F450167

General Info

Members Datasets Scaffolds Average Seq Length
469 378 938 269

Family's Representative Sequence

Representative Sequence 3300003762|Ga0055542_1001631|Ga0055542_10016313
Length 282
Sequence VSDILRKIEAYKRDEIAAAKARVPLAEIRARAKDADAPRGFLAALEAKRGSGRFALIAEIKKASPSKGLIRADFDPPALARAYEKGGAACLSVLTDAPSFQGAPEFLTRARAAVALPALRKDFLFDPYQVYEARAWGADAILIIMASVDDALASELEATAFELGMDALIEVHDEAETMRALKLSSRLIGINNRNLRTFETSLETSERLATMVPADRLLVSESGIFTHDDCLRLQKKDIGAFLVGESLMRQEDVTAATRILLTGKALDASARKSESIFGEHDA

Samples

Sample ID Description Type Environment
1 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
14 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
31 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
33 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
49 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
50 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
51 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
52 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
53 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
54 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
55 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
56 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
57 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
58 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
64 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
65 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
66 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
67 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
68 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
69 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
70 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
71 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
72 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
73 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
74 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
75 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
76 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
77 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
78 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
79 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
80 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
81 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
82 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
83 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
84 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
85 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
86 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
87 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
88 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
104 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
105 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
109 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
110 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
111 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
112 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
113 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
114 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
115 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
116 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
117 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
118 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
119 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
120 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
121 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
122 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
123 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
124 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
125 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
126 2512875024
127 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
128 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
129 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
130 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
131 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
132 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
133 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
134 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
135 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
136 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
137 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
138 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
139 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
140 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
141 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
142 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
143 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
144 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
145 2738543024 Aminobacter sp. AP02 Isolate Unclassified
146 2751185800 Brucella pituitosa AA2 Isolate Unclassified
147 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
148 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
149 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
150 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
151 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
152 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
153 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
154 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
155 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
156 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
157 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
158 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
159 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
160 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
161 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
162 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
163 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
164 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
165 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
166 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
167 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
