
129 Ga0075436_100096140 3300006914 Bacteria 2061
130 Ga0075436_100698944 3300006914 Bacteria 751
131 Ga0097620_100720306 3300006931 Bacteria 1088
132 Ga0097620_101490753 3300006931 Bacteria 746
133 Ga0097620_101774106 3300006931 Unclassified 682
134 Ga0075435_100187090 3300007076 Unclassified 1751
135 Ga0105240_10022148 3300009093 Bacteria 8432
136 Ga0105240_10056354 3300009093 Bacteria 4919
137 Ga0105240_10173084 3300009093 Bacteria 2555
138 Ga0105240_10184284 3300009093 Bacteria 2460
139 Ga0105240_10323719 3300009093 Bacteria 1756
140 Ga0105240_10423820 3300009093 Bacteria 1494
141 Ga0105240_12348579 3300009093 Bacteria 552
142 Ga0105245_10149270 3300009098 Unclassified 2209
143 Ga0105245_10905530 3300009098 Bacteria 924
144 Ga0105245_10956167 3300009098 Bacteria 900
145 Ga0105245_11867282 3300009098 Unclassified 654
146 Ga0105247_10950345 3300009101 Unclassified 667
147 Ga0105243_10014852 3300009148 Bacteria 5892
148 Ga0105243_10082244 3300009148 Bacteria 2631
149 Ga0105241_10089324 3300009174 Unclassified 2427
150 Ga0105241_10193152 3300009174 Bacteria 1695
151 Ga0105241_10194581 3300009174 Unclassified 1690
152 Ga0105241_10293765 3300009174 Bacteria 1392
153 Ga0105241_10317230 3300009174 Unclassified 1343
154 Ga0105241_10576172 3300009174 Bacteria 1014
155 Ga0105241_10947444 3300009174 Bacteria 802
156 Ga0105242_10019128 3300009176 Bacteria 5365
157 Ga0105242_10166737 3300009176 Unclassified 1933
158 Ga0105242_10219179 3300009176 Bacteria 1699
159 Ga0105242_10392234 3300009176 Bacteria 1293
160 Ga0105242_10406682 3300009176 Unclassified 1272
161 Ga0105242_11119308 3300009176 Bacteria 802
162 Ga0105242_11761678 3300009176 Bacteria 657
163 Ga0105248_10028228 3300009177 Bacteria 6250
164 Ga0105248_10161295 3300009177 Bacteria 2529
165 Ga0105248_10573885 3300009177 Bacteria 1273
166 Ga0105248_10846506 3300009177 Bacteria 1032
167 Ga0105237_10231864 3300009545 Bacteria 1847
168 Ga0105237_10299045 3300009545 Bacteria 1612
169 Ga0105237_10467518 3300009545 Bacteria 1267
170 Ga0105237_10623863 3300009545 Unclassified 1085
171 Ga0105237_10962954 3300009545 Unclassified 860
172 Ga0105237_12309962 3300009545 Bacteria 548
173 Ga0105238_10002176 3300009551 Bacteria 19789
174 Ga0105238_10271473 3300009551 Bacteria 1676
175 Ga0105238_10821584 3300009551 Bacteria 946
176 Ga0105238_11640282 3300009551 Unclassified 673
177 Ga0105238_11992130 3300009551 Unclassified 614
178 Ga0105238_12411923 3300009551 Unclassified 562
179 Ga0105249_10033055 3300009553 Bacteria 4683
180 Ga0105239_10000400 3300010375 Bacteria 63699
181 Ga0105239_10116436 3300010375 Plasmid 2966
182 Ga0105239_10336369 3300010375 Bacteria 1704
183 Ga0105239_10411292 3300010375 Unclassified 1532
184 Ga0105239_11283323 3300010375 Unclassified 845
185 Ga0105239_11778736 3300010375 Bacteria 714
186 Ga0105246_10055476 3300011119 Unclassified 2734
187 Ga0105246_10073239 3300011119 Unclassified 2418
188 Ga0105246_11708264 3300011119 Unclassified 598
189 Ga0157373_10013979 3300013100 Bacteria 5886
190 Ga0157373_10078924 3300013100 Unclassified 2321
191 Ga0157370_10014830 3300013104 Bacteria 7953
192 Ga0157370_11111593 3300013104 Bacteria 714
193 Ga0157369_10041905 3300013105 Unclassified 4996
194 Ga0157369_10104810 3300013105 Bacteria 3011
195 Ga0157369_10109236 3300013105 Bacteria 2941
196 Ga0157369_10344048 3300013105 Bacteria 1549
197 Ga0157369_10446314 3300013105 Bacteria 1340
198 Ga0157369_12694310 3300013105 Unclassified 501
199 Ga0157374_10108049 3300013296 Bacteria 2674
200 Ga0157374_10252724 3300013296 Bacteria 1735
201 Ga0157374_10656849 3300013296 Bacteria 1060
202 Ga0157374_10876954 3300013296 Bacteria 915
203 Ga0157378_10109029 3300013297 Bacteria 2536
204 Ga0157378_10210952 3300013297 Bacteria 1841
205 Ga0157378_10261092 3300013297 Bacteria 1662
206 Ga0157378_10472086 3300013297 Bacteria 1248
207 Ga0157378_10615012 3300013297 Bacteria 1099
208 Ga0157378_11320052 3300013297 Bacteria 763
209 Ga0163162_10032167 3300013306 Bacteria 5208
210 Ga0163162_10214583 3300013306 Bacteria 2054
211 Ga0163162_10563663 3300013306 Unclassified 1266
212 Ga0163162_10565746 3300013306 Bacteria 1264
213 Ga0163162_11016194 3300013306 Bacteria 938
214 Ga0157372_10111793 3300013307 Bacteria 3130
215 Ga0157372_10254033 3300013307 Bacteria 2041
216 Ga0157372_10576043 3300013307 Bacteria 1312
217 Ga0157372_11212643 3300013307 Bacteria 872
218 Ga0157372_12692474 3300013307 Unclassified 571
219 Ga0157372_12854445 3300013307 Unclassified 554
220 Ga0157375_10049592 3300013308 Bacteria 4115
221 Ga0157375_11526700 3300013308 Bacteria 789
222 Ga0157375_11545527 3300013308 Bacteria 784
223 Ga0163163_10000002 3300014325 Bacteria 609846
224 Ga0163163_10255226 3300014325 Bacteria 1804
225 Ga0163163_10348214 3300014325 Bacteria 1537
226 Ga0163163_10565052 3300014325 Bacteria 1200
227 Ga0157377_10080869 3300014745 Bacteria 1899
228 Ga0157379_10031995 3300014968 Unclassified 4688
229 Ga0157379_10049747 3300014968 Bacteria 3742
230 Ga0157379_10063225 3300014968 Bacteria 3310
231 Ga0157379_10149907 3300014968 Bacteria 2103
232 Ga0157379_10915661 3300014968 Unclassified 832
233 Ga0157376_10021304 3300014969 Bacteria 5033
234 Ga0157376_10138855 3300014969 Bacteria 2178
235 Ga0157376_10490117 3300014969 Bacteria 1206
236 Ga0157376_10520946 3300014969 Bacteria 1172
237 Ga0157376_10534183 3300014969 Unclassified 1158
238 Ga0157376_10996141 3300014969 Unclassified 860
239 Ga0207642_10427665 3300025899 Bacteria 798
240 Ga0207680_10043432 3300025903 Bacteria 2636
241 Ga0207680_10223103 3300025903 Unclassified 1293
242 Ga0207699_10000115 3300025906 Bacteria 56719
243 Ga0207645_10011595 3300025907 Bacteria 6011
244 Ga0207645_10204363 3300025907 Bacteria 1300
245 Ga0207705_10012953 3300025909 Bacteria 6019
246 Ga0207705_10407147 3300025909 Bacteria 1052
