F450126

General Info

Members Datasets Scaffolds Average Seq Length
468 206 936 123

Family's Representative Sequence

Representative Sequence 3300049591|Ga0501075_0831142|Ga0501075_0831142_107_565
Length 152
Sequence MDVTGTPAAGWCRARPLGTDVDEERGGVMPEQGSKVVVNLATGLEDAERVTVAFLVGGAAVQQGRPVAMFLTKEAVRLALPGYADAVACDGCPPLARLFEQYVDAGGELLVCPICFSARKLDESSLVPGARLAGATPLWEWIGDGPATVFSY

Samples

Sample ID Description Type Environment
1 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
160 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
161 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 1.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.33
Rhizosphere 90.38
Stem 0
Stem Tuber 0
Unclassified 16.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501075_0831142 3300049591 Bacteria 703
2 JGI25406J46586_10021132 3300003203 Bacteria 2618
3 Ga0058863_11701061 3300004799 Bacteria 618
4 Ga0058861_11768738 3300004800 Unclassified 2235
5 Ga0058862_10062319 3300004803 Unclassified 1711
6 Ga0058862_11754725 3300004803 Unclassified 571
7 Ga0070658_10019702 3300005327 Bacteria 5402
8 Ga0070683_100021347 3300005329 Bacteria 5779
9 Ga0070683_101232416 3300005329 Unclassified 719
10 Ga0070680_100024745 3300005336 Bacteria 4799
11 Ga0070680_100052632 3300005336 Bacteria 3322
12 Ga0070682_101261786 3300005337 Unclassified 626
13 Ga0070660_100004973 3300005339 Bacteria 9192
14 Ga0070660_100021598 3300005339 Bacteria 4749
15 Ga0070661_100830678 3300005344 Bacteria 759
16 Ga0070692_10116889 3300005345 Bacteria 1482
17 Ga0070659_100064564 3300005366 Bacteria 2898
18 Ga0070659_100280053 3300005366 Unclassified 1387
19 Ga0070659_100602968 3300005366 Bacteria 944
20 Ga0070709_10767625 3300005434 Unclassified 754
21 Ga0070714_100406849 3300005435 Bacteria 1287
22 Ga0070714_100460488 3300005435 Bacteria 1209
23 Ga0070714_102115357 3300005435 Bacteria 548
24 Ga0070713_101304019 3300005436 Bacteria 704
25 Ga0070713_101835915 3300005436 Bacteria 588
26 Ga0070710_11345506 3300005437 Unclassified 532
27 Ga0070700_100150156 3300005441 Bacteria 1593
28 Ga0070694_100482688 3300005444 Bacteria 984
29 Ga0070708_100861591 3300005445 Bacteria 851
30 Ga0070663_100077726 3300005455 Bacteria 2431
31 Ga0070678_100623171 3300005456 Bacteria 965
32 Ga0070662_100791697 3300005457 Bacteria 806
33 Ga0070681_10093222 3300005458 Bacteria 2960
34 Ga0070706_100006146 3300005467 Bacteria 11361
35 Ga0070707_100145903 3300005468 Archaea 2303
36 Ga0070707_100551296 3300005468 Bacteria 1115
37 Ga0070698_100022572 3300005471 Bacteria 6582
38 Ga0070698_100083028 3300005471 Bacteria 3195
39 Ga0070698_100150007 3300005471 Bacteria 2279
40 Ga0070698_100258032 3300005471 Bacteria 1675
41 Ga0070698_100358042 3300005471 Bacteria 1391
42 Ga0070699_100036696 3300005518 Bacteria 4240
43 Ga0070699_100199273 3300005518 Bacteria 1780
44 Ga0070699_100339387 3300005518 Bacteria 1352
45 Ga0070699_101475922 3300005518 Bacteria 624
46 Ga0070679_100028443 3300005530 Bacteria 5511
47 Ga0070679_100660027 3300005530 Bacteria 988
48 Ga0070684_100011478 3300005535 Bacteria 7056
49 Ga0070684_100073410 3300005535 Bacteria 3014
50 Ga0070697_100157315 3300005536 Unclassified 1919
51 Ga0070697_100467096 3300005536 Bacteria 1100
52 Ga0070697_100559439 3300005536 Bacteria 1003
53 Ga0068853_100362149 3300005539 Unclassified 1351
54 Ga0070686_101338154 3300005544 Bacteria 599
55 Ga0070695_100143571 3300005545 Bacteria 1658
56 Ga0070696_100026029 3300005546 Unclassified 3980
57 Ga0070696_101849042 3300005546 Bacteria 522
58 Ga0070693_100649486 3300005547 Bacteria 767
59 Ga0070704_100786696 3300005549 Unclassified 849
60 Ga0068855_100045039 3300005563 Bacteria 5219
61 Ga0068855_100096609 3300005563 Bacteria 3403
62 Ga0068855_101882382 3300005563 Bacteria 606
63 Ga0068855_102337997 3300005563 Unclassified 534
64 Ga0070664_100532643 3300005564 Bacteria 1085
65 Ga0068857_100314968 3300005577 Unclassified 1444
66 Ga0068854_100134847 3300005578 Bacteria 1889
67 Ga0068856_100075066 3300005614 Bacteria 3349
68 Ga0068856_102293455 3300005614 Bacteria 548
69 Ga0068852_100178471 3300005616 Bacteria 1995
70 Ga0068852_101135378 3300005616 Bacteria 802
71 Ga0068852_102627856 3300005616 Bacteria 523
72 Ga0068859_101103925 3300005617 Bacteria 872
73 Ga0068861_100135407 3300005719 Bacteria 2004
74 Ga0068870_10939527 3300005840 Bacteria 613
75 Ga0081455_10027150 3300005937 Bacteria 5249
76 Ga0081455_10690819 3300005937 Bacteria 651