168 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
169 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
170 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
171 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
172 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
173 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
174 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
175 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
176 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
177 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
178 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
179 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
180 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
181 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
182 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
183 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
184 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
185 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
186 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
187 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
188 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
189 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
190 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
191 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
192 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
193 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
194 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
195 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
196 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
197 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
198 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
199 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
200 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
201 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
202 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
203 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
204 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
205 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
206 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
207 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
208 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
209 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
210 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
211 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
212 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
213 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
214 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
215 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
216 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
217 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
218 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
219 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
220 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
221 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
222 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
223 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
224 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
225 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
226 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
227 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
228 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
229 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
230 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
231 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
232 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
233 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
234 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
235 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
236 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
237 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
238 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
239 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
240 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
241 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
242 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
243 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
244 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
245 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
246 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
247 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
248 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
249 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
250 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
251 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
252 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
253 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
254 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
255 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
256 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
257 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
258 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
259 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
260 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
261 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
262 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
263 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
264 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
265 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
266 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
267 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
268 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
269 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
270 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
271 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
272 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
273 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
274 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
275 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
276 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
277 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
278 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
279 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
280 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
281 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
282 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
283 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
284 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
285 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
286 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
287 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
288 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
289 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
290 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
291 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
292 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
293 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
294 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
295 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
296 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
297 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
298 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
299 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
300 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
301 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
302 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
303 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
304 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
305 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
306 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
307 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
308 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
309 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
310 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
311 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
312 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
313 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
314 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
315 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
316 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
317 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
318 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
319 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
320 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
321 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
322 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
323 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
324 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
325 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
326 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
327 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
328 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
329 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
330 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
331 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
332 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
333 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
334 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
335 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
336 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
337 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
338 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
339 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
340 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
341 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
342 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
343 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
344 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
345 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
346 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
347 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
348 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
349 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
350 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
351 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
352 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
353 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
354 3004167301 Mesorhizobium loti 582 Isolate Unclassified
355 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
356 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
357 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
358 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
359 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
360 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
361 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
362 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
363 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
364 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
365 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
366 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
367 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
368 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
369 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
370 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
371 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
372 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
373 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
374 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
375 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
376 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
377 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
378 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 44.35
Metatranscriptomes 0
Isolates 55.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.18
Nodule 46.7
Rhizoplane 4.05
Rhizosphere 32.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055542_1001631 3300003762 Bacteria 10113
2 JGI24739J22299_10013791 3300001989 Bacteria 2946
3 JGI24735J21928_10028797 3300002067 Bacteria 1657