247 Ga0207654_10275698 3300025911 Bacteria 1136
248 Ga0207654_10452955 3300025911 Bacteria 900
249 Ga0207654_10647621 3300025911 Unclassified 757
250 Ga0207707_10000002 3300025912 Bacteria 1142054
251 Ga0207707_10100569 3300025912 Bacteria 2527
252 Ga0207707_10128952 3300025912 Bacteria 2212
253 Ga0207707_10280025 3300025912 Bacteria 1445
254 Ga0207707_10838708 3300025912 Bacteria 763
255 Ga0207695_10113494 3300025913 Unclassified 2686
256 Ga0207695_10277986 3300025913 Bacteria 1568
257 Ga0207695_10279645 3300025913 Bacteria 1563
258 Ga0207695_11354913 3300025913 Bacteria 592
259 Ga0207671_10148854 3300025914 Bacteria 1808
260 Ga0207671_10194062 3300025914 Unclassified 1584
261 Ga0207671_10452244 3300025914 Bacteria 1023
262 Ga0207671_10532665 3300025914 Bacteria 936
263 Ga0207671_10715973 3300025914 Bacteria 796
264 Ga0207693_10000149 3300025915 Bacteria 64155
265 Ga0207663_10227578 3300025916 Bacteria 1360
266 Ga0207663_10321542 3300025916 Bacteria 1163
267 Ga0207660_10000025 3300025917 Bacteria 69889
268 Ga0207660_10257272 3300025917 Bacteria 1379
269 Ga0207657_10029592 3300025919 Bacteria 4983
270 Ga0207649_10000287 3300025920 Bacteria 39380
271 Ga0207649_10171431 3300025920 Bacteria 1512
272 Ga0207649_10749564 3300025920 Unclassified 760
273 Ga0207649_10781787 3300025920 Bacteria 744
274 Ga0207652_10000712 3300025921 Bacteria 32307
275 Ga0207652_10039420 3300025921 Bacteria 4009
276 Ga0207652_11612519 3300025921 Bacteria 553
277 Ga0207652_11664481 3300025921 Bacteria 543
278 Ga0207646_10477166 3300025922 Bacteria 1125
279 Ga0207694_10207354 3300025924 Bacteria 1596
280 Ga0207694_10287249 3300025924 Bacteria 1352
281 Ga0207650_10386482 3300025925 Bacteria 1156
282 Ga0207659_10038455 3300025926 Bacteria 3328
283 Ga0207659_10288419 3300025926 Unclassified 1344
284 Ga0207687_10079348 3300025927 Unclassified 2366
285 Ga0207687_10146288 3300025927 Bacteria 1798
286 Ga0207687_10605026 3300025927 Bacteria 924
287 Ga0207700_10000017 3300025928 Bacteria 195983
288 Ga0207700_10469444 3300025928 Unclassified 1111
289 Ga0207644_10277087 3300025931 Bacteria 1346
290 Ga0207644_10287216 3300025931 Bacteria 1322
291 Ga0207644_10849238 3300025931 Bacteria 764
292 Ga0207706_10709061 3300025933 Bacteria 859
293 Ga0207686_10158062 3300025934 Bacteria 1586
294 Ga0207686_10210353 3300025934 Unclassified 1398
295 Ga0207709_10026699 3300025935 Bacteria 3319
296 Ga0207704_10217276 3300025938 Bacteria 1412
297 Ga0207704_10291720 3300025938 Bacteria 1245
298 Ga0207665_10720621 3300025939 Bacteria 785
299 Ga0207691_10480322 3300025940 Bacteria 1056
300 Ga0207711_11146963 3300025941 Unclassified 718
301 Ga0207689_10006791 3300025942 Bacteria 10072
302 Ga0207689_10120773 3300025942 Bacteria 2155
303 Ga0207679_10359616 3300025945 Unclassified 1271
304 Ga0207679_10746913 3300025945 Unclassified 890
305 Ga0207667_10223471 3300025949 Bacteria 1929
306 Ga0207667_10595461 3300025949 Bacteria 1115
307 Ga0207667_10634147 3300025949 Bacteria 1075
308 Ga0207651_10007945 3300025960 Bacteria 5688
309 Ga0207712_11723552 3300025961 Bacteria 562
310 Ga0207640_11119972 3300025981 Bacteria 697
311 Ga0207658_10158151 3300025986 Unclassified 1854
312 Ga0207658_11163230 3300025986 Bacteria 705
313 Ga0207677_10006801 3300026023 Bacteria 6278
314 Ga0207677_10372439 3300026023 Bacteria 1203
315 Ga0207703_10208803 3300026035 Unclassified 1740
316 Ga0207703_11436622 3300026035 Unclassified 664
317 Ga0207639_10213268 3300026041 Bacteria 1663
318 Ga0207639_10232978 3300026041 Bacteria 1597
319 Ga0207639_10421964 3300026041 Bacteria 1206
320 Ga0207639_10618580 3300026041 Bacteria 1000
321 Ga0207708_11200790 3300026075 Bacteria 663
322 Ga0207702_10018397 3300026078 Bacteria 5780
323 Ga0207702_10153045 3300026078 Bacteria 2100
324 Ga0207702_10261132 3300026078 Bacteria 1631
325 Ga0207702_10457114 3300026078 Unclassified 1240
326 Ga0207702_11020837 3300026078 Unclassified 821
327 Ga0207641_10326025 3300026088 Unclassified 1457
328 Ga0207641_11185548 3300026088 Bacteria 763
329 Ga0207648_10041671 3300026089 Bacteria 4032
330 Ga0207674_10019953 3300026116 Bacteria 7253
331 Ga0207674_10704251 3300026116 Unclassified 975
332 Ga0207674_11362420 3300026116 Bacteria 679
333 Ga0207674_11560016 3300026116 Unclassified 629
334 Ga0207675_100370315 3300026118 Bacteria 1407
335 Ga0207698_10071675 3300026142 Bacteria 2750
336 Ga0268266_10003361 3300028379 Bacteria 16020
337 Ga0268266_10008917 3300028379 Bacteria 8876
338 Ga0268266_10090112 3300028379 Bacteria 2687
339 Ga0268266_10292393 3300028379 Bacteria 1517
340 Ga0268266_11488820 3300028379 Unclassified 652
341 Ga0268265_11039004 3300028380 Bacteria 811
342 Ga0268264_11028617 3300028381 Bacteria 831
343 Ga0265338_10027063 3300028800 Bacteria 5763
344 Ga0265330_10032808 3300031235 Bacteria 2326
345 Ga0265330_10046154 3300031235 Bacteria 1920
346 Ga0265332_10026666 3300031238 Bacteria 2534
347 Ga0265332_10413437 3300031238 Bacteria 557
348 Ga0265328_10117655 3300031239 Bacteria 990
349 Ga0265320_10000042 3300031240 Bacteria 124844
350 Ga0265325_10077334 3300031241 Bacteria 1659
351 Ga0265325_10193009 3300031241 Bacteria 943
352 Ga0265325_10334443 3300031241 Bacteria 671
353 Ga0265340_10223253 3300031247 Bacteria 844
354 Ga0265339_10045200 3300031249 Bacteria 2425
355 Ga0265339_10301211 3300031249 Unclassified 764
356 Ga0265331_10106136 3300031250 Bacteria 1290
357 Ga0265316_10354917 3300031344 Bacteria 1061
358 Ga0265314_10048205 3300031711 Bacteria 2991
359 Ga0265314_10058474 3300031711 Bacteria 2641
360 Ga0265314_10108192 3300031711 Bacteria 1772
361 Ga0265342_10021183 3300031712 Bacteria 4156
362 Ga0265342_10425268 3300031712 Unclassified 684
363 Ga0307516_10140238 3300031730 Bacteria 2188
364 Ga0373940_0259782 3300035088 Bacteria 588
365 Ga0373932_0134646 3300035112 Bacteria 835
366 Ga0373955_0179034 3300035172 Bacteria 1257