77 Ga0081538_10005583 3300005981 Bacteria 11291
78 Ga0081539_10000433 3300005985 Bacteria 89118
79 Ga0081539_10008698 3300005985 Bacteria 8731
80 Ga0081539_10027541 3300005985 Bacteria 3596
81 Ga0070717_10032683 3300006028 Bacteria 4194
82 Ga0070717_10215338 3300006028 Bacteria 1687
83 Ga0070717_10294690 3300006028 Bacteria 1441
84 Ga0070717_10746226 3300006028 Bacteria 890
85 Ga0070717_11636064 3300006028 Bacteria 583
86 Ga0070712_100845650 3300006175 Bacteria 787
87 Ga0075431_100327113 3300006847 Bacteria 1545
88 Ga0075433_10620861 3300006852 Bacteria 948
89 Ga0075433_10948165 3300006852 Unclassified 750
90 Ga0075434_100181796 3300006871 Bacteria 2123
91 Ga0068865_100337438 3300006881 Bacteria 1217
92 Ga0075436_100148457 3300006914 Bacteria 1649
93 Ga0075436_101401158 3300006914 Unclassified 530
94 Ga0097620_101103938 3300006931 Bacteria 872
95 Ga0075435_100952322 3300007076 Bacteria 749
96 Ga0075435_101977502 3300007076 Unclassified 512
97 Ga0105240_10003780 3300009093 Bacteria 23382
98 Ga0105240_10151868 3300009093 Bacteria 2758
99 Ga0111539_10056356 3300009094 Bacteria 4671
100 Ga0105245_10309960 3300009098 Bacteria 1552
101 Ga0105245_12997412 3300009098 Unclassified 523
102 Ga0114129_10196910 3300009147 Bacteria 2732
103 Ga0114129_11681887 3300009147 Bacteria 775
104 Ga0114129_12548551 3300009147 Bacteria 611
105 Ga0114129_12676812 3300009147 Bacteria 594
106 Ga0105237_12092060 3300009545 Unclassified 575
107 Ga0105238_10126152 3300009551 Unclassified 2538
108 Ga0105249_11263476 3300009553 Bacteria 810
109 Ga0105239_10080382 3300010375 Bacteria 3587
110 Ga0105239_10300244 3300010375 Unclassified 1808
111 Ga0157371_10363391 3300013102 Bacteria 1055
112 Ga0157370_10116952 3300013104 Bacteria 2491
113 Ga0157370_10151833 3300013104 Bacteria 2155
114 Ga0157369_10146083 3300013105 Bacteria 2501
115 Ga0157369_10520622 3300013105 Bacteria 1230
116 Ga0157369_11131120 3300013105 Unclassified 800
117 Ga0157374_10799453 3300013296 Bacteria 959
118 Ga0157372_10060240 3300013307 Unclassified 4248
119 Ga0157372_10668628 3300013307 Bacteria 1209
120 Ga0182008_10084430 3300014497 Bacteria 1564
121 Ga0206356_10439586 3300020070 Unclassified 1973
122 Ga0206353_10564235 3300020082 Bacteria 3631
123 Ga0213876_10620586 3300021384 Bacteria 575
124 Ga0213875_10038904 3300021388 Unclassified 2241
125 Ga0224712_10501904 3300022467 Bacteria 586
126 Ga0207699_10272339 3300025906 Bacteria 1174
127 Ga0207699_10744569 3300025906 Bacteria 719
128 Ga0207684_10017782 3300025910 Bacteria 6098
129 Ga0207684_10581904 3300025910 Bacteria 957
130 Ga0207654_10520610 3300025911 Bacteria 842
131 Ga0207707_10013602 3300025912 Bacteria 7096
132 Ga0207707_10061387 3300025912 Bacteria 3270
133 Ga0207695_10015780 3300025913 Bacteria 8874
134 Ga0207695_10204570 3300025913 Bacteria 1887
135 Ga0207663_10198208 3300025916 Bacteria 1446
136 Ga0207660_10040183 3300025917 Unclassified 3274
137 Ga0207660_10238718 3300025917 Unclassified 1431
138 Ga0207657_10001447 3300025919 Bacteria 25415
139 Ga0207657_10003626 3300025919 Bacteria 16444
140 Ga0207652_10138426 3300025921 Bacteria 2175
141 Ga0207646_10125682 3300025922 Archaea 2306
142 Ga0207646_10484957 3300025922 Bacteria 1114
143 Ga0207646_11836079 3300025922 Unclassified 518
144 Ga0207687_10861113 3300025927 Bacteria 774
145 Ga0207700_10018268 3300025928 Bacteria 4707
146 Ga0207700_11302266 3300025928 Unclassified 647
147 Ga0207664_10059795 3300025929 Bacteria 3036
148 Ga0207664_10080175 3300025929 Bacteria 2652
149 Ga0207664_10410089 3300025929 Bacteria 1206
150 Ga0207690_10339970 3300025932 Unclassified 1184
151 Ga0207690_11401387 3300025932 Bacteria 584
152 Ga0207706_10035660 3300025933 Bacteria 4421
153 Ga0207709_10781001 3300025935 Bacteria 770
154 Ga0207704_10657957 3300025938 Bacteria 863
155 Ga0207661_10315915 3300025944 Bacteria 1403
156 Ga0207661_11618908 3300025944 Bacteria 592
157 Ga0207679_10085303 3300025945 Bacteria 2426
158 Ga0207679_10230971 3300025945 Bacteria 1562
159 Ga0207667_10046418 3300025949 Bacteria 4600
160 Ga0207667_11214226 3300025949 Unclassified 733
161 Ga0207640_10042488 3300025981 Bacteria 2899
162 Ga0207677_10507332 3300026023 Bacteria 1044
163 Ga0207703_10673749 3300026035 Bacteria 982
164 Ga0207639_10819953 3300026041 Bacteria 867
165 Ga0207678_10083180 3300026067 Bacteria 2738
166 Ga0207678_10479937 3300026067 Bacteria 1083
167 Ga0207708_10004529 3300026075 Bacteria 10227
168 Ga0207708_10243374 3300026075 Bacteria 1447