4 JGI25165J46597_1000033 3300003214 Bacteria 293030
5 Ga0055529_1001715 3300003763 Bacteria 5611
6 Ga0070660_100498901 3300005339 Bacteria 1012
7 Ga0068853_100077900 3300005539 Bacteria 2896
8 Ga0068853_100166771 3300005539 Bacteria 1990
9 Ga0068855_100074803 3300005563 Bacteria 3934
10 Ga0068856_100155122 3300005614 Bacteria 2300
11 Ga0081538_10010807 3300005981 Bacteria 7455
12 Ga0075365_10003274 3300006038 Bacteria 8304
13 Ga0075365_10010098 3300006038 Bacteria 5476
14 Ga0075365_10357956 3300006038 Bacteria 1029
15 Ga0075363_100093355 3300006048 Bacteria 1658
16 Ga0075363_100139282 3300006048 Bacteria 1365
17 Ga0075364_10002851 3300006051 Bacteria 9744
18 Ga0075364_10012314 3300006051 Bacteria 5227
19 Ga0070712_100004104 3300006175 Bacteria 8949
20 Ga0075367_10036213 3300006178 Bacteria 2860
21 Ga0075367_10214800 3300006178 Bacteria 1203
22 Ga0075369_10015493 3300006186 Bacteria 3060
23 Ga0075370_10015646 3300006353 Bacteria 4066
24 Ga0075434_100989695 3300006871 Bacteria 855
25 Ga0105245_10658005 3300009098 Bacteria 1078
26 Ga0105247_10197906 3300009101 Bacteria 1349
27 Ga0105241_10163809 3300009174 Bacteria 1830
28 Ga0105248_10463231 3300009177 Bacteria 1429
29 Ga0105237_10033099 3300009545 Bacteria 5236
30 Ga0105237_10082968 3300009545 Bacteria 3196
31 Ga0105238_10011213 3300009551 Bacteria 9017
32 Ga0105238_10353055 3300009551 Bacteria 1459
33 Ga0105239_10061929 3300010375 Bacteria 4107
34 Ga0105239_10142984 3300010375 Bacteria 2667
35 Ga0105239_10193880 3300010375 Bacteria 2275
36 Ga0105239_10404342 3300010375 Bacteria 1545
37 Ga0157370_10193672 3300013104 Bacteria 1887
38 Ga0157374_10154636 3300013296 Bacteria 2231
39 Ga0157378_10837197 3300013297 Bacteria 948
40 Ga0163163_10014595 3300014325 Bacteria 7226
41 Ga0213874_10007567 3300021377 Bacteria 2612
42 Ga0209148_1000072 3300025254 Bacteria 325292
43 Ga0209233_1000027 3300025261 Bacteria 652089
44 Ga0209455_1000133 3300025272 Bacteria 155670
45 Ga0207710_10070335 3300025900 Bacteria 1603
46 Ga0207647_10009185 3300025904 Bacteria 7034
47 Ga0207695_10325935 3300025913 Bacteria 1425
48 Ga0207671_10012933 3300025914 Bacteria 6680
49 Ga0207693_10001524 3300025915 Bacteria 20450
50 Ga0207652_10114485 3300025921 Bacteria 2395
51 Ga0207694_10002336 3300025924 Bacteria 15508
52 Ga0207691_10274818 3300025940 Bacteria 1450
53 Ga0207667_10339225 3300025949 Bacteria 1534
54 Ga0207639_10003324 3300026041 Bacteria 10825
55 Ga0207639_10494782 3300026041 Bacteria 1116
56 Ga0207678_10426719 3300026067 Bacteria 1150
57 Ga0207702_10158747 3300026078 Bacteria 2064
58 Ga0207698_10107010 3300026142 Bacteria 2334
59 Ga0207698_10216589 3300026142 Bacteria 1727
60 Ga0268266_10489244 3300028379 Bacteria 1173
61 Ga0265318_10066167 3300028577 Bacteria 1343
62 Ga0307515_10294007 3300028794 Bacteria 1317
63 Ga0265332_10134742 3300031238 Bacteria 1036
64 Ga0265340_10164102 3300031247 Bacteria 1008
65 Ga0265316_10152357 3300031344 Bacteria 1732
66 Ga0265342_10019294 3300031712 Bacteria 4398
67 Ga0307412_10616221 3300031911 Bacteria 921
68 Ga0307414_10421087 3300032004 Bacteria 1165
69 Ga0373931_0084671 3300035691 Bacteria 1756
70 Ga0373925_0273192 3300037068 Bacteria 1360
71 Ga0395899_0000398 3300037312 Bacteria 51631
72 Ga0395899_0060608 3300037312 Bacteria 2788
73 Ga0395900_0000121 3300037418 Bacteria 135026
74 Ga0395900_0020571 3300037418 Bacteria 6739
75 Ga0395898_0000247 3300037466 Bacteria 135026
76 Ga0395898_0557066 3300037466 Bacteria 1089
77 Ga0395905_0000112 3300037471 Bacteria 135010
78 Ga0395905_0014885 3300037471 Bacteria 7421
79 Ga0395905_0143643 3300037471 Bacteria 2245
80 Ga0395905_0481709 3300037471 Bacteria 1140
81 Ga0395901_0000078 3300038443 Bacteria 135026
82 Ga0395901_0006071 3300038443 Bacteria 12242
83 Ga0395901_0058856 3300038443 Bacteria 3997
84 Ga0395901_0171581 3300038443 Bacteria 2276
85 Ga0436365_0785116 3300039437 Bacteria 1076
86 Ga0436363_0402394 3300039450 Bacteria 7738
87 Ga0436363_0799139 3300039450 Bacteria 2280
88 Ga0439465_0118429 3300041413 Bacteria 927
89 Ga0495639_0102373 3300046475 Bacteria 1353
90 Ga0495632_0106091 3300046519 Bacteria 1322
91 Ga0495668_0038180 3300046616 Bacteria 2685
92 Ga0495668_0173678 3300046616 Bacteria 1181
93 Ga0495624_0185626 3300046690 Bacteria 1266
94 Ga0495660_0071605 3300046810 Bacteria 1838
95 Ga0495686_0226965 3300047472 Bacteria 1059
96 Ga0496100_0045350 3300048903 Bacteria 2821
97 Ga0496104_0025010 3300048907 Bacteria 5501
98 Ga0496105_0003600 3300048908 Bacteria 11504
99 Ga0496108_0008682 3300048911 Bacteria 8238
100 Ga0496108_0623194 3300048911 Bacteria 939
101 Ga0496109_0001287 3300048912 Bacteria 20815
102 Ga0496109_0134674 3300048912 Bacteria 2308
103 Ga0496109_0303016 3300048912 Bacteria 1507
104 Ga0496110_0107960 3300048913 Bacteria 2499
105 Ga0496110_0175038 3300048913 Bacteria 1947
106 Ga0496111_0108154 3300048914 Bacteria 2047
107 Ga0496112_0003602 3300048915 Bacteria 12887
108 Ga0496112_0316446 3300048915 Bacteria 1505
109 Ga0496113_0003739 3300048916 Bacteria 9172
110 Ga0496113_0064999 3300048916 Bacteria 2760
111 Ga0496113_0209840 3300048916 Bacteria 1550
112 Ga0496114_0092772 3300048917 Bacteria 2566
113 Ga0496115_0008667 3300048918 Bacteria 7536
114 Ga0496119_0005249 3300048922 Bacteria 12486
115 Ga0496119_0055643 3300048922 Bacteria 2402
116 Ga0496119_0157016 3300048922 Bacteria 1213
117 Ga0496120_0008156 3300048923 Bacteria 7682
118 Ga0496120_0261189 3300048923 Bacteria 808
119 Ga0496122_0045274 3300048925 Bacteria 3421
120 Ga0496122_0080223 3300048925 Bacteria 2276
121 Ga0496123_0172042 3300048926 Bacteria 1141
122 Ga0496126_0017843 3300048929 Bacteria 7062
123 Ga0501031_0000095 3300049568 Bacteria 47538
124 Ga0501031_0005703 3300049568 Bacteria 8115
125 Ga0501031_0040336 3300049568 Bacteria 3048
126 Ga0501031_0258959 3300049568 Bacteria 1130
127 Ga0501032_0000064 3300049569 Bacteria 91971
128 Ga0501032_0000084 3300049569 Bacteria 82148
129 Ga0501032_0066309 3300049569 Bacteria 2412
130 Ga0501032_0219947 3300049569 Bacteria 1236
131 Ga0501032_0220140 3300049569 Bacteria 1235
132 Ga0501033_0000102 3300049570 Bacteria 81583
133 Ga0501033_0000286 3300049570 Bacteria 48628
134 Ga0501033_0047102 3300049570 Bacteria 3205
135 Ga0501033_0063622 3300049570 Bacteria 2715
136 Ga0501033_0266497 3300049570 Bacteria 1211
137 Ga0501033_0301654 3300049570 Bacteria 1127
