F450108

General Info

Members Datasets Scaffolds Average Seq Length
468 206 423 204

Family's Representative Sequence

Representative Sequence 3300046542|Ga0495597_0050207|Ga0495597_0050207_401_1099
Length 232
Sequence MDTRCHPNWVHFLPTEIVFSRSLYSVIRPLPPKSLCDLSELSDFSIRLTPAPEVWEWLQAEILADTGSIHNEDHAHLLDADIRVMWASSSFERQGRRVLGQAEQVAFRAGGWQKARMEQQMLDWFGDVPAFIITLVADYCSQCSDTDFCALVEHELYHLAHAKDKYGQPAFTKEGAPKIEMRGHDVEEFVGVVRRYGASPDVQELVDAANSPAEMGKLNISRACGTCLLKSA

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2511231007 Pseudomonas sp. GM18 Isolate Nodule
3 2511231011 Pseudomonas sp. GM30 Isolate Nodule
4 2511231023 Pseudomonas sp. GM80 Isolate Nodule
5 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
6 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
7 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
8 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
9 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
10 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
11 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
12 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
13 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
14 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
15 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
16 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
17 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
18 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
19 2784132063 Pseudomonas sp. 424 Isolate Unclassified
20 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
21 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
22 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
23 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
24 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
25 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
26 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
27 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
28 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
29 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
30 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
31 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
32 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
33 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
34 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
35 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
36 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
37 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
38 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
39 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
40 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
41 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
42 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
43 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
44 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
45 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
46 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
47 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
48 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
49 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
50 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
51 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
52 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
53 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
54 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
55 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
56 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
57 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
58 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
89 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
90 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
109 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
110 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
117 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
118 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
119 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