169 Ga0207702_11751661 3300026078 Bacteria 614
170 Ga0207683_10721294 3300026121 Bacteria 924
171 Ga0207698_11427346 3300026142 Bacteria 707
172 Ga0207698_11538756 3300026142 Bacteria 680
173 Ga0207428_10968907 3300027907 Bacteria 599
174 Ga0307408_101776117 3300031548 Unclassified 589
175 Ga0307405_11379187 3300031731 Bacteria 616
176 Ga0307410_10493741 3300031852 Bacteria 1006
177 Ga0307406_11335202 3300031901 Unclassified 627
178 Ga0307407_10787096 3300031903 Bacteria 723
179 Ga0307407_11657689 3300031903 Unclassified 508
180 Ga0307409_100061640 3300031995 Bacteria 2932
181 Ga0307409_101518167 3300031995 Bacteria 697
182 Ga0307409_101587990 3300031995 Unclassified 682
183 Ga0307416_100948273 3300032002 Bacteria 962
184 Ga0307411_10758927 3300032005 Unclassified 850
185 Ga0307415_101219603 3300032126 Unclassified 709
186 Ga0373943_0107861 3300035170 Bacteria 1465
187 Ga0395899_0019501 3300037312 Bacteria 5150
188 Ga0395899_0045209 3300037312 Unclassified 3281
189 Ga0395899_0052565 3300037312 Unclassified 3019
190 Ga0395899_0096653 3300037312 Bacteria 2136
191 Ga0395899_0100484 3300037312 Bacteria 2089
192 Ga0395899_0136664 3300037312 Bacteria 1747
193 Ga0395899_0138722 3300037312 Unclassified 1731
194 Ga0395899_0462206 3300037312 Unclassified 829
195 Ga0395900_0009466 3300037418 Bacteria 9986
196 Ga0395900_0027753 3300037418 Bacteria 5800
197 Ga0395900_0095667 3300037418 Bacteria 3052
198 Ga0395900_0102655 3300037418 Bacteria 2937
199 Ga0395900_0135231 3300037418 Bacteria 2525
200 Ga0395900_0137078 3300037418 Unclassified 2507
201 Ga0395900_0150589 3300037418 Unclassified 2377
202 Ga0395900_0227646 3300037418 Bacteria 1877
203 Ga0395900_0304854 3300037418 Unclassified 1577
204 Ga0395900_0604223 3300037418 Bacteria 1037
205 Ga0395900_1126463 3300037418 Unclassified 701
206 Ga0395900_1459996 3300037418 Unclassified 596
207 Ga0395898_0010163 3300037466 Bacteria 9849
208 Ga0395898_0046884 3300037466 Unclassified 4244
209 Ga0395898_0060853 3300037466 Bacteria 3668
210 Ga0395898_0081463 3300037466 Unclassified 3120
211 Ga0395898_0094041 3300037466 Bacteria 2881
212 Ga0395898_0181188 3300037466 Unclassified 2013
213 Ga0395898_0199016 3300037466 Bacteria 1913
214 Ga0395898_0256889 3300037466 Unclassified 1666
215 Ga0395898_0261194 3300037466 Bacteria 1652
216 Ga0395898_0271781 3300037466 Unclassified 1616
217 Ga0395898_0299388 3300037466 Bacteria 1534
218 Ga0395898_0417128 3300037466 Bacteria 1279
219 Ga0395898_0808746 3300037466 Bacteria 877
220 Ga0395898_1505793 3300037466 Unclassified 599
221 Ga0395905_0007459 3300037471 Bacteria 10875
222 Ga0395905_0019552 3300037471 Bacteria 6419
223 Ga0395905_0026701 3300037471 Bacteria 5444
224 Ga0395905_0055802 3300037471 Unclassified 3697
225 Ga0395905_0061774 3300037471 Unclassified 3504
226 Ga0395905_0070133 3300037471 Bacteria 3284
227 Ga0395905_0096994 3300037471 Bacteria 2768
228 Ga0395905_0151884 3300037471 Unclassified 2178
229 Ga0395905_0180713 3300037471 Unclassified 1981
230 Ga0395905_0184362 3300037471 Bacteria 1959
231 Ga0395905_0186467 3300037471 Bacteria 1947
232 Ga0395905_0367011 3300037471 Bacteria 1333
233 Ga0395905_0413044 3300037471 Viruses 1245
234 Ga0395905_0498667 3300037471 Bacteria 1118
235 Ga0395905_1281665 3300037471 Bacteria 636
236 Ga0395905_1345627 3300037471 Bacteria 618
237 Ga0395905_1749223 3300037471 Bacteria 527
238 Ga0436364_0328278 3300037853 Bacteria 7402
239 Ga0395901_0008522 3300038443 Bacteria 10357
240 Ga0395901_0015382 3300038443 Bacteria 7789
241 Ga0395901_0017175 3300038443 Bacteria 7381
242 Ga0395901_0021063 3300038443 Bacteria 6678
243 Ga0395901_0023632 3300038443 Bacteria 6301
244 Ga0395901_0032800 3300038443 Bacteria 5358
245 Ga0395901_0051306 3300038443 Bacteria 4289
246 Ga0395901_0079207 3300038443 Unclassified 3430
247 Ga0395901_0117949 3300038443 Bacteria 2789
248 Ga0395901_0167326 3300038443 Bacteria 2307
249 Ga0395901_0178559 3300038443 Unclassified 2227
250 Ga0395901_0205978 3300038443 Bacteria 2061
251 Ga0395901_0375909 3300038443 Unclassified 1463
252 Ga0395901_0561987 3300038443 Unclassified 1155
253 Ga0395901_0697771 3300038443 Bacteria 1013
254 Ga0395901_0790590 3300038443 Bacteria 939
255 Ga0395901_0875123 3300038443 Bacteria 882
256 Ga0395901_0878821 3300038443 Unclassified 880
257 Ga0439460_0102048 3300042461 Bacteria 923
258 Ga0466963_0401994 3300044694 Bacteria 966
259 Ga0466968_0023048 3300044735 Bacteria 2535