138 Ga0501033_0351399 3300049570 Bacteria 1032
139 Ga0501033_0455623 3300049570 Bacteria 888
140 Ga0501034_0000174 3300049571 Bacteria 119615
141 Ga0501034_0000744 3300049571 Bacteria 49218
142 Ga0501034_0002038 3300049571 Bacteria 25392
143 Ga0501034_0011734 3300049571 Bacteria 9066
144 Ga0501034_0024581 3300049571 Bacteria 6127
145 Ga0501034_0273797 3300049571 Bacteria 1629
146 Ga0501034_0307205 3300049571 Bacteria 1521
147 Ga0501036_0000040 3300049572 Bacteria 81588
148 Ga0501036_0000310 3300049572 Bacteria 33917
149 Ga0501036_0077346 3300049572 Bacteria 2815
150 Ga0501036_0400803 3300049572 Bacteria 1144
151 Ga0501037_0000098 3300049573 Bacteria 81588
152 Ga0501037_0000118 3300049573 Bacteria 73584
153 Ga0501037_0059578 3300049573 Bacteria 2784
154 Ga0501037_0103034 3300049573 Bacteria 2058
155 Ga0501038_0000002 3300049574 Bacteria 330446
156 Ga0501038_0001806 3300049574 Bacteria 19815
157 Ga0501038_0131385 3300049574 Bacteria 2055
158 Ga0501038_0224473 3300049574 Bacteria 1497
159 Ga0501039_0000002 3300049575 Bacteria 375152
160 Ga0501039_0000057 3300049575 Bacteria 89756
161 Ga0501039_0237060 3300049575 Bacteria 1434
162 Ga0501039_0349662 3300049575 Bacteria 1161
163 Ga0501040_0006401 3300049576 Bacteria 7647
164 Ga0501041_0091948 3300049577 Bacteria 1873
165 Ga0501042_0097940 3300049578 Bacteria 2108
166 Ga0501043_0000048 3300049579 Bacteria 109146
167 Ga0501043_0003633 3300049579 Bacteria 12670
168 Ga0501043_0066347 3300049579 Bacteria 2834
169 Ga0501043_0085890 3300049579 Bacteria 2472
170 Ga0501043_0215862 3300049579 Bacteria 1485
171 Ga0501046_0288947 3300049580 Bacteria 1199
172 Ga0501047_0001761 3300049581 Bacteria 20967
173 Ga0501047_0158028 3300049581 Bacteria 2139
174 Ga0501047_0313962 3300049581 Bacteria 1408
175 Ga0501047_0433769 3300049581 Bacteria 1144
176 Ga0501048_0030063 3300049582 Bacteria 3934
177 Ga0501067_0186229 3300049583 Bacteria 1156
178 Ga0501070_0011578 3300049586 Bacteria 7448
179 Ga0501070_0030610 3300049586 Bacteria 4510
180 Ga0501070_0279461 3300049586 Bacteria 1362
181 Ga0501073_0051400 3300049589 Bacteria 2887
182 Ga0501035_0000118 3300049822 Bacteria 95482
183 Ga0501035_0000163 3300049822 Bacteria 81898
184 Ga0501035_0031627 3300049822 Bacteria 4820
185 Ga0501035_0110201 3300049822 Bacteria 2412
186 Ga0501035_0110203 3300049822 Bacteria 2412
187 Ga0501044_0000002 3300049823 Bacteria 375152
188 Ga0501044_0014357 3300049823 Bacteria 8552
189 Ga0501044_0021869 3300049823 Bacteria 6819
190 Ga0501044_0062422 3300049823 Bacteria 3808
191 Ga0501044_0261327 3300049823 Bacteria 1669
192 Ga0501044_0514198 3300049823 Bacteria 1097
193 Ga0501045_0277628 3300049824 Bacteria 1247
194 nmdc:mga00v17_490_c2 3300050491 Bacteria 9764
195 nmdc:mga00v17_68879_c1 3300050491 Bacteria 2188
196 nmdc:mga00v17_87764_c1 3300050491 Bacteria 1949
197 nmdc:mga0yw44_135399_c1 3300050492 Bacteria 1598
198 nmdc:mga0yw44_25830_c1 3300050492 Bacteria 3346
199 nmdc:mga04h51_46779_c1 3300050495 Bacteria 1435
200 nmdc:mga07m45_123100_c1 3300050496 Bacteria 1499
201 nmdc:mga0n895_713752_c1 3300050512 Bacteria 998
202 nmdc:mga0sz30_12206_c2 3300050516 Bacteria 2489
203 Ga0495655_0027817 3300053083 Bacteria 1345
204 Ga0500620_000225 3300053155 Bacteria 11219
205 Ga0500627_0074840 3300053158 Bacteria 1504
206 Ga0500627_0132621 3300053158 Bacteria 1125
207 Ga0500611_025594 3300053727 Bacteria 1171
208 Ga0501082_0217930 3300060353 Bacteria 1661
209 2503202327 2503198000 Bacteria 6884444
210 2509114270 2508501123 Bacteria 6283661
211 2509140546 2508501127 Bacteria 7037543
212 2509370435 2509276018 Bacteria 6910194
213 2510317399 2510065059 Bacteria 6847884
214 2512930773 2512875016 Bacteria 6529530
215 2512958502 2512875024 Bacteria 7195110
216 2513609821 2513237090 Bacteria 7096802
217 2514035085 2513237164 Bacteria 7563725
218 2514421820 2513237305 Bacteria 7293571
219 2514589827 2513237351 Bacteria 6968952
220 2588516435 2588253730 Bacteria 6881675
221 2597814002 2597489875 Bacteria 7010078
222 2599940037 2599185301 Bacteria 6161860
223 2643772738 2643221550 Bacteria 4619371
224 2643775674 2643221551 Bacteria 3750538
225 2643794121 2643221555 Bacteria 3749717
226 2643837404 2643221564 Bacteria 4193379
227 2643988103 2643221595 Bacteria 6565519
228 2644132144 2643221623 Bacteria 5239945
229 2644155278 2643221627 Bacteria 6761570
230 2688599315 2687453392 Bacteria 6880454
231 2694632109 2693429783 Bacteria 7019804
232 2694634484 2693429784 Bacteria 7241525
233 2723576261 2721755686 Bacteria 7343952
234 2739307957 2738543024 Bacteria 5603683
235 2753359485 2751185800 Bacteria 5467370
236 2756675787 2756170246 Bacteria 7451806
237 2758641745 2758568016 Bacteria 5645291
238 2776271332 2775506902 Bacteria 6208009
239 2776280670 2775506904 Bacteria 5954060
240 2792745996 2791355123 Bacteria 8049106
241 2840770101 2840764183 Bacteria 6358399
242 2841740112 2841734538 Bacteria 6784580
243 2844006551 2844002411 Bacteria 7168230
244 2844014598 2844009547 Bacteria 6728125
245 2847693052 2847686936 Bacteria 6278406
246 2856330438 2856328259 Bacteria 6528202
247 2856340524 2856334872 Bacteria 7037011
248 2856348913 2856342000 Bacteria 7176905
249 2856353254 2856349417 Bacteria 6230045
250 2856368935 2856364286 Bacteria 6939991
251 2857349511 2857349434 Bacteria 7926032
252 2869166018 2869162929 Bacteria 6399702
253 2869171234 2869169390 Bacteria 6659796
254 2869237745 2869234852 Bacteria 6654993
255 2869248249 2869242130 Bacteria 6609239
256 2869253711 2869249662 Bacteria 6868783
257 2869258253 2869256925 Bacteria 6981691
258 2869270966 2869264136 Bacteria 6880765
259 2869271682 2869271264 Bacteria 6908218
260 2869278742 2869278585 Bacteria 7077053
261 2869291454 2869285874 Bacteria 6901219
262 2871433734 2871429161 Bacteria 6547891
263 2871442256 2871435913 Bacteria 6880295
264 2871451462 2871444079 Bacteria 6423508
265 2871455443 2871451962 Bacteria 7336357
266 2871467375 2871466892 Bacteria 6923287
267 2871476070 2871474448 Bacteria 6806570
268 2871488685 2871481445 Bacteria 6700002
269 2871495201 2871488783 Bacteria 6929816
270 2871500641 2871495908 Bacteria 6935695
271 2874103490 2874102143 Bacteria 6342645
272 2874117192 2874116593 Bacteria 6674494
273 2874125888 2874123672 Bacteria 7238285
274 2874137776 2874131515 Bacteria 6820270
275 2874145327 2874139085 Bacteria 7021506