367 Ga0373942_0040355 3300035207 Unclassified 1273
368 Ga0373962_0177049 3300035242 Unclassified 711
369 Ga0373935_0618069 3300035692 Unclassified 793
370 Ga0373935_0638434 3300035692 Bacteria 780
371 Ga0373933_0079387 3300035724 Bacteria 2009
372 Ga0373937_0018988 3300036401 Bacteria 6149
373 Ga0373937_1516330 3300036401 Bacteria 618
374 Ga0395898_0056743 3300037466 Bacteria 3817
375 Ga0395901_0364277 3300038443 Bacteria 1490
376 Ga0436365_0725141 3300039437 Bacteria 824
377 Ga0451795_1570088 3300041456 Bacteria 908
378 Ga0451802_1918129 3300041460 Bacteria 630
379 Ga0466967_0136809 3300045976 Bacteria 2279
380 Ga0466967_0207816 3300045976 Bacteria 1856
381 Ga0466967_1707679 3300045976 Unclassified 627
382 Ga0495592_0838595 3300046454 Bacteria 544
383 Ga0495653_0665204 3300046463 Bacteria 635
384 Ga0495650_0052164 3300046471 Bacteria 1680
385 Ga0495580_0334903 3300046472 Bacteria 1027
386 Ga0495580_0503369 3300046472 Bacteria 808
387 Ga0495594_0710724 3300046499 Unclassified 568
388 Ga0495606_0316263 3300046507 Bacteria 840
389 Ga0495616_0150963 3300046513 Bacteria 1051
390 Ga0495628_0868322 3300046516 Unclassified 628
391 Ga0495644_0151113 3300046523 Bacteria 889
392 Ga0495652_0561929 3300046529 Bacteria 783
393 Ga0495586_0395596 3300046535 Bacteria 795
394 Ga0495587_0016626 3300046536 Bacteria 4576
395 Ga0495622_0024612 3300046557 Bacteria 2811
396 Ga0495667_0079645 3300046559 Unclassified 2130
397 Ga0495634_0436686 3300046642 Bacteria 774
398 Ga0495611_0112080 3300046648 Bacteria 1270
399 Ga0495599_0240544 3300046678 Bacteria 1104
400 Ga0495623_0185365 3300046679 Bacteria 1206
401 Ga0495600_0867106 3300046809 Bacteria 534
402 Ga0495675_0282594 3300047444 Bacteria 989
403 Ga0495602_0280671 3300048088 Unclassified 1227
404 Ga0496106_0739331 3300048909 Bacteria 783
405 Ga0496107_0574618 3300048910 Bacteria 834
406 Ga0496110_1298741 3300048913 Bacteria 637
407 Ga0496126_0134801 3300048929 Bacteria 2131
408 Ga0501031_0778878 3300049568 Bacteria 613
409 Ga0501032_0041486 3300049569 Bacteria 3125
410 Ga0501032_0500608 3300049569 Unclassified 776
411 Ga0501033_0206647 3300049570 Bacteria 1401
412 Ga0501033_0304450 3300049570 Bacteria 1121
413 Ga0501034_0283104 3300049571 Bacteria 1597
414 Ga0501034_0386258 3300049571 Bacteria 1324
415 Ga0501036_0049607 3300049572 Bacteria 3554
416 Ga0501037_0211885 3300049573 Bacteria 1366
417 Ga0501038_0317811 3300049574 Bacteria 1219
418 Ga0501038_0573027 3300049574 Bacteria 857
419 Ga0501043_0076420 3300049579 Bacteria 2631
420 Ga0501046_0558949 3300049580 Bacteria 815
421 Ga0501046_0856915 3300049580 Bacteria 635
422 Ga0501047_0037616 3300049581 Bacteria 4679
423 Ga0501047_0061983 3300049581 Bacteria 3608
424 Ga0501047_0143961 3300049581 Bacteria 2261
425 Ga0501048_0029414 3300049582 Bacteria 3985
426 Ga0501067_0010118 3300049583 Bacteria 5217
427 Ga0501067_0018086 3300049583 Bacteria 3902
428 Ga0501069_0005873 3300049585 Bacteria 6393
429 Ga0501070_0033022 3300049586 Bacteria 4328
430 Ga0501070_0357591 3300049586 Unclassified 1185
431 Ga0501072_0059970 3300049588 Bacteria 3000
432 Ga0501073_0022208 3300049589 Bacteria 4572
433 Ga0501073_0025133 3300049589 Bacteria 4274
434 Ga0501073_0061256 3300049589 Bacteria 2626
435 Ga0501073_0621007 3300049589 Unclassified 746
436 Ga0501074_0024317 3300049590 Bacteria 4402
437 Ga0501079_0099807 3300049741 Bacteria 2250
438 Ga0501079_0676818 3300049741 Bacteria 812
439 Ga0501080_0101490 3300049742 Bacteria 2669
440 Ga0501080_0325160 3300049742 Bacteria 1391
441 Ga0501080_0360500 3300049742 Bacteria 1312
442 Ga0501080_0464069 3300049742 Bacteria 1134
443 Ga0501083_0260949 3300049744 Bacteria 1127
444 Ga0501083_0459758 3300049744 Bacteria 828
445 Ga0501035_0005667 3300049822 Bacteria 11792
446 Ga0501035_0014394 3300049822 Bacteria 7301
447 Ga0501035_0184264 3300049822 Bacteria 1797
448 Ga0501035_0488243 3300049822 Bacteria 1015
449 Ga0501044_0067624 3300049823 Bacteria 3640
450 Ga0501044_0104294 3300049823 Bacteria 2849
451 Ga0501044_0166521 3300049823 Bacteria 2178
452 Ga0501045_0778742 3300049824 Bacteria 705
453 nmdc:mga0n895_123408_c1 3300050512 Bacteria 2612
454 nmdc:mga0n895_171124_c1 3300050512 Bacteria 2204
455 nmdc:mga0rr50_394205_c1 3300050513 Unclassified 1169
456 nmdc:mga0rr50_617122_c1 3300050513 Bacteria 925
457 nmdc:mga08x19_406325_c1 3300050514 Unclassified 956
458 nmdc:mga08x19_82_c1 3300050514 Bacteria 86410
459 Ga0500595_012074 3300053119 Bacteria 3351
460 Ga0500597_139117 3300053120 Bacteria 1047
461 Ga0500597_277951 3300053120 Bacteria 676
462 Ga0500642_0288341 3300053130 Bacteria 744
463 Ga0500559_0037192 3300053136 Bacteria 2109
464 Ga0500559_0133089 3300053136 Bacteria 1162
465 Ga0500577_0027064 3300053142 Bacteria 1960
466 Ga0501084_0021067 3300054114 Bacteria 5437
467 Ga0501084_0051491 3300054114 Bacteria 3446
468 Ga0501082_0384722 3300060353 Bacteria 1224
469 Ga0501082_0419784 3300060353 Bacteria 1168

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_101029001 Ga0070671_1010290012 98
2 3300005614 Ga0068856_100504255 Ga0068856_1005042552 98
3 3300005614 Ga0068856_100558161 Ga0068856_1005581611 98
4 3300006237 Ga0097621_100487497 Ga0097621_1004874972 98
5 3300006237 Ga0097621_100597927 Ga0097621_1005979272 98
6 3300006358 Ga0068871_100042958 Ga0068871_1000429584 98
7 3300006358 Ga0068871_102310066 Ga0068871_1023100661 98
8 3300013307 Ga0157372_10111793 Ga0157372_101117934 98
9 3300013307 Ga0157372_10254033 Ga0157372_102540333 98
10 3300013307 Ga0157372_10576043 Ga0157372_105760432 98
11 3300014969 Ga0157376_10520946 Ga0157376_105209462 98
12 3300014969 Ga0157376_10996141 Ga0157376_109961412 98
13 3300025931 Ga0207644_10849238 Ga0207644_108492381 98
14 3300026078 Ga0207702_10457114 Ga0207702_104571143 98
15 3300026078 Ga0207702_11020837 Ga0207702_110208372 98