260 Ga0466968_0072006 3300044735 Bacteria 1506
261 Ga0466960_0046536 3300044901 Bacteria 2078
262 Ga0466967_0524940 3300045976 Bacteria 1164
263 Ga0466967_1185870 3300045976 Bacteria 761
264 Ga0495651_0056753 3300046462 Bacteria 3007
265 Ga0495653_0055591 3300046463 Bacteria 3020
266 Ga0495584_0260406 3300046491 Bacteria 882
267 Ga0495618_0095667 3300046514 Bacteria 1899
268 Ga0495630_1376577 3300046517 Bacteria 531
269 Ga0495656_0139975 3300046615 Unclassified 1160
270 Ga0495635_0027717 3300046663 Bacteria 3940
271 Ga0495661_0304355 3300046665 Bacteria 797
272 Ga0495657_0527665 3300046675 Bacteria 687
273 Ga0495624_0418879 3300046690 Bacteria 803
274 Ga0495589_0145108 3300046794 Bacteria 1135
275 Ga0495674_0118794 3300047319 Bacteria 2235
276 Ga0495676_1068095 3300047321 Bacteria 514
277 Ga0495680_0002195 3300047322 Bacteria 20197
278 Ga0495684_0408401 3300047471 Bacteria 952
279 Ga0496100_1296866 3300048903 Bacteria 575
280 Ga0496101_0016236 3300048904 Bacteria 5025
281 Ga0496102_0312789 3300048905 Bacteria 1480
282 Ga0496102_0466667 3300048905 Bacteria 1183
283 Ga0496102_0551671 3300048905 Bacteria 1075
284 Ga0496103_0713613 3300048906 Bacteria 635
285 Ga0496105_0016335 3300048908 Bacteria 5924
286 Ga0496106_0279265 3300048909 Bacteria 1338
287 Ga0496106_0594244 3300048909 Bacteria 887
288 Ga0496106_1193654 3300048909 Bacteria 594
289 Ga0496107_0322363 3300048910 Bacteria 1150
290 Ga0496107_1029969 3300048910 Bacteria 597
291 Ga0496108_0014563 3300048911 Bacteria 6419
292 Ga0496108_0343075 3300048911 Bacteria 1303
293 Ga0496108_1702320 3300048911 Bacteria 519
294 Ga0496109_0016075 3300048912 Bacteria 6538
295 Ga0496109_0072267 3300048912 Bacteria 3169
296 Ga0496109_0109963 3300048912 Bacteria 2562
297 Ga0496109_0743421 3300048912 Bacteria 919
298 Ga0496109_1254448 3300048912 Unclassified 677
299 Ga0496109_1609769 3300048912 Unclassified 584
300 Ga0496110_0043751 3300048913 Bacteria 3910
301 Ga0496110_0096751 3300048913 Bacteria 2645
302 Ga0496110_0189277 3300048913 Unclassified 1869
303 Ga0496110_0274156 3300048913 Bacteria 1536
304 Ga0496110_0320466 3300048913 Bacteria 1412
305 Ga0496111_0022833 3300048914 Unclassified 4384
306 Ga0496111_0072092 3300048914 Bacteria 2514
307 Ga0496112_0023741 3300048915 Bacteria 5866
308 Ga0496112_0040623 3300048915 Bacteria 4549
309 Ga0496112_0063176 3300048915 Bacteria 3652
310 Ga0496112_0153942 3300048915 Bacteria 2266
311 Ga0496112_0332272 3300048915 Bacteria 1464
312 Ga0496112_0361375 3300048915 Bacteria 1394
313 Ga0496113_0074820 3300048916 Bacteria 2583
314 Ga0496113_0332936 3300048916 Bacteria 1217
315 Ga0496114_0001824 3300048917 Bacteria 16152
316 Ga0496114_0170940 3300048917 Bacteria 1894
317 Ga0496115_0418751 3300048918 Bacteria 1085
318 Ga0496117_0466999 3300048920 Bacteria 620
319 Ga0496119_0000974 3300048922 Bacteria 36779
320 Ga0496120_0002187 3300048923 Bacteria 20698
321 Ga0501031_0052280 3300049568 Bacteria 2661
322 Ga0501031_0074185 3300049568 Bacteria 2215
323 Ga0501031_0134155 3300049568 Bacteria 1617
324 Ga0501031_0321247 3300049568 Bacteria 1003
325 Ga0501032_0020276 3300049569 Bacteria 4633
326 Ga0501032_0327598 3300049569 Bacteria 988
327 Ga0501033_0007361 3300049570 Bacteria 8571
328 Ga0501033_0785659 3300049570 Bacteria 644
329 Ga0501036_0015617 3300049572 Bacteria 6343
330 Ga0501036_0063230 3300049572 Bacteria 3134
331 Ga0501036_0202458 3300049572 Bacteria 1669
332 Ga0501037_0040993 3300049573 Bacteria 3406
333 Ga0501037_0084626 3300049573 Bacteria 2297
334 Ga0501037_0405134 3300049573 Bacteria 935
335 Ga0501038_0004372 3300049574 Bacteria 13146
336 Ga0501038_0097826 3300049574 Bacteria 2448
337 Ga0501038_0187991 3300049574 Unclassified 1663
338 Ga0501038_0516107 3300049574 Bacteria 912
339 Ga0501039_0021483 3300049575 Bacteria 4950
340 Ga0501039_0024544 3300049575 Bacteria 4631
341 Ga0501039_0062713 3300049575 Bacteria 2880
342 Ga0501039_0886039 3300049575 Bacteria 695
343 Ga0501039_1398140 3300049575 Bacteria 539
344 Ga0501040_0005564 3300049576 Bacteria 8156
345 Ga0501040_0009694 3300049576 Bacteria 6288
346 Ga0501040_0015009 3300049576 Bacteria 5117
347 Ga0501040_0125844 3300049576 Bacteria 1800
348 Ga0501040_1328015 3300049576 Bacteria 522
349 Ga0501041_0002089 3300049577 Bacteria 11239
350 Ga0501041_0005325 3300049577 Bacteria 7527
351 Ga0501041_0005883 3300049577 Bacteria 7167
352 Ga0501041_0181096 3300049577 Unclassified 1319
353 Ga0501041_0233481 3300049577 Bacteria 1155