120 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
121 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
122 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
123 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
124 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
125 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
126 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
127 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
128 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
129 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
130 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
131 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
132 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
133 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
137 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
142 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
143 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
144 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
145 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
148 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
149 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
157 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
158 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
159 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
160 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
165 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
171 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
172 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
178 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
179 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
180 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
181 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
186 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
197 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
200 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
201 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
202 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
203 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
204 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
205 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
206 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.38
Metatranscriptomes 0
Isolates 9.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.98
Nodule 2.56
Rhizoplane 1.92
Rhizosphere 76.28
Stem 0
Stem Tuber 0.21
Unclassified 13.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_8706904 2162886011 Bacteria 826
2 JGI25154J39366_1003733 3300002738 Bacteria 3039
3 rootL2_10000530 3300003322 Bacteria 100270
4 Ga0055539_1000348 3300003752 Bacteria 20503
5 Ga0055533_1000340 3300003756 Bacteria 20503
6 Ga0055532_1000419 3300003758 Bacteria 20503
7 Ga0055525_1000490 3300003759 Bacteria 20503
8 Ga0055535_1006581 3300003761 Bacteria 2329
9 Ga0055534_1018171 3300003784 Bacteria 1228
10 Ga0055530_10000703 3300003791 Bacteria 28254
11 Ga0055540_1000623 3300003792 Bacteria 25198
12 Ga0055540_1000743 3300003792 Bacteria 22104
13 Ga0055541_1000240 3300003841 Bacteria 20503
14 Ga0065714_10007046 3300005288 Bacteria 3303
15 Ga0065714_10009840 3300005288 Bacteria 3411
16 Ga0065714_10011990 3300005288 Bacteria 2000
17 Ga0065714_10064791 3300005288 Bacteria 18761
18 Ga0065714_10077089 3300005288 Bacteria 2723
19 Ga0065714_10147193 3300005288 Bacteria 1126
20 Ga0065714_10212418 3300005288 Bacteria 861
21 Ga0065704_10090511 3300005289 Bacteria 2775
22 Ga0065712_10005942 3300005290 Bacteria 4550
23 Ga0065712_10084107 3300005290 Bacteria 2789
24 Ga0065712_10100648 3300005290 Bacteria 2037
25 Ga0070670_100000636 3300005331 Bacteria 27291
26 Ga0070662_100005392 3300005457 Bacteria 8167
27 Ga0070664_100000201 3300005564 Bacteria 42562
28 Ga0068851_10003434 3300005834 Bacteria 7050
29 Ga0075432_10004265 3300006058 Bacteria 4870
30 Ga0079104_1000730 3300006946 Bacteria 29122
31 Ga0079104_1000878 3300006946 Bacteria 24679
32 Ga0079104_1013641 3300006946 Bacteria 2493