16 3300045976 Ga0466967_1707679 Ga0466967_1707679_217_546 98
17 3300031730 Ga0307516_10140238 Ga0307516_101402382 103
18 3300046559 Ga0495667_0079645 Ga0495667_0079645_156_488 103
19 3300047444 Ga0495675_0282594 Ga0495675_0282594_365_697 103
20 3300049574 Ga0501038_0317811 Ga0501038_0317811_473_808 104
21 3300049822 Ga0501035_0488243 Ga0501035_0488243_418_753 104
22 3300005336 Ga0070680_101142603 Ga0070680_1011426032 105
23 3300005341 Ga0070691_10013912 Ga0070691_100139122 105
24 3300005344 Ga0070661_100496478 Ga0070661_1004964782 105
25 3300005366 Ga0070659_100667325 Ga0070659_1006673252 105
26 3300005434 Ga0070709_10001661 Ga0070709_100016619 105
27 3300005435 Ga0070714_100319652 Ga0070714_1003196521 105
28 3300005436 Ga0070713_100000008 Ga0070713_10000000852 105
29 3300005439 Ga0070711_100322127 Ga0070711_1003221272 105
30 3300005440 Ga0070705_100168848 Ga0070705_1001688482 105
31 3300005444 Ga0070694_101573869 Ga0070694_1015738691 105
32 3300005445 Ga0070708_101441379 Ga0070708_1014413792 105
33 3300005458 Ga0070681_10667795 Ga0070681_106677952 105
34 3300005467 Ga0070706_100555279 Ga0070706_1005552792 105
35 3300005468 Ga0070707_100554103 Ga0070707_1005541032 105
36 3300005535 Ga0070684_100148818 Ga0070684_1001488181 105
37 3300005539 Ga0068853_100048135 Ga0068853_1000481352 105
38 3300005545 Ga0070695_100070767 Ga0070695_1000707673 105
39 3300005547 Ga0070693_100786431 Ga0070693_1007864311 105
40 3300005563 Ga0068855_100052376 Ga0068855_1000523764 105
41 3300005564 Ga0070664_101424856 Ga0070664_1014248562 105
42 3300005577 Ga0068857_100013915 Ga0068857_1000139153 105
43 3300005578 Ga0068854_100054518 Ga0068854_1000545183 105
44 3300005614 Ga0068856_100000572 Ga0068856_10000057236 105
45 3300005614 Ga0068856_100067611 Ga0068856_1000676114 105
46 3300005616 Ga0068852_100044610 Ga0068852_1000446102 105
47 3300006173 Ga0070716_100522956 Ga0070716_1005229561 105
48 3300006175 Ga0070712_100000202 Ga0070712_10000020235 105
49 3300006871 Ga0075434_100095266 Ga0075434_1000952661 105
50 3300006914 Ga0075436_100000053 Ga0075436_10000005343 105
51 3300006914 Ga0075436_100096140 Ga0075436_1000961403 105
52 3300006914 Ga0075436_100698944 Ga0075436_1006989441 105
53 3300007076 Ga0075435_100187090 Ga0075435_1001870902 105
54 3300009093 Ga0105240_10022148 Ga0105240_100221488 105
55 3300009174 Ga0105241_10194581 Ga0105241_101945812 105
56 3300009174 Ga0105241_10293765 Ga0105241_102937651 105
57 3300009174 Ga0105241_10947444 Ga0105241_109474441 105
58 3300009545 Ga0105237_10467518 Ga0105237_104675182 105
59 3300009545 Ga0105237_10962954 Ga0105237_109629542 105
60 3300009551 Ga0105238_10002176 Ga0105238_100021763 105
61 3300010375 Ga0105239_10116436 Ga0105239_101164362 105
62 3300011119 Ga0105246_11708264 Ga0105246_117082641 105
63 3300013100 Ga0157373_10013979 Ga0157373_100139794 105
64 3300013105 Ga0157369_10041905 Ga0157369_100419055 105
65 3300013296 Ga0157374_10656849 Ga0157374_106568492 105
66 3300013296 Ga0157374_10876954 Ga0157374_108769542 105
67 3300013306 Ga0163162_11016194 Ga0163162_110161942 105
68 3300013307 Ga0157372_11212643 Ga0157372_112126431 105
69 3300013308 Ga0157375_11526700 Ga0157375_115267001 105
70 3300014325 Ga0163163_10565052 Ga0163163_105650522 105
71 3300014968 Ga0157379_10031995 Ga0157379_100319952 105
72 3300014968 Ga0157379_10149907 Ga0157379_101499072 105
73 3300025906 Ga0207699_10000115 Ga0207699_1000011517 105
74 3300025911 Ga0207654_10275698 Ga0207654_102756982 105
75 3300025911 Ga0207654_10452955 Ga0207654_104529552 105
76 3300025912 Ga0207707_10128952 Ga0207707_101289521 105
77 3300025913 Ga0207695_10113494 Ga0207695_101134943 105
78 3300025914 Ga0207671_10148854 Ga0207671_101488543 105
79 3300025915 Ga0207693_10000149 Ga0207693_1000014946 105
80 3300025916 Ga0207663_10321542 Ga0207663_103215422 105
81 3300025922 Ga0207646_10477166 Ga0207646_104771662 105
82 3300025924 Ga0207694_10287249 Ga0207694_102872492 105
83 3300025928 Ga0207700_10000017 Ga0207700_100000178 105
84 3300025939 Ga0207665_10720621 Ga0207665_107206211 105
85 3300025949 Ga0207667_10223471 Ga0207667_102234711 105
86 3300026035 Ga0207703_11436622 Ga0207703_114366222 105
87 3300026041 Ga0207639_10232978 Ga0207639_102329783 105
88 3300026078 Ga0207702_10018397 Ga0207702_100183972 105
89 3300026078 Ga0207702_10261132 Ga0207702_102611323 105
90 3300026116 Ga0207674_10019953 Ga0207674_100199534 105
91 3300026142 Ga0207698_10071675 Ga0207698_100716753 105
92 3300031241 Ga0265325_10193009 Ga0265325_101930092 105
93 3300035088 Ga0373940_0259782 Ga0373940_0259782_23_355 105
94 3300035112 Ga0373932_0134646 Ga0373932_0134646_228_560 105
95 3300035172 Ga0373955_0179034 Ga0373955_0179034_157_489 105
96 3300035207 Ga0373942_0040355 Ga0373942_0040355_659_991 105
97 3300035242 Ga0373962_0177049 Ga0373962_0177049_361_693 105
98 3300035692 Ga0373935_0618069 Ga0373935_0618069_444_776 105
99 3300035724 Ga0373933_0079387 Ga0373933_0079387_545_877 105
100 3300036401 Ga0373937_0018988 Ga0373937_0018988_5607_5939 105
101 3300046463 Ga0495653_0665204 Ga0495653_0665204_109_435 105
102 3300046472 Ga0495580_0334903 Ga0495580_0334903_428_760 105
103 3300046472 Ga0495580_0503369 Ga0495580_0503369_331_663 105
104 3300046678 Ga0495599_0240544 Ga0495599_0240544_313_639 105
105 3300046679 Ga0495623_0185365 Ga0495623_0185365_529_861 105
106 3300046809 Ga0495600_0867106 Ga0495600_0867106_157_483 105
107 3300048909 Ga0496106_0739331 Ga0496106_0739331_178_513 105
108 3300048913 Ga0496110_1298741 Ga0496110_1298741_197_532 105
109 3300048929 Ga0496126_0134801 Ga0496126_0134801_1301_1657 105
110 3300049568 Ga0501031_0778878 Ga0501031_0778878_132_461 105
111 3300049569 Ga0501032_0500608 Ga0501032_0500608_408_737 105
112 3300049570 Ga0501033_0304450 Ga0501033_0304450_609_938 105
113 3300049574 Ga0501038_0573027 Ga0501038_0573027_213_542 105