354 Ga0501041_0266983 3300049577 Bacteria 1076
355 Ga0501042_0013088 3300049578 Bacteria 5642
356 Ga0501042_0047809 3300049578 Bacteria 3050
357 Ga0501042_0092558 3300049578 Bacteria 2170
358 Ga0501043_0014638 3300049579 Bacteria 6142
359 Ga0501043_0214582 3300049579 Unclassified 1491
360 Ga0501043_0515562 3300049579 Bacteria 892
361 Ga0501046_0025917 3300049580 Bacteria 4792
362 Ga0501046_0026677 3300049580 Bacteria 4719
363 Ga0501046_0036834 3300049580 Bacteria 3935
364 Ga0501046_0362410 3300049580 Bacteria 1051
365 Ga0501047_0541345 3300049581 Bacteria 989
366 Ga0501047_1358772 3300049581 Bacteria 525
367 Ga0501048_0011567 3300049582 Bacteria 6579
368 Ga0501048_0014502 3300049582 Bacteria 5833
369 Ga0501048_0458108 3300049582 Bacteria 913
370 Ga0501048_0593739 3300049582 Archaea 795
371 Ga0501048_0713310 3300049582 Bacteria 720
372 Ga0501067_0790597 3300049583 Bacteria 534
373 Ga0501068_0062495 3300049584 Bacteria 2264
374 Ga0501068_0218785 3300049584 Bacteria 1210
375 Ga0501068_0268957 3300049584 Bacteria 1088
376 Ga0501069_0006423 3300049585 Bacteria 6146
377 Ga0501069_0121610 3300049585 Bacteria 1491
378 Ga0501070_0014308 3300049586 Bacteria 6677
379 Ga0501070_0026558 3300049586 Bacteria 4858
380 Ga0501071_0006625 3300049587 Bacteria 7525
381 Ga0501071_0088713 3300049587 Bacteria 2269
382 Ga0501071_0213996 3300049587 Bacteria 1449
383 Ga0501071_0256478 3300049587 Bacteria 1320
384 Ga0501071_0422774 3300049587 Bacteria 1018
385 Ga0501072_0002655 3300049588 Bacteria 13397
386 Ga0501072_0012173 3300049588 Bacteria 6573
387 Ga0501072_0016046 3300049588 Bacteria 5744
388 Ga0501072_0030304 3300049588 Bacteria 4230
389 Ga0501073_0003898 3300049589 Bacteria 11203
390 Ga0501073_0501621 3300049589 Bacteria 839
391 Ga0501074_0004949 3300049590 Bacteria 9545
392 Ga0501074_0207093 3300049590 Bacteria 1397
393 Ga0501074_0682638 3300049590 Unclassified 725
394 Ga0501075_0009674 3300049591 Bacteria 6752
395 Ga0501075_0014302 3300049591 Bacteria 5685
396 Ga0501075_0015210 3300049591 Bacteria 5519
397 Ga0501075_0022265 3300049591 Bacteria 4627
398 Ga0501076_0022735 3300049592 Bacteria 4821
399 Ga0501076_0035932 3300049592 Bacteria 3879
400 Ga0501076_0050117 3300049592 Bacteria 3303
401 Ga0501076_0125959 3300049592 Bacteria 2075
402 Ga0501077_0005096 3300049593 Bacteria 7975
403 Ga0501077_0045067 3300049593 Bacteria 2801
404 Ga0501077_0062179 3300049593 Bacteria 2369
405 Ga0501077_0117843 3300049593 Bacteria 1683
406 Ga0501077_0630920 3300049593 Unclassified 688
407 Ga0501077_1024217 3300049593 Bacteria 531
408 Ga0501209_162070 3300049656 Unclassified 677
409 Ga0501079_0002861 3300049741 Bacteria 12585
410 Ga0501079_0011433 3300049741 Bacteria 6775
411 Ga0501079_0088761 3300049741 Bacteria 2394
412 Ga0501079_0129886 3300049741 Bacteria 1960
413 Ga0501079_0172506 3300049741 Bacteria 1686
414 Ga0501079_0352277 3300049741 Bacteria 1153
415 Ga0501080_0014231 3300049742 Bacteria 7324
416 Ga0501080_0059686 3300049742 Bacteria 3549
417 Ga0501080_0170056 3300049742 Bacteria 2010
418 Ga0501080_1046806 3300049742 Unclassified 706
419 Ga0501081_0009307 3300049743 Bacteria 6400
420 Ga0501081_0012143 3300049743 Bacteria 5649
421 Ga0501081_0082623 3300049743 Bacteria 2250
422 Ga0501081_0088890 3300049743 Bacteria 2170
423 Ga0501081_0156987 3300049743 Bacteria 1637
424 Ga0501081_0245418 3300049743 Bacteria 1306
425 Ga0501081_0736325 3300049743 Bacteria 741
426 Ga0501081_1346532 3300049743 Bacteria 542
427 Ga0501083_0011641 3300049744 Bacteria 6172
428 Ga0501083_0035621 3300049744 Bacteria 3398
429 Ga0501083_0141802 3300049744 Bacteria 1573
430 Ga0501083_0216781 3300049744 Bacteria 1247
431 Ga0501035_0012225 3300049822 Bacteria 7936
432 Ga0501035_0049980 3300049822 Bacteria 3748
433 Ga0501044_0035548 3300049823 Bacteria 5217
434 Ga0501044_0981066 3300049823 Bacteria 717
435 Ga0501045_0008066 3300049824 Bacteria 7336
436 Ga0501045_0011239 3300049824 Bacteria 6281
437 Ga0501045_0491551 3300049824 Bacteria 911
438 nmdc:mga05p37_161985_c1 3300050507 Bacteria 2731
439 nmdc:mga06r32_462313_c1 3300050510 Bacteria 1248
440 nmdc:mga08y16_226024_c1 3300050511 Bacteria 1937
441 nmdc:mga0n895_1081435_c1 3300050512 Bacteria 780
442 nmdc:mga0n895_185667_c1 3300050512 Bacteria 2110
443 nmdc:mga0rr50_1223219_c1 3300050513 Unclassified 638
444 nmdc:mga08x19_475705_c1 3300050514 Bacteria 880
445 nmdc:mga08x19_484416_c1 3300050514 Bacteria 872
446 nmdc:mga08x19_486835_c1 3300050514 Bacteria 870