33 Ga0079104_1014902 3300006946 Bacteria 2327
34 Ga0105251_10041288 3300009011 Bacteria 2246
35 Ga0105251_10048598 3300009011 Bacteria 2033
36 Ga0105244_10007470 3300009036 Bacteria 6943
37 Ga0105244_10036755 3300009036 Bacteria 2563
38 Ga0105244_10059827 3300009036 Bacteria 1920
39 Ga0105250_10021250 3300009092 Bacteria 2620
40 Ga0105237_10000413 3300009545 Bacteria 60829
41 Ga0105246_10002457 3300011119 Bacteria 11187
42 Ga0105246_10005408 3300011119 Bacteria 7777
43 Ga0157373_10000594 3300013100 Bacteria 28114
44 Ga0157373_10002562 3300013100 Bacteria 13813
45 Ga0157373_10008095 3300013100 Bacteria 7813
46 Ga0157373_10014454 3300013100 Bacteria 5785
47 Ga0157373_10019046 3300013100 Bacteria 4996
48 Ga0157373_10032327 3300013100 Bacteria 3766
49 Ga0157371_10000515 3300013102 Bacteria 46443
50 Ga0157371_10002800 3300013102 Bacteria 16347
51 Ga0157371_10020270 3300013102 Bacteria 4894
52 Ga0157371_10023457 3300013102 Bacteria 4512
53 Ga0157371_10048472 3300013102 Bacteria 3020
54 Ga0157371_10059478 3300013102 Bacteria 2708
55 Ga0157370_10006088 3300013104 Bacteria 13392
56 Ga0157370_10007330 3300013104 Bacteria 12038
57 Ga0157370_10019115 3300013104 Bacteria 6887
58 Ga0157370_10021368 3300013104 Bacteria 6449
59 Ga0157370_10027526 3300013104 Bacteria 5605
60 Ga0157370_10135427 3300013104 Bacteria 2296
61 Ga0157370_10288558 3300013104 Bacteria 1516
62 Ga0157370_10819374 3300013104 Bacteria 846
63 Ga0157369_10001400 3300013105 Bacteria 29608
64 Ga0157369_10006462 3300013105 Bacteria 13589
65 Ga0157369_10053904 3300013105 Bacteria 4344
66 Ga0157369_10089925 3300013105 Bacteria 3278
67 Ga0157369_10174112 3300013105 Bacteria 2266
68 Ga0163162_10095904 3300013306 Bacteria 3054
69 Ga0163162_10099451 3300013306 Bacteria 2999
70 Ga0157372_10000261 3300013307 Bacteria 58448
71 Ga0157372_10400492 3300013307 Bacteria 1599
72 Ga0157375_10000471 3300013308 Bacteria 36699
73 Ga0157375_10020355 3300013308 Bacteria 6059
74 Ga0157375_10046943 3300013308 Bacteria 4214
75 Ga0182008_10001776 3300014497 Bacteria 14126
76 Ga0182008_10006137 3300014497 Bacteria 6754
77 Ga0182008_10006568 3300014497 Bacteria 6492
78 Ga0182008_10070304 3300014497 Bacteria 1722
79 Ga0182008_10088765 3300014497 Bacteria 1523
80 Ga0182008_10109219 3300014497 Bacteria 1370
81 Ga0182008_10311129 3300014497 Bacteria 827
82 Ga0182006_1001203 3300015261 Bacteria 16166
83 Ga0182006_1001761 3300015261 Bacteria 12555
84 Ga0182006_1001798 3300015261 Bacteria 12356
85 Ga0182006_1013203 3300015261 Bacteria 3589
86 Ga0182006_1025294 3300015261 Bacteria 2440
87 Ga0182007_10000115 3300015262 Bacteria 54892
88 Ga0182007_10000242 3300015262 Bacteria 36731
89 Ga0182007_10007640 3300015262 Bacteria 4510
90 Ga0182007_10018447 3300015262 Bacteria 2527
91 Ga0182007_10039466 3300015262 Bacteria 1580
92 Ga0182007_10079356 3300015262 Bacteria 1076
93 Ga0182005_1000452 3300015265 Bacteria 21756
94 Ga0182005_1002004 3300015265 Bacteria 7644
95 Ga0182005_1002751 3300015265 Bacteria 6136
96 Ga0182005_1007085 3300015265 Bacteria 3384
97 Ga0182005_1010172 3300015265 Bacteria 2712
98 Ga0163161_10356261 3300017792 Bacteria 1164
99 Ga0209784_100368 3300025224 Bacteria 21333
100 Ga0209566_100664 3300025225 Bacteria 20588
101 Ga0209674_100420 3300025226 Bacteria 20588
102 Ga0209147_100549 3300025229 Bacteria 21319
103 Ga0209563_100296 3300025230 Bacteria 20588
104 Ga0209437_101174 3300025233 Bacteria 7759
105 Ga0209258_100754 3300025242 Bacteria 20482
106 Ga0209646_1000464 3300025246 Bacteria 20587
107 Ga0209026_1026571 3300025250 Bacteria 869
108 Ga0209677_100561 3300025253 Bacteria 20588
109 Ga0209675_1008531 3300025291 Bacteria 3751
110 Ga0209676_1000003 3300025292 Bacteria 1454178
111 Ga0209050_1000004 3300025298 Bacteria 1600040
112 Ga0209050_1000079 3300025298 Bacteria 277803
113 Ga0209050_1007915 3300025298 Bacteria 5825
114 Ga0209256_1001780 3300025299 Bacteria 20409
115 Ga0209051_1000006 3300025303 Bacteria 1015785
116 Ga0209051_1000054 3300025303 Bacteria 280804
117 Ga0209257_1008525 3300025304 Bacteria 5794
118 Ga0207656_10021279 3300025321 Bacteria 2590
119 Ga0207696_1000045 3300025711 Bacteria 296484