276 2874153311 2874146452 Bacteria 7533118
277 2874160576 2874155637 Bacteria 6724144
278 2874164888 2874162495 Bacteria 6174670
279 2874176343 2874168670 Bacteria 8062617
280 2876365556 2876363079 Bacteria 6544991
281 2876378115 2876377896 Bacteria 6565995
282 2876391336 2876386047 Bacteria 6698674
283 2876403158 2876399893 Bacteria 6927900
284 2876412431 2876406927 Bacteria 6191900
285 2876419602 2876413966 Bacteria 6831344
286 2876421557 2876420981 Bacteria 6687741
287 2878737541 2878730984 Bacteria 6380721
288 2878743575 2878738818 Bacteria 7136951
289 2878751345 2878745973 Bacteria 6867388
290 2878758133 2878753008 Bacteria 6922523
291 2878764730 2878760144 Bacteria 6823465
292 2878771831 2878767105 Bacteria 6898628
293 2878778805 2878774303 Bacteria 6108671
294 2878781253 2878781027 Bacteria 6834456
295 2878789051 2878788777 Bacteria 6567085
296 2881152752 2881147464 Bacteria 7779814
297 2881156031 2881155292 Bacteria 6461656
298 2881168444 2881161766 Bacteria 7127907
299 2881848917 2881845957 Bacteria 6611900
300 2881854924 2881853255 Bacteria 6698367
301 2881863330 2881861095 Bacteria 7128710
302 2882633983 2882632389 Bacteria 8154593
303 2882914907 2882912400 Bacteria 6801539
304 2885310419 2885305155 Bacteria 7348390
305 2885317214 2885312484 Bacteria 6415165
306 2885321335 2885318864 Bacteria 6729568
307 2885332973 2885326080 Bacteria 7134805
308 2885342505 2885334103 Bacteria 7216818
309 2885343121 2885342637 Bacteria 7011821
310 2885353208 2885350715 Bacteria 6787678
311 2888347557 2888343758 Bacteria 6611049
312 2888356687 2888350351 Bacteria 7372807
313 2889023331 2889016732 Bacteria 6700763
314 2903455722 2903448605 Bacteria 7357801
315 2903496135 2903492973 Bacteria 13473544
316 2903501867 2903492973 Bacteria 13473544
317 2903514560 2903513507 Bacteria 6344008
318 2903522912 2903521522 Bacteria 6525694
319 2903533102 2903528002 Bacteria 6586099
320 2903545454 2903540706 Bacteria 7062119
321 2904661708 2904659560 Bacteria 6685615
322 2906313262 2906308376 Bacteria 6841989
323 2906325973 2906321335 Bacteria 6579571
324 2906335167 2906328253 Bacteria 6585166
325 2906369587 2906363423 Bacteria 6856682
326 2906376061 2906370794 Bacteria 6881062
327 2906384241 2906378014 Bacteria 6911440
328 2906400898 2906393657 Bacteria 6790866
329 2906403184 2906401398 Bacteria 6693206
330 2906412753 2906408224 Bacteria 6162342
331 2915651794 2915650412 Bacteria 4288180
332 2922153456 2922151315 Bacteria 6902399
333 2922164205 2922158528 Bacteria 6573167
334 2922174150 2922172374 Bacteria 6167644
335 2922182042 2922178524 Bacteria 6025201
336 2922192011 2922185730 Bacteria 7113964
337 2924717297 2924710171 Bacteria 6752351
338 2924723009 2924718760 Bacteria 6331356
339 2924729288 2924726620 Bacteria 6271473
340 2924735928 2924733363 Bacteria 7574837
341 2924747031 2924741084 Bacteria 6661321
342 2924749863 2924748358 Bacteria 6154725
343 2924754765 2924754689 Bacteria 6774424
344 2924768869 2924762789 Bacteria 6561353
345 2924781387 2924776078 Bacteria 7492003
346 2924785874 2924784321 Bacteria 7416538
347 2937820588 2937813078 Bacteria 7783518
348 2937827174 2937822353 Bacteria 7290551
349 2937837868 2937836603 Bacteria 6811263
350 2937853859 2937848649 Bacteria 6983481
351 2937864345 2937861824 Bacteria 6660327
352 2937879098 2937877337 Bacteria 7246526
353 2937895976 2937891427 Bacteria 6357007
354 2937975156 2937972304 Bacteria 7532020
355 2937985264 2937980651 Bacteria 6517427
356 2937999304 2937994558 Bacteria 7036190
357 2938018902 2938014810 Bacteria 6700592
358 2958034858 2958034702 Bacteria 6989922
359 2958043013 2958041894 Bacteria 13082850
360 2958046302 2958041894 Bacteria 13082850
361 2958067102 2958064165 Bacteria 7158582
362 2958077606 2958071322 Bacteria 6815895
363 2958086272 2958084443 Bacteria 7312792
364 2958100568 2958092219 Bacteria 6861151
365 2958104575 2958100919 Bacteria 6800575
366 2958109230 2958108152 Bacteria 6681128
367 2958122355 2958115193 Bacteria 6923548
368 2958129190 2958122699 Bacteria 7280457
369 2958135853 2958130278 Bacteria 6897202
370 2958139498 2958137437 Bacteria 6050276
371 2958169778 2958165035 Bacteria 6906348
372 2958177567 2958172287 Bacteria 6716688
373 2958185320 2958179912 Bacteria 6874908
374 2961083587 2961077736 Bacteria 7079850
375 2961116861 2961114664 Bacteria 6680456
376 2961144663 2961136820 Bacteria 6775228
377 2961168238 2961163497 Bacteria 6901077
378 2961174764 2961170736 Bacteria 7072258
379 2961187390 2961183825 Bacteria 6688536
380 2963648453 2963644680 Bacteria 6530403
381 2965023057 2965018300 Bacteria 6883036
382 2965029415 2965025482 Bacteria 6532201
383 2965038982 2965032056 Bacteria 6887443
384 2965045920 2965040258 Bacteria 6855979
385 2965051758 2965047637 Bacteria 6623551
386 2965068403 2965062239 Bacteria 7412989
387 2965091757 2965089291 Bacteria 6866420
388 2965102972 2965102966 Bacteria 6800987
389 2965116880 2965110997 Bacteria 6693150
390 2965124505 2965119406 Bacteria 6956431
391 2968000698 2967996073 Bacteria 6787468
392 2968009929 2968003550 Bacteria 6929263
393 2968017733 2968016561 Bacteria 7022047
394 2968084967 2968083720 Bacteria 7351627
395 2968091898 2968091066 Bacteria 6052692
396 2968099408 2968097103 Bacteria 6107094
397 2968112768 2968110612 Bacteria 6814636
398 2968122996 2968117919 Bacteria 6536078
399 2968129959 2968128360 Bacteria 6270294
400 2968145044 2968138860 Bacteria 6605449
401 2968176638 2968171901 Bacteria 6894245
402 2970472092 2970469710 Bacteria 6969209
403 2970495930 2970489779 Bacteria 6517260
404 2970507350 2970503327 Bacteria 7099517
405 2970516438 2970510686 Bacteria 7006402
406 2970531807 2970524798 Bacteria 6840927
407 2970539626 2970532167 Bacteria 6553173
408 2970547065 2970540015 Bacteria 6977556
409 2970548215 2970547951 Bacteria 6931819
410 2970559577 2970554993 Bacteria 6814252
411 2970593338 2970593180 Bacteria 7073582
412 2970620690 2970619444 Bacteria 6986144
413 2970633965 2970627176 Bacteria 6680862
414 2977828793 2977821940 Bacteria 6906439
415 2977848886 2977843712 Bacteria 6753583
416 2977853457 2977851361 Bacteria 6694324
417 2977861858 2977858184 Bacteria 6215359
418 2977867551 2977864932 Bacteria 7534097
419 2977877943 2977872689 Bacteria 7270173
420 2977903790 2977898635 Bacteria 6675551
421 2977911735 2977907340 Bacteria 6577984