447 nmdc:mga08x19_634987_c1 3300050514 Bacteria 757
448 nmdc:mga0a205_569710_c1 3300050515 Bacteria 987
449 Ga0495595_0650011 3300053084 Bacteria 540
450 Ga0501084_0023750 3300054114 Bacteria 5113
451 Ga0501084_0064672 3300054114 Bacteria 3060
452 Ga0501084_0216249 3300054114 Bacteria 1617
453 Ga0501084_0228478 3300054114 Bacteria 1570
454 Ga0501084_0262686 3300054114 Bacteria 1457
455 Ga0501084_0406864 3300054114 Bacteria 1150
456 Ga0501084_1746266 3300054114 Bacteria 520
457 Ga0590075_010556 3300059424 Bacteria 2225
458 Ga0590077_006028 3300059426 Bacteria 2485
459 Ga0590077_060266 3300059426 Unclassified 860
460 Ga0501082_0013978 3300060353 Bacteria 6904
461 Ga0501082_0085099 3300060353 Bacteria 2727
462 Ga0501082_0146584 3300060353 Bacteria 2049
463 Ga0501082_0286418 3300060353 Bacteria 1434
464 Ga0501082_0605865 3300060353 Unclassified 958
465 Ga0530510_0003732 3300061734 Bacteria 10483
466 Ga0530510_0007694 3300061734 Bacteria 7503
467 Ga0530510_0068417 3300061734 Bacteria 2576
468 Ga0530510_0105174 3300061734 Bacteria 2065
469 Ga0501075_0831142
470 JGI25406J46586_10021132
471 Ga0058863_11701061
472 Ga0058861_11768738
473 Ga0058862_10062319
474 Ga0058862_11754725
475 Ga0070658_10019702
476 Ga0070683_100021347
477 Ga0070683_101232416
478 Ga0070680_100024745
479 Ga0070680_100052632
480 Ga0070682_101261786
481 Ga0070660_100004973
482 Ga0070660_100021598
483 Ga0070661_100830678
484 Ga0070692_10116889
485 Ga0070659_100064564
486 Ga0070659_100280053
487 Ga0070659_100602968
488 Ga0070709_10767625
489 Ga0070714_100406849
490 Ga0070714_100460488
491 Ga0070714_102115357
492 Ga0070713_101304019
493 Ga0070713_101835915
494 Ga0070710_11345506
495 Ga0070700_100150156
496 Ga0070694_100482688
497 Ga0070708_100861591
498 Ga0070663_100077726
499 Ga0070678_100623171
500 Ga0070662_100791697
501 Ga0070681_10093222
502 Ga0070706_100006146
503 Ga0070707_100145903
504 Ga0070707_100551296
505 Ga0070698_100022572
506 Ga0070698_100083028
507 Ga0070698_100150007
508 Ga0070698_100258032
509 Ga0070698_100358042
510 Ga0070699_100036696
511 Ga0070699_100199273
512 Ga0070699_100339387
513 Ga0070699_101475922
514 Ga0070679_100028443
515 Ga0070679_100660027
516 Ga0070684_100011478
517 Ga0070684_100073410
518 Ga0070697_100157315
519 Ga0070697_100467096
520 Ga0070697_100559439
521 Ga0068853_100362149
522 Ga0070686_101338154
523 Ga0070695_100143571
524 Ga0070696_100026029
525 Ga0070696_101849042
526 Ga0070693_100649486
527 Ga0070704_100786696
528 Ga0068855_100045039
529 Ga0068855_100096609
530 Ga0068855_101882382
531 Ga0068855_102337997
532 Ga0070664_100532643
533 Ga0068857_100314968
534 Ga0068854_100134847
535 Ga0068856_100075066
536 Ga0068856_102293455
537 Ga0068852_100178471
538 Ga0068852_101135378
539 Ga0068852_102627856
540 Ga0068859_101103925
541 Ga0068861_100135407
542 Ga0068870_10939527
543 Ga0081455_10027150
544 Ga0081455_10690819
545 Ga0081538_10005583
546 Ga0081539_10000433
547 Ga0081539_10008698
548 Ga0081539_10027541
549 Ga0070717_10032683
550 Ga0070717_10215338
551 Ga0070717_10294690
552 Ga0070717_10746226
553 Ga0070717_11636064
554 Ga0070712_100845650
555 Ga0075431_100327113
556 Ga0075433_10620861
557 Ga0075433_10948165
558 Ga0075434_100181796
559 Ga0068865_100337438
560 Ga0075436_100148457
561 Ga0075436_101401158
562 Ga0097620_101103938
563 Ga0075435_100952322
564 Ga0075435_101977502
565 Ga0105240_10003780
566 Ga0105240_10151868
567 Ga0111539_10056356
568 Ga0105245_10309960
569 Ga0105245_12997412
570 Ga0114129_10196910
571 Ga0114129_11681887
572 Ga0114129_12548551
573 Ga0114129_12676812
574 Ga0105237_12092060
575 Ga0105238_10126152
576 Ga0105249_11263476
577 Ga0105239_10080382
578 Ga0105239_10300244
579 Ga0157371_10363391
580 Ga0157370_10116952
581 Ga0157370_10151833
582 Ga0157369_10146083
583 Ga0157369_10520622
584 Ga0157369_11131120
585 Ga0157374_10799453
586 Ga0157372_10060240
587 Ga0157372_10668628
588 Ga0182008_10084430
589 Ga0206356_10439586
590 Ga0206353_10564235
591 Ga0213876_10620586
592 Ga0213875_10038904
593 Ga0224712_10501904
594 Ga0207699_10272339
595 Ga0207699_10744569
596 Ga0207684_10017782
597 Ga0207684_10581904
598 Ga0207654_10520610
599 Ga0207707_10013602
600 Ga0207707_10061387
601 Ga0207695_10015780
602 Ga0207695_10204570
603 Ga0207663_10198208
604 Ga0207660_10040183
605 Ga0207660_10238718
606 Ga0207657_10001447
607 Ga0207657_10003626
608 Ga0207652_10138426
609 Ga0207646_10125682
610 Ga0207646_10484957
611 Ga0207646_11836079
612 Ga0207687_10861113