120 Ga0207655_1007431 3300025728 Bacteria 7106
121 Ga0207655_1010548 3300025728 Bacteria 5590
122 Ga0207655_1104446 3300025728 Bacteria 969
123 Ga0207713_1000259 3300025735 Bacteria 65068
124 Ga0207713_1033267 3300025735 Bacteria 2254
125 Ga0207713_1038157 3300025735 Bacteria 2041
126 Ga0207671_10001061 3300025914 Bacteria 33340
127 Ga0207649_10000183 3300025920 Bacteria 51125
128 Ga0207650_10000369 3300025925 Bacteria 42709
129 Ga0207706_10039996 3300025933 Bacteria 4156
130 Ga0207679_10000016 3300025945 Bacteria 253494
131 Ga0209281_1000015 3300027111 Bacteria 590084
132 Ga0209281_1000018 3300027111 Bacteria 579091
133 Ga0209281_1000450 3300027111 Bacteria 58787
134 Ga0209281_1014078 3300027111 Bacteria 1703
135 Ga0209281_1017263 3300027111 Bacteria 1467
136 Ga0207428_10001296 3300027907 Bacteria 26642
137 Ga0316179_1012668 3300030734 Bacteria 1427
138 Ga0316178_1002000 3300030735 Bacteria 20253
139 Ga0316183_1036010 3300030742 Bacteria 1605
140 Ga0307408_100100959 3300031548 Bacteria 2198
141 Ga0307408_101028850 3300031548 Bacteria 760
142 Ga0307405_10000596 3300031731 Bacteria 13860
143 Ga0307405_10000806 3300031731 Bacteria 12319
144 Ga0307405_10002850 3300031731 Bacteria 7771
145 Ga0307406_10026453 3300031901 Bacteria 3485
146 Ga0307412_10057345 3300031911 Bacteria 2599
147 Ga0307412_10521816 3300031911 Bacteria 992
148 Ga0307414_10037503 3300032004 Bacteria 3246
149 Ga0237819_00264 3300038705 Bacteria 19208
150 Ga0439438_000107 3300041405 Bacteria 38582
151 Ga0439438_001162 3300041405 Bacteria 11677
152 Ga0439438_013211 3300041405 Bacteria 2500
153 Ga0439447_000006 3300041407 Bacteria 101894
154 Ga0439447_000729 3300041407 Bacteria 12203
155 Ga0439447_001053 3300041407 Bacteria 10015
156 Ga0439447_002349 3300041407 Bacteria 6912
157 Ga0439447_004538 3300041407 Bacteria 4751
158 Ga0439466_0000036 3300041411 Bacteria 54279
159 Ga0439466_0000121 3300041411 Bacteria 30583
160 Ga0439466_0000224 3300041411 Bacteria 22371
161 Ga0439466_0000354 3300041411 Bacteria 17620
162 Ga0439466_0002829 3300041411 Bacteria 6793
163 Ga0439466_0060441 3300041411 Bacteria 1221
164 Ga0439432_000070 3300042006 Bacteria 31240
165 Ga0439432_000467 3300042006 Bacteria 15127
166 Ga0439432_004533 3300042006 Bacteria 5070
167 Ga0439451_000026 3300042009 Bacteria 32595
168 Ga0439452_000241 3300042010 Bacteria 37760
169 Ga0439452_000572 3300042010 Bacteria 19201
170 Ga0439452_066282 3300042010 Bacteria 801
171 Ga0439456_000035 3300042013 Bacteria 50951
172 Ga0439456_010855 3300042013 Bacteria 1883
173 Ga0439456_070467 3300042013 Bacteria 774
174 Ga0439463_000176 3300042016 Bacteria 16767
175 Ga0439463_000180 3300042016 Bacteria 16720
176 Ga0439463_011657 3300042016 Bacteria 2159
177 Ga0439463_012553 3300042016 Bacteria 2083
178 Ga0450911_006002 3300042115 Bacteria 1838
179 Ga0450905_000001 3300042142 Bacteria 51289
180 Ga0450906_000024 3300042145 Bacteria 27173
181 Ga0450907_000015 3300042146 Bacteria 85221
182 Ga0439446_0003047 3300042156 Bacteria 4107
183 Ga0450893_0003793 3300042532 Bacteria 2392
184 Ga0439440_0002233 3300042993 Bacteria 3627
185 Ga0495617_001809 3300046452 Bacteria 9104
186 Ga0495617_003535 3300046452 Bacteria 5850
187 Ga0495617_008850 3300046452 Bacteria 3464
188 Ga0495617_014041 3300046452 Bacteria 2722
189 Ga0495627_000244 3300046453 Bacteria 57194
190 Ga0495627_002243 3300046453 Bacteria 9571
191 Ga0495627_019677 3300046453 Bacteria 2260
192 Ga0495592_0000277 3300046454 Bacteria 43977
193 Ga0495603_0000015 3300046455 Bacteria 67608
194 Ga0495590_0000093 3300046457 Bacteria 55139
195 Ga0495590_0018216 3300046457 Bacteria 2516
196 Ga0495591_000191 3300046458 Bacteria 62737
197 Ga0495591_000418 3300046458 Bacteria 35269
198 Ga0495591_002948 3300046458 Bacteria 9086
199 Ga0495591_025982 3300046458 Bacteria 1828
200 Ga0495629_0115939 3300046459 Bacteria 1867
201 Ga0495629_0188327 3300046459 Bacteria 1429
202 Ga0495638_0000372 3300046460 Bacteria 55671
203 Ga0495638_0002771 3300046460 Bacteria 14084
204 Ga0495638_0004999 3300046460 Bacteria 9949
205 Ga0495638_0277901 3300046460 Bacteria 911
206 Ga0495638_0422956 3300046460 Bacteria 686