114 3300049581 Ga0501047_0143961 Ga0501047_0143961_678_1007 105
115 3300049586 Ga0501070_0357591 Ga0501070_0357591_834_1160 105
116 3300049822 Ga0501035_0005667 Ga0501035_0005667_4839_5168 105
117 3300049823 Ga0501044_0067624 Ga0501044_0067624_2903_3232 105
118 3300050512 nmdc:mga0n895_123408_c1 nmdc:mga0n895_123408_c1_220_552 105
119 3300050512 nmdc:mga0n895_171124_c1 nmdc:mga0n895_171124_c1_156_491 105
120 3300050513 nmdc:mga0rr50_394205_c1 nmdc:mga0rr50_394205_c1_763_1095 105
121 3300050513 nmdc:mga0rr50_617122_c1 nmdc:mga0rr50_617122_c1_383_718 105
122 3300050514 nmdc:mga08x19_406325_c1 nmdc:mga08x19_406325_c1_125_457 105
123 3300050514 nmdc:mga08x19_82_c1 nmdc:mga08x19_82_c1_29028_29363 105
124 3300005338 Ga0068868_101038342 Ga0068868_1010383421 106
125 3300005455 Ga0070663_100499961 Ga0070663_1004999612 106
126 3300005456 Ga0070678_100009449 Ga0070678_1000094497 106
127 3300005535 Ga0070684_100085580 Ga0070684_1000855801 106
128 3300005539 Ga0068853_100530372 Ga0068853_1005303722 106
129 3300005563 Ga0068855_100390133 Ga0068855_1003901332 106
130 3300005564 Ga0070664_100182779 Ga0070664_1001827792 106
131 3300005614 Ga0068856_100015543 Ga0068856_1000155435 106
132 3300005616 Ga0068852_100318083 Ga0068852_1003180833 106
133 3300005617 Ga0068859_101490677 Ga0068859_1014906772 106
134 3300005618 Ga0068864_100334521 Ga0068864_1003345212 106
135 3300005718 Ga0068866_10415624 Ga0068866_104156242 106
136 3300005840 Ga0068870_10280417 Ga0068870_102804172 106
137 3300005844 Ga0068862_102291891 Ga0068862_1022918912 106
138 3300006237 Ga0097621_100177464 Ga0097621_1001774642 106
139 3300006237 Ga0097621_100652746 Ga0097621_1006527462 106
140 3300006358 Ga0068871_100077839 Ga0068871_1000778393 106
141 3300006881 Ga0068865_100121596 Ga0068865_1001215962 106
142 3300006931 Ga0097620_101490753 Ga0097620_1014907532 106
143 3300009093 Ga0105240_10184284 Ga0105240_101842842 106
144 3300009093 Ga0105240_10423820 Ga0105240_104238202 106
145 3300009098 Ga0105245_11867282 Ga0105245_118672822 106
146 3300009174 Ga0105241_10089324 Ga0105241_100893242 106
147 3300009176 Ga0105242_11119308 Ga0105242_111193082 106
148 3300009177 Ga0105248_10573885 Ga0105248_105738851 106
149 3300009551 Ga0105238_10271473 Ga0105238_102714733 106
150 3300010375 Ga0105239_10336369 Ga0105239_103363692 106
151 3300010375 Ga0105239_10411292 Ga0105239_104112923 106
152 3300011119 Ga0105246_10055476 Ga0105246_100554762 106
153 3300013105 Ga0157369_10109236 Ga0157369_101092362 106
154 3300013296 Ga0157374_10252724 Ga0157374_102527242 106
155 3300013297 Ga0157378_10472086 Ga0157378_104720862 106
156 3300013306 Ga0163162_10032167 Ga0163162_100321676 106
157 3300013306 Ga0163162_10214583 Ga0163162_102145833 106
158 3300013307 Ga0157372_12854445 Ga0157372_128544452 106
159 3300013308 Ga0157375_10049592 Ga0157375_100495922 106
160 3300014325 Ga0163163_10255226 Ga0163163_102552263 106
161 3300014969 Ga0157376_10021304 Ga0157376_100213046 106
162 3300025920 Ga0207649_10000287 Ga0207649_1000028747 106
163 3300028800 Ga0265338_10027063 Ga0265338_100270632 106
164 3300031240 Ga0265320_10000042 Ga0265320_1000004282 106
165 3300031241 Ga0265325_10334443 Ga0265325_103344432 106
166 3300031247 Ga0265340_10223253 Ga0265340_102232531 106
167 3300031250 Ga0265331_10106136 Ga0265331_101061361 106
168 3300031711 Ga0265314_10058474 Ga0265314_100584743 106
169 3300031711 Ga0265314_10108192 Ga0265314_101081922 106
170 3300031712 Ga0265342_10425268 Ga0265342_104252682 106
171 3300041456 Ga0451795_1570088 Ga0451795_1570088_380_715 106
172 3300046513 Ga0495616_0150963 Ga0495616_0150963_397_723 106
173 3300005327 Ga0070658_10040247 Ga0070658_100402474 107
174 3300005331 Ga0070670_100185581 Ga0070670_1001855812 107
175 3300005331 Ga0070670_100478130 Ga0070670_1004781302 107
176 3300005334 Ga0068869_100034305 Ga0068869_1000343052 107
177 3300005335 Ga0070666_10103805 Ga0070666_101038052 107
178 3300005338 Ga0068868_100841024 Ga0068868_1008410241 107
179 3300005338 Ga0068868_102277480 Ga0068868_1022774801 107
180 3300005339 Ga0070660_100055448 Ga0070660_1000554483 107
181 3300005340 Ga0070689_100921324 Ga0070689_1009213241 107
182 3300005344 Ga0070661_100817082 Ga0070661_1008170821 107
183 3300005353 Ga0070669_102012672 Ga0070669_1020126721 107
184 3300005354 Ga0070675_100044368 Ga0070675_1000443682 107
185 3300005355 Ga0070671_100888287 Ga0070671_1008882872 107
186 3300005364 Ga0070673_101281081 Ga0070673_1012810812 107
187 3300005437 Ga0070710_10925302 Ga0070710_109253022 107
188 3300005438 Ga0070701_10664557 Ga0070701_106645571 107
189 3300005439 Ga0070711_100578261 Ga0070711_1005782612 107
190 3300005444 Ga0070694_101807374 Ga0070694_1018073741 107
191 3300005458 Ga0070681_11228157 Ga0070681_112281572 107
192 3300005459 Ga0068867_100068675 Ga0068867_1000686753 107
193 3300005530 Ga0070679_100000062 Ga0070679_10000006230 107
194 3300005530 Ga0070679_100181382 Ga0070679_1001813822 107
195 3300005539 Ga0068853_100347206 Ga0068853_1003472062 107
196 3300005543 Ga0070672_100399963 Ga0070672_1003999632 107
197 3300005548 Ga0070665_100022221 Ga0070665_1000222212 107
198 3300005548 Ga0070665_100042867 Ga0070665_1000428671 107
199 3300005548 Ga0070665_100976032 Ga0070665_1009760321 107
200 3300005578 Ga0068854_101184110 Ga0068854_1011841101 107
201 3300005617 Ga0068859_100720335 Ga0068859_1007203351 107
202 3300005718 Ga0068866_10427112 Ga0068866_104271121 107
203 3300005840 Ga0068870_11060237 Ga0068870_110602372 107
204 3300006237 Ga0097621_100028354 Ga0097621_1000283543 107
205 3300006237 Ga0097621_100028776 Ga0097621_1000287766 107
206 3300006237 Ga0097621_100327616 Ga0097621_1003276162 107
207 3300006237 Ga0097621_100427531 Ga0097621_1004275312 107
208 3300006358 Ga0068871_100145317 Ga0068871_1001453173 107
209 3300006358 Ga0068871_100151664 Ga0068871_1001516643 107