422 2977928983 2977922695 Bacteria 6956781
423 2977941516 2977935797 Bacteria 6252826
424 2977947050 2977942078 Bacteria 7570577
425 2977957419 2977950692 Bacteria 6893264
426 2977958777 2977957713 Bacteria 6877875
427 2977977760 2977971508 Bacteria 7472917
428 2977989460 2977986579 Bacteria 6581278
429 2979711817 2979710463 Bacteria 6785254
430 2979772450 2979772303 Bacteria 6618277
431 2979780469 2979779861 Bacteria 6219781
432 2979797600 2979793036 Bacteria 6808957
433 2979812546 2979808191 Bacteria 7179355
434 2987645418 2987636660 Bacteria 8088555
435 2987649541 2987645492 Bacteria 6117018
436 2987658287 2987652177 Bacteria 6969023
437 2987664252 2987659509 Bacteria 6966464
438 2987670547 2987666974 Bacteria 6509233
439 2987674370 2987673487 Bacteria 6884027
440 2996311139 2996310559 Bacteria 6357320
441 2996341781 2996336353 Bacteria 5511628
442 2996351024 2996348954 Bacteria 7239054
443 2996392671 2996386984 Bacteria 6978667
444 3000138374 3000135777 Bacteria 6891109
445 3004169699 3004167301 Bacteria 8330599
446 3004193307 3004188549 Bacteria 6952365
447 3004199711 3004195979 Bacteria 6776956
448 3004206325 3004203850 Bacteria 7307914
449 3004213162 3004211236 Bacteria 7417683
450 3004221533 3004218560 Bacteria 7421728
451 3004235535 3004232784 Bacteria 6662140
452 3004275304 3004268573 Bacteria 7043476
453 3004277722 3004275668 Bacteria 7114440
454 3004340878 3004334049 Bacteria 8449246
455 637073820 637000159 Bacteria 7596297
456 649873820 649633066 Bacteria 6690028
457 8004304786 8004300914 Bacteria 6132239
458 8004314309 8004312739 Bacteria 7444653
459 8004363932 8004361976 Bacteria 6858373
460 8004379645 8004374579 Bacteria 6898112
461 8004393991 8004387939 Bacteria 7049250
462 8004396798 8004395343 Bacteria 6620908
463 8004638998 8004633249 Bacteria 6723080
464 8004646827 8004640170 Bacteria 6723001
465 8004702645 8004695233 Bacteria 6731676
466 8004713789 8004703790 Bacteria 8006957
467 8004719518 8004714634 Bacteria 6776161
468 8004732482 8004727605 Bacteria 6643904
469 8055621634 8055617313 Bacteria 7548464
470 Ga0055542_1001631
471 JGI24739J22299_10013791
472 JGI24735J21928_10028797
473 JGI25165J46597_1000033
474 Ga0055529_1001715
475 Ga0070660_100498901
476 Ga0068853_100077900
477 Ga0068853_100166771
478 Ga0068855_100074803
479 Ga0068856_100155122
480 Ga0081538_10010807
481 Ga0075365_10003274
482 Ga0075365_10010098
483 Ga0075365_10357956
484 Ga0075363_100093355
485 Ga0075363_100139282
486 Ga0075364_10002851
487 Ga0075364_10012314
488 Ga0070712_100004104
489 Ga0075367_10036213
490 Ga0075367_10214800
491 Ga0075369_10015493
492 Ga0075370_10015646
493 Ga0075434_100989695
494 Ga0105245_10658005
495 Ga0105247_10197906
496 Ga0105241_10163809
497 Ga0105248_10463231
498 Ga0105237_10033099
499 Ga0105237_10082968
500 Ga0105238_10011213
501 Ga0105238_10353055
502 Ga0105239_10061929
503 Ga0105239_10142984
504 Ga0105239_10193880
505 Ga0105239_10404342
506 Ga0157370_10193672
507 Ga0157374_10154636
508 Ga0157378_10837197
509 Ga0163163_10014595
510 Ga0213874_10007567
511 Ga0209148_1000072
512 Ga0209233_1000027
513 Ga0209455_1000133
514 Ga0207710_10070335
515 Ga0207647_10009185
516 Ga0207695_10325935
517 Ga0207671_10012933
518 Ga0207693_10001524
519 Ga0207652_10114485
520 Ga0207694_10002336
521 Ga0207691_10274818
522 Ga0207667_10339225
523 Ga0207639_10003324
524 Ga0207639_10494782
525 Ga0207678_10426719
526 Ga0207702_10158747
527 Ga0207698_10107010
528 Ga0207698_10216589
529 Ga0268266_10489244
530 Ga0265318_10066167
531 Ga0307515_10294007
532 Ga0265332_10134742
533 Ga0265340_10164102
534 Ga0265316_10152357
535 Ga0265342_10019294
536 Ga0307412_10616221
537 Ga0307414_10421087
538 Ga0373931_0084671
539 Ga0373925_0273192
540 Ga0395899_0000398
541 Ga0395899_0060608
542 Ga0395900_0000121
543 Ga0395900_0020571
544 Ga0395898_0000247
545 Ga0395898_0557066
546 Ga0395905_0000112
547 Ga0395905_0014885
548 Ga0395905_0143643
549 Ga0395905_0481709
550 Ga0395901_0000078
551 Ga0395901_0006071
552 Ga0395901_0058856
553 Ga0395901_0171581
554 Ga0436365_0785116
555 Ga0436363_0402394
556 Ga0436363_0799139
557 Ga0439465_0118429
558 Ga0495639_0102373
559 Ga0495632_0106091
560 Ga0495668_0038180
561 Ga0495668_0173678
562 Ga0495624_0185626
563 Ga0495660_0071605
564 Ga0495686_0226965
565 Ga0496100_0045350
566 Ga0496104_0025010
567 Ga0496105_0003600
568 Ga0496108_0008682
569 Ga0496108_0623194
570 Ga0496109_0001287
571 Ga0496109_0134674
572 Ga0496109_0303016
573 Ga0496110_0107960
574 Ga0496110_0175038
575 Ga0496111_0108154
576 Ga0496112_0003602
577 Ga0496112_0316446
578 Ga0496113_0003739
579 Ga0496113_0064999
580 Ga0496113_0209840
581 Ga0496114_0092772
582 Ga0496115_0008667
583 Ga0496119_0005249
584 Ga0496119_0055643
585 Ga0496119_0157016
586 Ga0496120_0008156
587 Ga0496120_0261189
588 Ga0496122_0045274
589 Ga0496122_0080223
590 Ga0496123_0172042
591 Ga0496126_0017843
592 Ga0501031_0000095
593 Ga0501031_0005703
594 Ga0501031_0040336
595 Ga0501031_0258959
596 Ga0501032_0000064
597 Ga0501032_0000084
598 Ga0501032_0066309
599 Ga0501032_0219947
600 Ga0501032_0220140
601 Ga0501033_0000102
602 Ga0501033_0000286
603 Ga0501033_0047102
604 Ga0501033_0063622
605 Ga0501033_0266497
606 Ga0501033_0301654
607 Ga0501033_0351399
608 Ga0501033_0455623
609 Ga0501034_0000174
610 Ga0501034_0000744
611 Ga0501034_0002038
612 Ga0501034_0011734
613 Ga0501034_0024581
614 Ga0501034_0273797
615 Ga0501034_0307205
616 Ga0501036_0000040
617 Ga0501036_0000310
618 Ga0501036_0077346
619 Ga0501036_0400803
620 Ga0501037_0000098
621 Ga0501037_0000118
622 Ga0501037_0059578
623 Ga0501037_0103034
624 Ga0501038_0000002
625 Ga0501038_0001806
626 Ga0501038_0131385
627 Ga0501038_0224473
628 Ga0501039_0000002
629 Ga0501039_0000057
630 Ga0501039_0237060
631 Ga0501039_0349662
632 Ga0501040_0006401
633 Ga0501041_0091948
634 Ga0501042_0097940
635 Ga0501043_0000048
636 Ga0501043_0003633
637 Ga0501043_0066347
638 Ga0501043_0085890
639 Ga0501043_0215862
640 Ga0501046_0288947
641 Ga0501047_0001761
642 Ga0501047_0158028
643 Ga0501047_0313962
644 Ga0501047_0433769
645 Ga0501048_0030063
646 Ga0501067_0186229
647 Ga0501070_0011578
648 Ga0501070_0030610
649 Ga0501070_0279461
650 Ga0501073_0051400
651 Ga0501035_0000118
652 Ga0501035_0000163
653 Ga0501035_0031627
654 Ga0501035_0110201
655 Ga0501035_0110203
656 Ga0501044_0000002
657 Ga0501044_0014357
658 Ga0501044_0021869