207 Ga0495650_0001331 3300046471 Bacteria 24756
208 Ga0495605_0000020 3300046474 Bacteria 254765
209 Ga0495605_0005300 3300046474 Bacteria 7521
210 Ga0495605_0025274 3300046474 Bacteria 3096
211 Ga0495584_0006183 3300046491 Bacteria 6290
212 Ga0495584_0012524 3300046491 Bacteria 4330
213 Ga0495584_0030978 3300046491 Bacteria 2707
214 Ga0495585_0000182 3300046492 Bacteria 66842
215 Ga0495585_0004872 3300046492 Bacteria 8606
216 Ga0495585_0006409 3300046492 Bacteria 7308
217 Ga0495585_0006454 3300046492 Bacteria 7274
218 Ga0495585_0011998 3300046492 Bacteria 5114
219 Ga0495607_0000255 3300046501 Bacteria 57210
220 Ga0495607_0000670 3300046501 Bacteria 33214
221 Ga0495607_0006076 3300046501 Bacteria 8538
222 Ga0495607_0017470 3300046501 Bacteria 4603
223 Ga0495607_0043749 3300046501 Bacteria 2646
224 Ga0495607_0152029 3300046501 Bacteria 1184
225 Ga0495583_0000393 3300046506 Bacteria 66835
226 Ga0495606_0002985 3300046507 Bacteria 18594
227 Ga0495606_0055011 3300046507 Bacteria 2575
228 Ga0495610_0000551 3300046512 Bacteria 37502
229 Ga0495610_0045518 3300046512 Bacteria 2171
230 Ga0495610_0049486 3300046512 Bacteria 2058
231 Ga0495616_0002982 3300046513 Bacteria 10994
232 Ga0495616_0033598 3300046513 Bacteria 2670
233 Ga0495616_0055930 3300046513 Bacteria 1951
234 Ga0495616_0148175 3300046513 Bacteria 1063
235 Ga0495620_0004885 3300046515 Bacteria 7527
236 Ga0495631_0000905 3300046518 Bacteria 18463
237 Ga0495632_0000266 3300046519 Bacteria 52024
238 Ga0495632_0000438 3300046519 Bacteria 39688
239 Ga0495632_0001948 3300046519 Bacteria 16486
240 Ga0495632_0003623 3300046519 Bacteria 10855
241 Ga0495632_0020008 3300046519 Bacteria 3635
242 Ga0495632_0035478 3300046519 Bacteria 2544
243 Ga0495632_0144890 3300046519 Bacteria 1100
244 Ga0495637_0000136 3300046520 Bacteria 55157
245 Ga0495637_0000190 3300046520 Bacteria 48103
246 Ga0495637_0000869 3300046520 Bacteria 19687
247 Ga0495637_0061160 3300046520 Bacteria 1544
248 Ga0495643_0000128 3300046522 Bacteria 122550
249 Ga0495643_0000381 3300046522 Bacteria 58799
250 Ga0495643_0000803 3300046522 Bacteria 34595
251 Ga0495643_0003752 3300046522 Bacteria 10992
252 Ga0495643_0056801 3300046522 Bacteria 2088
253 Ga0495643_0121213 3300046522 Bacteria 1321
254 Ga0495644_0002283 3300046523 Bacteria 7669
255 Ga0495644_0003260 3300046523 Bacteria 6415
256 Ga0495644_0011025 3300046523 Bacteria 3484
257 Ga0495648_0000284 3300046524 Bacteria 57498
258 Ga0495648_0000927 3300046524 Bacteria 30514
259 Ga0495648_0007289 3300046524 Bacteria 8872
260 Ga0495648_0118414 3300046524 Bacteria 1428
261 Ga0495666_0000028 3300046526 Bacteria 54995
262 Ga0495666_0004608 3300046526 Bacteria 6970
263 Ga0495642_0000042 3300046528 Bacteria 75891
264 Ga0495654_0000229 3300046530 Bacteria 52203
265 Ga0495654_0001075 3300046530 Bacteria 19908
266 Ga0495654_0001174 3300046530 Bacteria 18649
267 Ga0495654_0001430 3300046530 Bacteria 16428
268 Ga0495654_0001837 3300046530 Bacteria 14144
269 Ga0495654_0007965 3300046530 Bacteria 5884
270 Ga0495654_0010565 3300046530 Bacteria 5023
271 Ga0495654_0014311 3300046530 Bacteria 4224
272 Ga0495654_0034209 3300046530 Bacteria 2566
273 Ga0495654_0073018 3300046530 Bacteria 1623
274 Ga0495609_0000205 3300046538 Bacteria 58818
275 Ga0495609_0000301 3300046538 Bacteria 45226
276 Ga0495609_0028437 3300046538 Bacteria 2550
277 Ga0495597_0002643 3300046542 Bacteria 11110
278 Ga0495597_0017312 3300046542 Bacteria 3394
279 Ga0495597_0050207 3300046542 Bacteria 1842
280 Ga0495597_0146438 3300046542 Bacteria 971
281 Ga0495622_0000728 3300046557 Bacteria 18618
282 Ga0495622_0370326 3300046557 Bacteria 619
283 Ga0495668_0000328 3300046616 Bacteria 64806
284 Ga0495668_0000594 3300046616 Bacteria 43998
285 Ga0495668_0046646 3300046616 Bacteria 2407
286 Ga0495625_0001201 3300046660 Bacteria 32943
287 Ga0495625_0001690 3300046660 Bacteria 25714
288 Ga0495625_0012605 3300046660 Bacteria 6841
289 Ga0495625_0013123 3300046660 Bacteria 6676
290 Ga0495625_0028269 3300046660 Bacteria 4207
291 Ga0495625_0048965 3300046660 Bacteria 3039
292 Ga0495625_0188622 3300046660 Bacteria 1367
293 Ga0495659_0000099 3300046664 Bacteria 38226