613 Ga0207700_10018268
614 Ga0207700_11302266
615 Ga0207664_10059795
616 Ga0207664_10080175
617 Ga0207664_10410089
618 Ga0207690_10339970
619 Ga0207690_11401387
620 Ga0207706_10035660
621 Ga0207709_10781001
622 Ga0207704_10657957
623 Ga0207661_10315915
624 Ga0207661_11618908
625 Ga0207679_10085303
626 Ga0207679_10230971
627 Ga0207667_10046418
628 Ga0207667_11214226
629 Ga0207640_10042488
630 Ga0207677_10507332
631 Ga0207703_10673749
632 Ga0207639_10819953
633 Ga0207678_10083180
634 Ga0207678_10479937
635 Ga0207708_10004529
636 Ga0207708_10243374
637 Ga0207702_11751661
638 Ga0207683_10721294
639 Ga0207698_11427346
640 Ga0207698_11538756
641 Ga0207428_10968907
642 Ga0307408_101776117
643 Ga0307405_11379187
644 Ga0307410_10493741
645 Ga0307406_11335202
646 Ga0307407_10787096
647 Ga0307407_11657689
648 Ga0307409_100061640
649 Ga0307409_101518167
650 Ga0307409_101587990
651 Ga0307416_100948273
652 Ga0307411_10758927
653 Ga0307415_101219603
654 Ga0373943_0107861
655 Ga0395899_0019501
656 Ga0395899_0045209
657 Ga0395899_0052565
658 Ga0395899_0096653
659 Ga0395899_0100484
660 Ga0395899_0136664
661 Ga0395899_0138722
662 Ga0395899_0462206
663 Ga0395900_0009466
664 Ga0395900_0027753
665 Ga0395900_0095667
666 Ga0395900_0102655
667 Ga0395900_0135231
668 Ga0395900_0137078
669 Ga0395900_0150589
670 Ga0395900_0227646
671 Ga0395900_0304854
672 Ga0395900_0604223
673 Ga0395900_1126463
674 Ga0395900_1459996
675 Ga0395898_0010163
676 Ga0395898_0046884
677 Ga0395898_0060853
678 Ga0395898_0081463
679 Ga0395898_0094041
680 Ga0395898_0181188
681 Ga0395898_0199016
682 Ga0395898_0256889
683 Ga0395898_0261194
684 Ga0395898_0271781
685 Ga0395898_0299388
686 Ga0395898_0417128
687 Ga0395898_0808746
688 Ga0395898_1505793
689 Ga0395905_0007459
690 Ga0395905_0019552
691 Ga0395905_0026701
692 Ga0395905_0055802
693 Ga0395905_0061774
694 Ga0395905_0070133
695 Ga0395905_0096994
696 Ga0395905_0151884
697 Ga0395905_0180713
698 Ga0395905_0184362
699 Ga0395905_0186467
700 Ga0395905_0367011
701 Ga0395905_0413044
702 Ga0395905_0498667
703 Ga0395905_1281665
704 Ga0395905_1345627
705 Ga0395905_1749223
706 Ga0436364_0328278
707 Ga0395901_0008522
708 Ga0395901_0015382
709 Ga0395901_0017175
710 Ga0395901_0021063
711 Ga0395901_0023632
712 Ga0395901_0032800
713 Ga0395901_0051306
714 Ga0395901_0079207
715 Ga0395901_0117949
716 Ga0395901_0167326
717 Ga0395901_0178559
718 Ga0395901_0205978
719 Ga0395901_0375909
720 Ga0395901_0561987
721 Ga0395901_0697771
722 Ga0395901_0790590
723 Ga0395901_0875123
724 Ga0395901_0878821
725 Ga0439460_0102048
726 Ga0466963_0401994
727 Ga0466968_0023048
728 Ga0466968_0072006
729 Ga0466960_0046536
730 Ga0466967_0524940
731 Ga0466967_1185870
732 Ga0495651_0056753
733 Ga0495653_0055591
734 Ga0495584_0260406
735 Ga0495618_0095667
736 Ga0495630_1376577
737 Ga0495656_0139975
738 Ga0495635_0027717
739 Ga0495661_0304355
740 Ga0495657_0527665
741 Ga0495624_0418879
742 Ga0495589_0145108
743 Ga0495674_0118794
744 Ga0495676_1068095
745 Ga0495680_0002195
746 Ga0495684_0408401
747 Ga0496100_1296866
748 Ga0496101_0016236
749 Ga0496102_0312789
750 Ga0496102_0466667
751 Ga0496102_0551671
752 Ga0496103_0713613
753 Ga0496105_0016335
754 Ga0496106_0279265
755 Ga0496106_0594244
756 Ga0496106_1193654
757 Ga0496107_0322363
758 Ga0496107_1029969
759 Ga0496108_0014563
760 Ga0496108_0343075
761 Ga0496108_1702320
762 Ga0496109_0016075
763 Ga0496109_0072267
764 Ga0496109_0109963
765 Ga0496109_0743421
766 Ga0496109_1254448
767 Ga0496109_1609769
768 Ga0496110_0043751
769 Ga0496110_0096751
770 Ga0496110_0189277
771 Ga0496110_0274156
772 Ga0496110_0320466
773 Ga0496111_0022833
774 Ga0496111_0072092
775 Ga0496112_0023741
776 Ga0496112_0040623
777 Ga0496112_0063176
778 Ga0496112_0153942
779 Ga0496112_0332272
780 Ga0496112_0361375
781 Ga0496113_0074820
782 Ga0496113_0332936
783 Ga0496114_0001824
784 Ga0496114_0170940
785 Ga0496115_0418751
786 Ga0496117_0466999
787 Ga0496119_0000974
788 Ga0496120_0002187
789 Ga0501031_0052280
790 Ga0501031_0074185
791 Ga0501031_0134155
792 Ga0501031_0321247
793 Ga0501032_0020276
794 Ga0501032_0327598
795 Ga0501033_0007361
796 Ga0501033_0785659
797 Ga0501036_0015617
798 Ga0501036_0063230
799 Ga0501036_0202458
800 Ga0501037_0040993
801 Ga0501037_0084626
802 Ga0501037_0405134
803 Ga0501038_0004372
804 Ga0501038_0097826
805 Ga0501038_0187991
806 Ga0501038_0516107
807 Ga0501039_0021483
808 Ga0501039_0024544
809 Ga0501039_0062713
810 Ga0501039_0886039
811 Ga0501039_1398140