210 3300006358 Ga0068871_100378533 Ga0068871_1003785332 107
211 3300006881 Ga0068865_100046430 Ga0068865_1000464303 107
212 3300006881 Ga0068865_100174416 Ga0068865_1001744162 107
213 3300006931 Ga0097620_100720306 Ga0097620_1007203061 107
214 3300009098 Ga0105245_10149270 Ga0105245_101492701 107
215 3300009098 Ga0105245_10905530 Ga0105245_109055302 107
216 3300009098 Ga0105245_10956167 Ga0105245_109561671 107
217 3300009148 Ga0105243_10014852 Ga0105243_100148525 107
218 3300009148 Ga0105243_10082244 Ga0105243_100822442 107
219 3300009174 Ga0105241_10193152 Ga0105241_101931523 107
220 3300009174 Ga0105241_10317230 Ga0105241_103172302 107
221 3300009176 Ga0105242_10019128 Ga0105242_100191283 107
222 3300009176 Ga0105242_10166737 Ga0105242_101667371 107
223 3300009176 Ga0105242_10219179 Ga0105242_102191793 107
224 3300009176 Ga0105242_10392234 Ga0105242_103922342 107
225 3300009176 Ga0105242_11761678 Ga0105242_117616782 107
226 3300009177 Ga0105248_10161295 Ga0105248_101612954 107
227 3300009177 Ga0105248_10846506 Ga0105248_108465062 107
228 3300009545 Ga0105237_12309962 Ga0105237_123099621 107
229 3300009551 Ga0105238_12411923 Ga0105238_124119232 107
230 3300010375 Ga0105239_10000400 Ga0105239_1000040047 107
231 3300011119 Ga0105246_10073239 Ga0105246_100732393 107
232 3300013100 Ga0157373_10078924 Ga0157373_100789243 107
233 3300013105 Ga0157369_10344048 Ga0157369_103440482 107
234 3300013297 Ga0157378_10109029 Ga0157378_101090292 107
235 3300013297 Ga0157378_10210952 Ga0157378_102109523 107
236 3300013297 Ga0157378_10615012 Ga0157378_106150122 107
237 3300013297 Ga0157378_11320052 Ga0157378_113200522 107
238 3300013306 Ga0163162_10565746 Ga0163162_105657462 107
239 3300013308 Ga0157375_11545527 Ga0157375_115455272 107
240 3300014325 Ga0163163_10000002 Ga0163163_1000000249 107
241 3300014745 Ga0157377_10080869 Ga0157377_100808691 107
242 3300014968 Ga0157379_10049747 Ga0157379_100497473 107
243 3300014968 Ga0157379_10915661 Ga0157379_109156613 107
244 3300014969 Ga0157376_10138855 Ga0157376_101388552 107
245 3300014969 Ga0157376_10490117 Ga0157376_104901172 107
246 3300014969 Ga0157376_10534183 Ga0157376_105341832 107
247 3300025899 Ga0207642_10427665 Ga0207642_104276652 107
248 3300025903 Ga0207680_10043432 Ga0207680_100434322 107
249 3300025907 Ga0207645_10011595 Ga0207645_100115953 107
250 3300025907 Ga0207645_10204363 Ga0207645_102043631 107
251 3300025912 Ga0207707_10000002 Ga0207707_10000002626 107
252 3300025912 Ga0207707_10838708 Ga0207707_108387081 107
253 3300025914 Ga0207671_10532665 Ga0207671_105326652 107
254 3300025916 Ga0207663_10227578 Ga0207663_102275782 107
255 3300025917 Ga0207660_10000025 Ga0207660_1000002580 107
256 3300025919 Ga0207657_10029592 Ga0207657_100295924 107
257 3300025920 Ga0207649_10781787 Ga0207649_107817872 107
258 3300025921 Ga0207652_10000712 Ga0207652_1000071230 107
259 3300025921 Ga0207652_11612519 Ga0207652_116125192 107
260 3300025924 Ga0207694_10207354 Ga0207694_102073543 107
261 3300025925 Ga0207650_10386482 Ga0207650_103864822 107
262 3300025926 Ga0207659_10038455 Ga0207659_100384554 107
263 3300025926 Ga0207659_10288419 Ga0207659_102884192 107
264 3300025927 Ga0207687_10079348 Ga0207687_100793483 107
265 3300025927 Ga0207687_10605026 Ga0207687_106050262 107
266 3300025931 Ga0207644_10287216 Ga0207644_102872162 107
267 3300025933 Ga0207706_10709061 Ga0207706_107090612 107
268 3300025934 Ga0207686_10158062 Ga0207686_101580623 107
269 3300025934 Ga0207686_10210353 Ga0207686_102103531 107
270 3300025935 Ga0207709_10026699 Ga0207709_100266993 107
271 3300025938 Ga0207704_10217276 Ga0207704_102172762 107
272 3300025938 Ga0207704_10291720 Ga0207704_102917203 107
273 3300025940 Ga0207691_10480322 Ga0207691_104803222 107
274 3300025942 Ga0207689_10006791 Ga0207689_100067916 107
275 3300025942 Ga0207689_10120773 Ga0207689_101207733 107
276 3300025945 Ga0207679_10359616 Ga0207679_103596162 107
277 3300025960 Ga0207651_10007945 Ga0207651_100079457 107
278 3300026023 Ga0207677_10006801 Ga0207677_100068016 107
279 3300026023 Ga0207677_10372439 Ga0207677_103724392 107
280 3300026041 Ga0207639_10213268 Ga0207639_102132682 107
281 3300026075 Ga0207708_11200790 Ga0207708_112007902 107
282 3300026088 Ga0207641_11185548 Ga0207641_111855481 107
283 3300026089 Ga0207648_10041671 Ga0207648_100416713 107
284 3300026116 Ga0207674_11362420 Ga0207674_113624202 107
285 3300028379 Ga0268266_10008917 Ga0268266_1000891710 107
286 3300028379 Ga0268266_10292393 Ga0268266_102923933 107
287 3300028380 Ga0268265_11039004 Ga0268265_110390042 107
288 3300031238 Ga0265332_10413437 Ga0265332_104134372 107
289 3300035692 Ga0373935_0638434 Ga0373935_0638434_388_714 107
290 3300041460 Ga0451802_1918129 Ga0451802_1918129_167_496 107
291 3300046454 Ga0495592_0838595 Ga0495592_0838595_77_403 107
292 3300046507 Ga0495606_0316263 Ga0495606_0316263_172_504 107
293 3300046535 Ga0495586_0395596 Ga0495586_0395596_145_474 107
294 3300046557 Ga0495622_0024612 Ga0495622_0024612_602_928 107
295 3300046642 Ga0495634_0436686 Ga0495634_0436686_129_455 107
296 3300046648 Ga0495611_0112080 Ga0495611_0112080_659_985 107
297 3300048910 Ga0496107_0574618 Ga0496107_0574618_314_688 107
298 3300049569 Ga0501032_0041486 Ga0501032_0041486_859_1188 107
299 3300049571 Ga0501034_0283104 Ga0501034_0283104_311_640 107
300 3300049571 Ga0501034_0386258 Ga0501034_0386258_908_1237 107
301 3300049572 Ga0501036_0049607 Ga0501036_0049607_71_400 107
302 3300049573 Ga0501037_0211885 Ga0501037_0211885_392_721 107
303 3300049579 Ga0501043_0076420 Ga0501043_0076420_1544_1873 107
304 3300049580 Ga0501046_0856915 Ga0501046_0856915_188_517 107
305 3300049581 Ga0501047_0037616 Ga0501047_0037616_3156_3485 107
306 3300049582 Ga0501048_0029414 Ga0501048_0029414_502_831 107