294 Ga0495661_0000163 3300046665 Bacteria 78896
295 Ga0495661_0002441 3300046665 Bacteria 14313
296 Ga0495661_0151710 3300046665 Bacteria 1251
297 Ga0495661_0287266 3300046665 Bacteria 827
298 Ga0495669_0004536 3300046684 Bacteria 5744
299 Ga0495669_0017971 3300046684 Bacteria 3036
300 Ga0495613_0000182 3300046689 Bacteria 61411
301 Ga0495624_0102066 3300046690 Bacteria 1766
302 Ga0495670_0002456 3300046691 Bacteria 9155
303 Ga0495670_0010289 3300046691 Bacteria 4595
304 Ga0495670_0076017 3300046691 Bacteria 1706
305 Ga0495670_0245842 3300046691 Bacteria 953
306 Ga0495671_0000284 3300046692 Bacteria 42448
307 Ga0495671_0005120 3300046692 Bacteria 7714
308 Ga0495671_0090758 3300046692 Bacteria 1495
309 Ga0495649_0000103 3300046694 Bacteria 75113
310 Ga0495649_0000310 3300046694 Bacteria 42647
311 Ga0495649_0014342 3300046694 Bacteria 4545
312 Ga0495649_0019584 3300046694 Bacteria 3802
313 Ga0495649_0033728 3300046694 Bacteria 2817
314 Ga0495649_0071248 3300046694 Bacteria 1863
315 Ga0495649_0191557 3300046694 Bacteria 1064
316 Ga0495649_0193041 3300046694 Bacteria 1059
317 Ga0495649_0246262 3300046694 Bacteria 919
318 Ga0495589_0000520 3300046794 Bacteria 27048
319 Ga0495589_0000902 3300046794 Bacteria 18342
320 Ga0495589_0001067 3300046794 Bacteria 16448
321 Ga0495589_0003589 3300046794 Bacteria 8384
322 Ga0495600_0006383 3300046809 Bacteria 7176
323 Ga0495660_0008581 3300046810 Bacteria 5979
324 Ga0495660_0011043 3300046810 Bacteria 5244
325 Ga0495660_0012348 3300046810 Bacteria 4956
326 Ga0495660_0012823 3300046810 Bacteria 4861
327 Ga0495660_0014024 3300046810 Bacteria 4646
328 Ga0495660_0019452 3300046810 Bacteria 3899
329 Ga0495660_0096853 3300046810 Bacteria 1524
330 Ga0495672_0000268 3300047320 Bacteria 72131
331 Ga0495672_0000318 3300047320 Bacteria 64020
332 Ga0495672_0000709 3300047320 Bacteria 36671
333 Ga0495672_0070625 3300047320 Bacteria 1978
334 Ga0495672_0113243 3300047320 Bacteria 1453
335 Ga0495680_0003372 3300047322 Bacteria 15785
336 Ga0495680_0007255 3300047322 Bacteria 10204
337 Ga0495680_0019917 3300047322 Bacteria 5655
338 Ga0495680_0315012 3300047322 Bacteria 1096
339 Ga0495683_0000731 3300047323 Bacteria 23833
340 Ga0495683_0001722 3300047323 Bacteria 13869
341 Ga0495683_0001963 3300047323 Bacteria 12834
342 Ga0495683_0001971 3300047323 Bacteria 12815
343 Ga0495677_0000879 3300047445 Bacteria 12148
344 Ga0495685_002726 3300047447 Bacteria 5571
345 Ga0495673_0000276 3300047469 Bacteria 69967
346 Ga0495673_0000281 3300047469 Bacteria 68886
347 Ga0495673_0000732 3300047469 Bacteria 31449
348 Ga0495673_0000764 3300047469 Bacteria 30514
349 Ga0495673_0002249 3300047469 Bacteria 13862
350 Ga0495681_0000097 3300047470 Bacteria 76004
351 Ga0495681_0000124 3300047470 Bacteria 67763
352 Ga0495681_0000367 3300047470 Bacteria 35217
353 Ga0495681_0002355 3300047470 Bacteria 13567
354 Ga0495681_0005913 3300047470 Bacteria 8117
355 Ga0495681_0043004 3300047470 Bacteria 2182
356 Ga0495686_0000546 3300047472 Bacteria 53799
357 Ga0495686_0136709 3300047472 Bacteria 1449
358 Ga0495593_0000260 3300047673 Bacteria 28520
359 Ga0495593_0004162 3300047673 Bacteria 8614
360 Ga0495602_0010283 3300048088 Bacteria 9715
361 Ga0495626_0000045 3300048091 Bacteria 164931
362 Ga0495626_0000442 3300048091 Bacteria 42376
363 Ga0495626_0000690 3300048091 Bacteria 32282
364 Ga0495626_0005696 3300048091 Bacteria 7207
365 Ga0495626_0025108 3300048091 Bacteria 2916
366 Ga0495626_0028320 3300048091 Bacteria 2717
367 Ga0496116_0000207 3300048919 Bacteria 111531
368 Ga0496116_0000603 3300048919 Bacteria 47538
369 Ga0496116_0029145 3300048919 Bacteria 3985
370 Ga0496117_0002289 3300048920 Bacteria 24708
371 Ga0496117_0002888 3300048920 Bacteria 20832
372 Ga0496117_0006564 3300048920 Bacteria 11706
373 Ga0496117_0009488 3300048920 Bacteria 9045
374 Ga0496117_0073769 3300048920 Bacteria 2275
375 Ga0496117_0347307 3300048920 Bacteria 767
376 Ga0496117_0405700 3300048920 Bacteria 686
377 Ga0496118_0001038 3300048921 Bacteria 43279
378 Ga0496118_0002132 3300048921 Bacteria 27641
379 Ga0496118_0022235 3300048921 Bacteria 5552
380 Ga0496118_0024269 3300048921 Bacteria 5242