812 Ga0501040_0005564
813 Ga0501040_0009694
814 Ga0501040_0015009
815 Ga0501040_0125844
816 Ga0501040_1328015
817 Ga0501041_0002089
818 Ga0501041_0005325
819 Ga0501041_0005883
820 Ga0501041_0181096
821 Ga0501041_0233481
822 Ga0501041_0266983
823 Ga0501042_0013088
824 Ga0501042_0047809
825 Ga0501042_0092558
826 Ga0501043_0014638
827 Ga0501043_0214582
828 Ga0501043_0515562
829 Ga0501046_0025917
830 Ga0501046_0026677
831 Ga0501046_0036834
832 Ga0501046_0362410
833 Ga0501047_0541345
834 Ga0501047_1358772
835 Ga0501048_0011567
836 Ga0501048_0014502
837 Ga0501048_0458108
838 Ga0501048_0593739
839 Ga0501048_0713310
840 Ga0501067_0790597
841 Ga0501068_0062495
842 Ga0501068_0218785
843 Ga0501068_0268957
844 Ga0501069_0006423
845 Ga0501069_0121610
846 Ga0501070_0014308
847 Ga0501070_0026558
848 Ga0501071_0006625
849 Ga0501071_0088713
850 Ga0501071_0213996
851 Ga0501071_0256478
852 Ga0501071_0422774
853 Ga0501072_0002655
854 Ga0501072_0012173
855 Ga0501072_0016046
856 Ga0501072_0030304
857 Ga0501073_0003898
858 Ga0501073_0501621
859 Ga0501074_0004949
860 Ga0501074_0207093
861 Ga0501074_0682638
862 Ga0501075_0009674
863 Ga0501075_0014302
864 Ga0501075_0015210
865 Ga0501075_0022265
866 Ga0501076_0022735
867 Ga0501076_0035932
868 Ga0501076_0050117
869 Ga0501076_0125959
870 Ga0501077_0005096
871 Ga0501077_0045067
872 Ga0501077_0062179
873 Ga0501077_0117843
874 Ga0501077_0630920
875 Ga0501077_1024217
876 Ga0501209_162070
877 Ga0501079_0002861
878 Ga0501079_0011433
879 Ga0501079_0088761
880 Ga0501079_0129886
881 Ga0501079_0172506
882 Ga0501079_0352277
883 Ga0501080_0014231
884 Ga0501080_0059686
885 Ga0501080_0170056
886 Ga0501080_1046806
887 Ga0501081_0009307
888 Ga0501081_0012143
889 Ga0501081_0082623
890 Ga0501081_0088890
891 Ga0501081_0156987
892 Ga0501081_0245418
893 Ga0501081_0736325
894 Ga0501081_1346532
895 Ga0501083_0011641
896 Ga0501083_0035621
897 Ga0501083_0141802
898 Ga0501083_0216781
899 Ga0501035_0012225
900 Ga0501035_0049980
901 Ga0501044_0035548
902 Ga0501044_0981066
903 Ga0501045_0008066
904 Ga0501045_0011239
905 Ga0501045_0491551
906 nmdc:mga05p37_161985_c1
907 nmdc:mga06r32_462313_c1
908 nmdc:mga08y16_226024_c1
909 nmdc:mga0n895_1081435_c1
910 nmdc:mga0n895_185667_c1
911 nmdc:mga0rr50_1223219_c1
912 nmdc:mga08x19_475705_c1
913 nmdc:mga08x19_484416_c1
914 nmdc:mga08x19_486835_c1
915 nmdc:mga08x19_634987_c1
916 nmdc:mga0a205_569710_c1
917 Ga0495595_0650011
918 Ga0501084_0023750
919 Ga0501084_0064672
920 Ga0501084_0216249
921 Ga0501084_0228478
922 Ga0501084_0262686
923 Ga0501084_0406864
924 Ga0501084_1746266
925 Ga0590075_010556
926 Ga0590077_006028
927 Ga0590077_060266
928 Ga0501082_0013978
929 Ga0501082_0085099
930 Ga0501082_0146584
931 Ga0501082_0286418
932 Ga0501082_0605865
933 Ga0530510_0003732
934 Ga0530510_0007694
935 Ga0530510_0068417
936 Ga0530510_0105174

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02635

DsrE

DsrE/DsrF-like family

34

150

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jx7-assembly1.cif.gz_E crystal structure of ychn protein from e.coli 0.8254 4 123
1jx7-assembly1.cif.gz_E crystal structure of ychn protein from e.coli 0.8192 4 123
2qs7-assembly2.cif.gz_D crystal structure of a putative oxidoreductase of the dsre/dsrf-like family (sso1126) from sulfolobus solfataricus p2 at 2.09 a resolution 0.8014 4 121
3mc3-assembly1.cif.gz_A crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution 0.8004 3 121
3pnx-assembly2.cif.gz_E crystal structure of a putative sulfurtransferase dsre (swol_2425) from syntrophomonas wolfei str. goettingen at 1.92 a resolution 0.7977 4 121
ID Description Score Start End Superfamily
af_Q17399_1_268_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.879 2 43 3.40.50.2000
af_Q58396_1_114_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8606 6 123 3.40.1260.10
af_Q10941_1_278_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8595 2 43 3.40.50.2000
af_Q58396_1_114_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8471 6 123 3.40.1260.10
af_Q58170_143_270_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8347 1 117 3.40.1260.10
ID Description Score Start End GO Terms
AF-A0A7W1S265-F1-model_v4 deleted 0.9987 4 84
AF-A1SLX6-F1-model_v4 Peroxiredoxins-like protein 0.9882 5 123
AF-A0A6I3IN15-F1-model_v4 Peroxiredoxin 0.9844 4 123
AF-A0A1H5MH28-F1-model_v4 Predicted peroxiredoxin 0.9833 6 123
AF-A0A1I4ZLF0-F1-model_v4 Predicted peroxiredoxin 0.9799 4 123

Map