307 3300049583 Ga0501067_0010118 Ga0501067_0010118_1020_1349 107
308 3300049583 Ga0501067_0018086 Ga0501067_0018086_81_410 107
309 3300049585 Ga0501069_0005873 Ga0501069_0005873_5332_5661 107
310 3300049586 Ga0501070_0033022 Ga0501070_0033022_3020_3349 107
311 3300049588 Ga0501072_0059970 Ga0501072_0059970_499_828 107
312 3300049589 Ga0501073_0022208 Ga0501073_0022208_2784_3113 107
313 3300049589 Ga0501073_0025133 Ga0501073_0025133_76_405 107
314 3300049589 Ga0501073_0621007 Ga0501073_0621007_212_541 107
315 3300049590 Ga0501074_0024317 Ga0501074_0024317_3870_4199 107
316 3300049741 Ga0501079_0099807 Ga0501079_0099807_968_1297 107
317 3300049741 Ga0501079_0676818 Ga0501079_0676818_403_732 107
318 3300049742 Ga0501080_0101490 Ga0501080_0101490_1370_1699 107
319 3300049742 Ga0501080_0325160 Ga0501080_0325160_235_564 107
320 3300049742 Ga0501080_0464069 Ga0501080_0464069_786_1112 107
321 3300049744 Ga0501083_0459758 Ga0501083_0459758_473_802 107
322 3300049822 Ga0501035_0014394 Ga0501035_0014394_3155_3484 107
323 3300049823 Ga0501044_0104294 Ga0501044_0104294_1528_1857 107
324 3300049824 Ga0501045_0778742 Ga0501045_0778742_328_657 107
325 3300053120 Ga0500597_139117 Ga0500597_139117_688_1014 107
326 3300053120 Ga0500597_277951 Ga0500597_277951_52_378 107
327 3300053130 Ga0500642_0288341 Ga0500642_0288341_68_397 107
328 3300053136 Ga0500559_0133089 Ga0500559_0133089_715_1041 107
329 3300053142 Ga0500577_0027064 Ga0500577_0027064_360_689 107
330 3300054114 Ga0501084_0021067 Ga0501084_0021067_1314_1643 107
331 3300054114 Ga0501084_0051491 Ga0501084_0051491_1107_1436 107
332 3300060353 Ga0501082_0384722 Ga0501082_0384722_862_1191 107
333 3300060353 Ga0501082_0419784 Ga0501082_0419784_391_720 107
334 3300005335 Ga0070666_10006798 Ga0070666_100067983 108
335 3300005355 Ga0070671_100364051 Ga0070671_1003640512 108
336 3300005367 Ga0070667_100053625 Ga0070667_1000536253 108
337 3300005437 Ga0070710_11283162 Ga0070710_112831621 108
338 3300005539 Ga0068853_100132572 Ga0068853_1001325723 108
339 3300005543 Ga0070672_100724717 Ga0070672_1007247171 108
340 3300005548 Ga0070665_100078549 Ga0070665_1000785493 108
341 3300005548 Ga0070665_100176171 Ga0070665_1001761714 108
342 3300005617 Ga0068859_101774127 Ga0068859_1017741272 108
343 3300005719 Ga0068861_100277549 Ga0068861_1002775493 108
344 3300005841 Ga0068863_100049744 Ga0068863_1000497445 108
345 3300005842 Ga0068858_100015988 Ga0068858_1000159884 108
346 3300006931 Ga0097620_101774106 Ga0097620_1017741062 108
347 3300009101 Ga0105247_10950345 Ga0105247_109503451 108
348 3300009174 Ga0105241_10576172 Ga0105241_105761722 108
349 3300009176 Ga0105242_10406682 Ga0105242_104066823 108
350 3300009177 Ga0105248_10028228 Ga0105248_100282288 108
351 3300009545 Ga0105237_10299045 Ga0105237_102990452 108
352 3300009545 Ga0105237_10623863 Ga0105237_106238632 108
353 3300009553 Ga0105249_10033055 Ga0105249_100330552 108
354 3300010375 Ga0105239_11778736 Ga0105239_117787362 108
355 3300013104 Ga0157370_10014830 Ga0157370_100148303 108
356 3300013296 Ga0157374_10108049 Ga0157374_101080492 108
357 3300013297 Ga0157378_10261092 Ga0157378_102610922 108
358 3300013306 Ga0163162_10563663 Ga0163162_105636632 108
359 3300014325 Ga0163163_10348214 Ga0163163_103482142 108
360 3300014968 Ga0157379_10063225 Ga0157379_100632253 108
361 3300025903 Ga0207680_10223103 Ga0207680_102231032 108
362 3300025909 Ga0207705_10407147 Ga0207705_104071472 108
363 3300025911 Ga0207654_10647621 Ga0207654_106476212 108
364 3300025914 Ga0207671_10194062 Ga0207671_101940622 108
365 3300025914 Ga0207671_10715973 Ga0207671_107159732 108
366 3300025927 Ga0207687_10146288 Ga0207687_101462882 108
367 3300025931 Ga0207644_10277087 Ga0207644_102770872 108
368 3300025941 Ga0207711_11146963 Ga0207711_111469631 108
369 3300025961 Ga0207712_11723552 Ga0207712_117235522 108
370 3300025986 Ga0207658_10158151 Ga0207658_101581513 108
371 3300025986 Ga0207658_11163230 Ga0207658_111632302 108
372 3300026035 Ga0207703_10208803 Ga0207703_102088031 108
373 3300026088 Ga0207641_10326025 Ga0207641_103260252 108
374 3300026116 Ga0207674_10704251 Ga0207674_107042512 108
375 3300026118 Ga0207675_100370315 Ga0207675_1003703151 108
376 3300028379 Ga0268266_10090112 Ga0268266_100901123 108
377 3300028379 Ga0268266_11488820 Ga0268266_114888202 108
378 3300031235 Ga0265330_10032808 Ga0265330_100328083 108
379 3300031239 Ga0265328_10117655 Ga0265328_101176552 108
380 3300031249 Ga0265339_10301211 Ga0265339_103012111 108
381 3300031344 Ga0265316_10354917 Ga0265316_103549172 108
382 3300036401 Ga0373937_1516330 Ga0373937_1516330_256_594 108
383 3300037466 Ga0395898_0056743 Ga0395898_0056743_1791_2117 108
384 3300038443 Ga0395901_0364277 Ga0395901_0364277_701_1027 108
385 3300039437 Ga0436365_0725141 Ga0436365_0725141_229_555 108
386 3300046471 Ga0495650_0052164 Ga0495650_0052164_48_377 108
387 3300046516 Ga0495628_0868322 Ga0495628_0868322_277_612 108
388 3300046523 Ga0495644_0151113 Ga0495644_0151113_19_360 108
389 3300046536 Ga0495587_0016626 Ga0495587_0016626_3644_3979 108
390 3300048088 Ga0495602_0280671 Ga0495602_0280671_565_900 108
391 3300049570 Ga0501033_0206647 Ga0501033_0206647_773_1114 108
392 3300049580 Ga0501046_0558949 Ga0501046_0558949_83_415 108
393 3300049581 Ga0501047_0061983 Ga0501047_0061983_526_867 108
394 3300049589 Ga0501073_0061256 Ga0501073_0061256_1491_1817 108
395 3300049742 Ga0501080_0360500 Ga0501080_0360500_555_881 108
396 3300049744 Ga0501083_0260949 Ga0501083_0260949_774_1100 108
397 3300049822 Ga0501035_0184264 Ga0501035_0184264_395_736 108
398 3300049823 Ga0501044_0166521 Ga0501044_0166521_271_612 108
399 3300005543 Ga0070672_100995003 Ga0070672_1009950032 109
400 3300005843 Ga0068860_101371197 Ga0068860_1013711972 109
401 3300006358 Ga0068871_100001780 Ga0068871_10000178017 109
402 3300006358 Ga0068871_101901506 Ga0068871_1019015061 109