381 Ga0496118_0127374 3300048921 Bacteria 1643
382 Ga0496118_0164193 3300048921 Bacteria 1368
383 Ga0496119_0000120 3300048922 Bacteria 109767
384 Ga0496119_0036952 3300048922 Bacteria 3180
385 Ga0496120_0000540 3300048923 Bacteria 57943
386 Ga0496120_0009974 3300048923 Bacteria 6677
387 Ga0496120_0112741 3300048923 Bacteria 1418
388 Ga0496121_0004216 3300048924 Bacteria 19597
389 Ga0496121_0006691 3300048924 Bacteria 14167
390 Ga0496121_0008826 3300048924 Bacteria 11739
391 Ga0496122_0001523 3300048925 Bacteria 36892
392 Ga0496122_0209552 3300048925 Bacteria 1130
393 Ga0496123_0000683 3300048926 Bacteria 55914
394 Ga0496123_0013704 3300048926 Bacteria 6780
395 Ga0496124_0001102 3300048927 Bacteria 42451
396 Ga0496124_0003445 3300048927 Bacteria 19347
397 Ga0496124_0021065 3300048927 Bacteria 6012
398 Ga0496124_0054262 3300048927 Bacteria 3393
399 Ga0496124_0104485 3300048927 Bacteria 2290
400 Ga0496124_0177553 3300048927 Bacteria 1642
401 Ga0496125_0001262 3300048928 Bacteria 37739
402 Ga0496125_0001332 3300048928 Bacteria 36457
403 Ga0496125_0004139 3300048928 Bacteria 16935
404 Ga0496125_0004993 3300048928 Bacteria 14979
405 Ga0496125_0008514 3300048928 Bacteria 10723
406 Ga0496125_0011807 3300048928 Bacteria 8704
407 Ga0496125_0041436 3300048928 Bacteria 3936
408 Ga0496125_0057541 3300048928 Bacteria 3147
409 Ga0495678_000289 3300049459 Bacteria 55364
410 Ga0495678_023354 3300049459 Bacteria 2688
411 Ga0495682_0000143 3300049460 Bacteria 62210
412 Ga0495682_0001702 3300049460 Bacteria 11187
413 Ga0495682_0006549 3300049460 Bacteria 4706
414 Ga0495682_0015208 3300049460 Bacteria 2916
415 Ga0495682_0021811 3300049460 Bacteria 2398
416 Ga0495682_0029815 3300049460 Bacteria 2021
417 Ga0495682_0031475 3300049460 Bacteria 1960
418 Ga0501034_0571774 3300049571 Bacteria 1038
419 Ga0501227_001109 3300049665 Bacteria 5989
420 Ga0501235_036049 3300049669 Bacteria 1124
421 Ga0501252_006015 3300049682 Bacteria 1337
422 Ga0501226_000399 3300049853 Bacteria 6286
423 Ga0500572_000011 3300053111 Bacteria 64261

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005457 Ga0070662_100005392 Ga0070662_1000053929 187
2 3300005834 Ga0068851_10003434 Ga0068851_100034343 187
3 3300013102 Ga0157371_10002800 Ga0157371_100028007 187
4 3300013104 Ga0157370_10007330 Ga0157370_100073306 187
5 3300025933 Ga0207706_10039996 Ga0207706_100399964 187
6 3300042010 Ga0439452_066282 Ga0439452_066282_212_775 187
7 3300042145 Ga0450906_000024 Ga0450906_000024_2883_3446 187
8 3300047470 Ga0495681_0000124 Ga0495681_0000124_22258_22836 187
9 3300048927 Ga0496124_0021065 Ga0496124_0021065_3313_3876 187
10 3300042016 Ga0439463_000176 Ga0439463_000176_13113_13682 189
11 3300046694 Ga0495649_0246262 Ga0495649_0246262_292_867 190
12 3300046513 Ga0495616_0033598 Ga0495616_0033598_791_1378 191
13 3300046542 Ga0495597_0002643 Ga0495597_0002643_2209_2793 192
14 3300046794 Ga0495589_0003589 Ga0495589_0003589_4583_5173 192
15 3300046501 Ga0495607_0017470 Ga0495607_0017470_495_1076 193
16 3300046513 Ga0495616_0148175 Ga0495616_0148175_42_623 193
17 3300046810 Ga0495660_0014024 Ga0495660_0014024_1110_1694 194
18 3300013105 Ga0157369_10006462 Ga0157369_1000646217 195
19 3300013105 Ga0157369_10174112 Ga0157369_101741121 195
20 3300046507 Ga0495606_0002985 Ga0495606_0002985_2159_2746 195
21 3300046557 Ga0495622_0370326 Ga0495622_0370326_16_603 195
22 3300048922 Ga0496119_0036952 Ga0496119_0036952_324_911 195
23 3300048923 Ga0496120_0009974 Ga0496120_0009974_3562_4149 195
24 3300042156 Ga0439446_0003047 Ga0439446_0003047_1425_2048 196
25 3300046457 Ga0495590_0000093 Ga0495590_0000093_27780_28370 196
26 3300046492 Ga0495585_0004872 Ga0495585_0004872_1509_2102 196
27 3300046794 Ga0495589_0001067 Ga0495589_0001067_5753_6343 196
28 3300006058 Ga0075432_10004265 Ga0075432_100042655 197
29 3300027907 Ga0207428_10001296 Ga0207428_100012965 197
30 3300046492 Ga0495585_0011998 Ga0495585_0011998_2445_3053 197
31 3300005288 Ga0065714_10007046 Ga0065714_100070463 198
32 3300005290 Ga0065712_10005942 Ga0065712_100059427 198
33 3300005290 Ga0065712_10100648 Ga0065712_101006481 198