659 Ga0501044_0062422
660 Ga0501044_0261327
661 Ga0501044_0514198
662 Ga0501045_0277628
663 nmdc:mga00v17_490_c2
664 nmdc:mga00v17_68879_c1
665 nmdc:mga00v17_87764_c1
666 nmdc:mga0yw44_135399_c1
667 nmdc:mga0yw44_25830_c1
668 nmdc:mga04h51_46779_c1
669 nmdc:mga07m45_123100_c1
670 nmdc:mga0n895_713752_c1
671 nmdc:mga0sz30_12206_c2
672 Ga0495655_0027817
673 Ga0500620_000225
674 Ga0500627_0074840
675 Ga0500627_0132621
676 Ga0500611_025594
677 Ga0501082_0217930
678 2503202327
679 2509114270
680 2509140546
681 2509370435
682 2510317399
683 2512930773
684 2512958502
685 2513609821
686 2514035085
687 2514421820
688 2514589827
689 2588516435
690 2597814002
691 2599940037
692 2643772738
693 2643775674
694 2643794121
695 2643837404
696 2643988103
697 2644132144
698 2644155278
699 2688599315
700 2694632109
701 2694634484
702 2723576261
703 2739307957
704 2753359485
705 2756675787
706 2758641745
707 2776271332
708 2776280670
709 2792745996
710 2840770101
711 2841740112
712 2844006551
713 2844014598
714 2847693052
715 2856330438
716 2856340524
717 2856348913
718 2856353254
719 2856368935
720 2857349511
721 2869166018
722 2869171234
723 2869237745
724 2869248249
725 2869253711
726 2869258253
727 2869270966
728 2869271682
729 2869278742
730 2869291454
731 2871433734
732 2871442256
733 2871451462
734 2871455443
735 2871467375
736 2871476070
737 2871488685
738 2871495201
739 2871500641
740 2874103490
741 2874117192
742 2874125888
743 2874137776
744 2874145327
745 2874153311
746 2874160576
747 2874164888
748 2874176343
749 2876365556
750 2876378115
751 2876391336
752 2876403158
753 2876412431
754 2876419602
755 2876421557
756 2878737541
757 2878743575
758 2878751345
759 2878758133
760 2878764730
761 2878771831
762 2878778805
763 2878781253
764 2878789051
765 2881152752
766 2881156031
767 2881168444
768 2881848917
769 2881854924
770 2881863330
771 2882633983
772 2882914907
773 2885310419
774 2885317214
775 2885321335
776 2885332973
777 2885342505
778 2885343121
779 2885353208
780 2888347557
781 2888356687
782 2889023331
783 2903455722
784 2903496135
785 2903501867
786 2903514560
787 2903522912
788 2903533102
789 2903545454
790 2904661708
791 2906313262
792 2906325973
793 2906335167
794 2906369587
795 2906376061
796 2906384241
797 2906400898
798 2906403184
799 2906412753
800 2915651794
801 2922153456
802 2922164205
803 2922174150
804 2922182042
805 2922192011
806 2924717297
807 2924723009
808 2924729288
809 2924735928
810 2924747031
811 2924749863
812 2924754765
813 2924768869
814 2924781387
815 2924785874
816 2937820588
817 2937827174
818 2937837868
819 2937853859
820 2937864345
821 2937879098
822 2937895976
823 2937975156
824 2937985264
825 2937999304
826 2938018902
827 2958034858
828 2958043013
829 2958046302
830 2958067102
831 2958077606
832 2958086272
833 2958100568
834 2958104575
835 2958109230
836 2958122355
837 2958129190
838 2958135853
839 2958139498
840 2958169778
841 2958177567
842 2958185320
843 2961083587
844 2961116861
845 2961144663
846 2961168238
847 2961174764
848 2961187390
849 2963648453
850 2965023057
851 2965029415
852 2965038982
853 2965045920
854 2965051758
855 2965068403
856 2965091757
857 2965102972
858 2965116880
859 2965124505
860 2968000698
861 2968009929
862 2968017733
863 2968084967
864 2968091898
865 2968099408
866 2968112768
867 2968122996
868 2968129959
869 2968145044
870 2968176638
871 2970472092
872 2970495930
873 2970507350
874 2970516438
875 2970531807
876 2970539626
877 2970547065
878 2970548215
879 2970559577
880 2970593338
881 2970620690
882 2970633965
883 2977828793
884 2977848886
885 2977853457
886 2977861858
887 2977867551
888 2977877943
889 2977903790
890 2977911735
891 2977928983
892 2977941516
893 2977947050
894 2977957419
895 2977958777
896 2977977760
897 2977989460
898 2979711817
899 2979772450
900 2979780469
901 2979797600
902 2979812546
903 2987645418
904 2987649541
905 2987658287
906 2987664252
907 2987670547
908 2987674370
909 2996311139
910 2996341781
911 2996351024
912 2996392671
913 3000138374
914 3004169699
915 3004193307
916 3004199711
917 3004206325
918 3004213162
919 3004221533
920 3004235535
921 3004275304
922 3004277722
923 3004340878
924 637073820
925 649873820
926 8004304786
927 8004314309
928 8004363932
929 8004379645
930 8004393991
931 8004396798
932 8004638998
933 8004646827
934 8004702645
935 8004713789
936 8004719518
937 8004732482
938 8055621634

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00218

IGPS

Indole-3-glycerol phosphate synthase

5

260

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6y88-assembly8.cif.gz_H igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp 0.9813 2 259
3t78-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with 5-fluoroanthranilate 0.9619 4 261
3t55-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with phenoxymethyl benzoic acid (pmba) 0.9617 4 263
3t40-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) complex with n-2-carboxyphenyl glycine (cpg) 0.9574 4 261
3qja-assembly1.cif.gz_A crystal structure of the mycobacterium tuberculosis indole-3-glycerol phosphate synthase (trpc) in apo form 0.956 2 261
ID Description Score Start End Superfamily
af_B4FS35_106_381_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9609 4 265 3.20.20.70
3t40A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9575 4 261 3.20.20.70
2c3zA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9521 43 249 3.20.20.70
af_P00909_2_259_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9428 1 265 3.20.20.70
af_P00909_2_259_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9393 1 265 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A529ZJD6-F1-model_v4 indole-3-glycerol-phosphate synthase (EC 4.1.1.48) 0.9984 77 264 GO:0000162
GO:0004425
GO:0004640
AF-A0A436E409-F1-model_v4 indole-3-glycerol-phosphate synthase (EC 4.1.1.48) 0.998 68 262 GO:0000162
GO:0004425
GO:0004640
AF-A0A528BEV0-F1-model_v4 indole-3-glycerol-phosphate synthase (EC 4.1.1.48) 0.9972 45 261 GO:0000162
GO:0004425
GO:0004640
GO:0006568
AF-A0A3M5WGY6-F1-model_v4 indole-3-glycerol-phosphate synthase (EC 4.1.1.48) 0.9963 28 265 GO:0000162
GO:0004425
GO:0004640
GO:0006568
AF-A0A529WF14-F1-model_v4 indole-3-glycerol-phosphate synthase (EC 4.1.1.48) 0.9961 1 230 GO:0000162
GO:0004425
GO:0004640
GO:0006568

Map