403 3300028381 Ga0268264_11028617 Ga0268264_110286172 109
404 3300045976 Ga0466967_0136809 Ga0466967_0136809_1692_2021 109
405 3300046499 Ga0495594_0710724 Ga0495594_0710724_126_506 109
406 3300046529 Ga0495652_0561929 Ga0495652_0561929_160_528 109
407 3300053119 Ga0500595_012074 Ga0500595_012074_1231_1611 109
408 3300053136 Ga0500559_0037192 Ga0500559_0037192_142_522 109
409 3300005327 Ga0070658_10006544 Ga0070658_100065448 110
410 3300005329 Ga0070683_100078998 Ga0070683_1000789983 110
411 3300005329 Ga0070683_101038004 Ga0070683_1010380042 110
412 3300005336 Ga0070680_100334338 Ga0070680_1003343383 110
413 3300005336 Ga0070680_101588507 Ga0070680_1015885072 110
414 3300005344 Ga0070661_100306402 Ga0070661_1003064021 110
415 3300005366 Ga0070659_101549131 Ga0070659_1015491311 110
416 3300005458 Ga0070681_10166782 Ga0070681_101667823 110
417 3300005458 Ga0070681_10696653 Ga0070681_106966532 110
418 3300005530 Ga0070679_100007554 Ga0070679_1000075547 110
419 3300005539 Ga0068853_100217237 Ga0068853_1002172372 110
420 3300005547 Ga0070693_100191458 Ga0070693_1001914582 110
421 3300005548 Ga0070665_100000162 Ga0070665_10000016292 110
422 3300005563 Ga0068855_100799551 Ga0068855_1007995512 110
423 3300005563 Ga0068855_101584107 Ga0068855_1015841071 110
424 3300005577 Ga0068857_100110600 Ga0068857_1001106003 110
425 3300005577 Ga0068857_100261971 Ga0068857_1002619712 110
426 3300005614 Ga0068856_101595616 Ga0068856_1015956162 110
427 3300009093 Ga0105240_10056354 Ga0105240_100563544 110
428 3300009093 Ga0105240_10173084 Ga0105240_101730844 110
429 3300009093 Ga0105240_10323719 Ga0105240_103237193 110
430 3300009093 Ga0105240_12348579 Ga0105240_123485792 110
431 3300009545 Ga0105237_10231864 Ga0105237_102318642 110
432 3300009551 Ga0105238_10821584 Ga0105238_108215842 110
433 3300009551 Ga0105238_11640282 Ga0105238_116402821 110
434 3300009551 Ga0105238_11992130 Ga0105238_119921302 110
435 3300010375 Ga0105239_11283323 Ga0105239_112833232 110
436 3300013104 Ga0157370_11111593 Ga0157370_111115932 110
437 3300013105 Ga0157369_10104810 Ga0157369_101048102 110
438 3300013105 Ga0157369_10446314 Ga0157369_104463142 110
439 3300013105 Ga0157369_12694310 Ga0157369_126943101 110
440 3300013307 Ga0157372_12692474 Ga0157372_126924741 110
441 3300025909 Ga0207705_10012953 Ga0207705_100129534 110
442 3300025912 Ga0207707_10100569 Ga0207707_101005692 110
443 3300025912 Ga0207707_10280025 Ga0207707_102800253 110
444 3300025913 Ga0207695_10277986 Ga0207695_102779863 110
445 3300025913 Ga0207695_10279645 Ga0207695_102796452 110
446 3300025913 Ga0207695_11354913 Ga0207695_113549132 110
447 3300025914 Ga0207671_10452244 Ga0207671_104522442 110
448 3300025917 Ga0207660_10257272 Ga0207660_102572722 110
449 3300025920 Ga0207649_10171431 Ga0207649_101714313 110
450 3300025920 Ga0207649_10749564 Ga0207649_107495642 110
451 3300025921 Ga0207652_10039420 Ga0207652_100394203 110
452 3300025921 Ga0207652_11664481 Ga0207652_116644812 110
453 3300025928 Ga0207700_10469444 Ga0207700_104694441 110
454 3300025945 Ga0207679_10746913 Ga0207679_107469132 110
455 3300025949 Ga0207667_10595461 Ga0207667_105954612 110
456 3300025949 Ga0207667_10634147 Ga0207667_106341472 110
457 3300025981 Ga0207640_11119972 Ga0207640_111199722 110
458 3300026041 Ga0207639_10421964 Ga0207639_104219642 110
459 3300026041 Ga0207639_10618580 Ga0207639_106185802 110
460 3300026078 Ga0207702_10153045 Ga0207702_101530453 110
461 3300026116 Ga0207674_11560016 Ga0207674_115600162 110
462 3300028379 Ga0268266_10003361 Ga0268266_1000336115 110
463 3300031235 Ga0265330_10046154 Ga0265330_100461543 110
464 3300031238 Ga0265332_10026666 Ga0265332_100266663 110
465 3300031241 Ga0265325_10077334 Ga0265325_100773342 110
466 3300031249 Ga0265339_10045200 Ga0265339_100452001 110
467 3300031711 Ga0265314_10048205 Ga0265314_100482054 110
468 3300031712 Ga0265342_10021183 Ga0265342_100211834 110
469 3300045976 Ga0466967_0207816 Ga0466967_0207816_995_1327 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13473

Cupredoxin_1

Cupredoxin-like domain

8

112

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hcf-assembly2.cif.gz_B crystal structure of uncharacterized cupredoxin-like domain protein cupredoxin_1 with copper bound from bacillus anthracis 0.9125 23 110
5tk2-assembly3.cif.gz_C crystal structure of uncharacterized cupredoxin-like domain protein from bacillus anthracis 0.9118 25 110
5u7n-assembly7.cif.gz_G crystal structure of a chimeric cua domain (subunit ii) of cytochrome ba3 from thermus thermophilus with the amicyanin loop 0.9116 26 110
1iby-assembly1.cif.gz_C red copper protein nitrosocyanin from nitrosomonas europaea 0.9073 35 109
1fwx-assembly2.cif.gz_D crystal structure of nitrous oxide reductase from p. denitrificans 0.9064 26 110
ID Description Score Start End Superfamily
4hcfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9315 27 110 2.60.40.420
5u7nF00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9081 26 110 2.60.40.420
1ibyB00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9049 35 109 2.60.40.420
4hcfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8915 27 110 2.60.40.420
4f2eA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8877 26 110 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A0F3MBZ7-F1-model_v4 Cupredoxin-like domain protein 0.9906 30 110
AF-A0A7W8D273-F1-model_v4 Heme/copper-type cytochrome/quinol oxidase subunit 2 0.9874 25 110
AF-A0A3B8T3B5-F1-model_v4 Cupredoxin domain-containing protein 0.9862 28 110
AF-A0A525IDU3-F1-model_v4 Cupredoxin domain-containing protein 0.9758 27 110
AF-A0A178MZS9-F1-model_v4 EfeO-type cupredoxin-like domain-containing protein 0.9749 25 110

Feature Viewer

pLDDT pTM Quality
86.43 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map