34 3300009011 Ga0105251_10041288 Ga0105251_100412881 198
35 3300009036 Ga0105244_10036755 Ga0105244_100367552 198
36 3300013100 Ga0157373_10014454 Ga0157373_100144541 198
37 3300013102 Ga0157371_10000515 Ga0157371_1000051525 198
38 3300013104 Ga0157370_10288558 Ga0157370_102885581 198
39 3300013306 Ga0163162_10095904 Ga0163162_100959045 198
40 3300013307 Ga0157372_10000261 Ga0157372_1000026137 198
41 3300013307 Ga0157372_10400492 Ga0157372_104004923 198
42 3300014497 Ga0182008_10006568 Ga0182008_100065681 198
43 3300014497 Ga0182008_10311129 Ga0182008_103111291 198
44 3300015262 Ga0182007_10039466 Ga0182007_100394663 198
45 3300015262 Ga0182007_10079356 Ga0182007_100793562 198
46 3300015265 Ga0182005_1000452 Ga0182005_100045224 198
47 3300025735 Ga0207713_1033267 Ga0207713_10332675 198
48 3300031731 Ga0307405_10000806 Ga0307405_100008065 198
49 3300042013 Ga0439456_070467 Ga0439456_070467_42_638 198
50 3300042115 Ga0450911_006002 Ga0450911_006002_787_1383 198
51 3300046452 Ga0495617_003535 Ga0495617_003535_2311_2907 198
52 3300046458 Ga0495591_000191 Ga0495591_000191_30379_30987 198
53 3300046460 Ga0495638_0277901 Ga0495638_0277901_299_895 198
54 3300046512 Ga0495610_0000551 Ga0495610_0000551_7847_8443 198
55 3300046515 Ga0495620_0004885 Ga0495620_0004885_2997_3593 198
56 3300046519 Ga0495632_0000438 Ga0495632_0000438_8767_9363 198
57 3300046519 Ga0495632_0001948 Ga0495632_0001948_9091_9687 198
58 3300046519 Ga0495632_0035478 Ga0495632_0035478_1740_2336 198
59 3300046522 Ga0495643_0000128 Ga0495643_0000128_31332_31928 198
60 3300046522 Ga0495643_0056801 Ga0495643_0056801_170_766 198
61 3300046530 Ga0495654_0001430 Ga0495654_0001430_814_1410 198
62 3300046530 Ga0495654_0010565 Ga0495654_0010565_1401_1997 198
63 3300046616 Ga0495668_0000328 Ga0495668_0000328_27882_28490 198
64 3300046665 Ga0495661_0151710 Ga0495661_0151710_415_1011 198
65 3300046694 Ga0495649_0000103 Ga0495649_0000103_45444_46040 198
66 3300046694 Ga0495649_0033728 Ga0495649_0033728_369_965 198
67 3300046694 Ga0495649_0071248 Ga0495649_0071248_475_1083 198
68 3300046810 Ga0495660_0008581 Ga0495660_0008581_2234_2830 198
69 3300046810 Ga0495660_0011043 Ga0495660_0011043_3228_3824 198
70 3300046810 Ga0495660_0019452 Ga0495660_0019452_153_749 198
71 3300046810 Ga0495660_0096853 Ga0495660_0096853_202_810 198
72 3300047320 Ga0495672_0000709 Ga0495672_0000709_25173_25769 198
73 3300047320 Ga0495672_0070625 Ga0495672_0070625_672_1349 198
74 3300047323 Ga0495683_0001963 Ga0495683_0001963_11182_11778 198
75 3300048091 Ga0495626_0005696 Ga0495626_0005696_4699_5307 198
76 3300048919 Ga0496116_0000207 Ga0496116_0000207_26058_26654 198
77 3300048919 Ga0496116_0000603 Ga0496116_0000603_16020_16616 198
78 3300048920 Ga0496117_0002289 Ga0496117_0002289_3256_3852 198
79 3300048920 Ga0496117_0347307 Ga0496117_0347307_119_715 198
80 3300048920 Ga0496117_0405700 Ga0496117_0405700_38_634 198
81 3300048921 Ga0496118_0001038 Ga0496118_0001038_41243_41839 198
82 3300048921 Ga0496118_0002132 Ga0496118_0002132_6189_6785 198
83 3300048921 Ga0496118_0022235 Ga0496118_0022235_4871_5467 198
84 3300048925 Ga0496122_0209552 Ga0496122_0209552_494_1105 198
85 3300048926 Ga0496123_0013704 Ga0496123_0013704_33_629 198
86 3300048927 Ga0496124_0001102 Ga0496124_0001102_23967_24575 198
87 3300048928 Ga0496125_0008514 Ga0496125_0008514_7019_7615 198
88 3300049459 Ga0495678_000289 Ga0495678_000289_22834_23430 198
89 iso_pu_bacteria 2511231023 2511366474 198
90 iso_pu_bacteria 2599185160 2599357690 198
91 iso_pu_bacteria 2599185164 2599382595 198
92 iso_pu_bacteria 2599185165 2599389042 198
93 iso_pu_bacteria 2599185181 2599463822 198
94 iso_pu_bacteria 2599185186 2599492842 198
95 iso_pu_bacteria 2599185356 2600216959 198
96 iso_pu_bacteria 2600255313 2601777130 198
97 iso_pu_bacteria 2643221571 2643874022 198
98 iso_pu_bacteria 2939651529 2939656960 198
99 iso_pu_bacteria 2984286254 2984288998 198
100 iso_pu_bacteria 637000220 637321106 198
101 iso_pu_bacteria 8055878733 8055882125 198
102 3300006946 Ga0079104_1013641 Ga0079104_10136417 199
103 3300027111 Ga0209281_1000450 Ga0209281_100045053 199
104 3300042016 Ga0439463_011657 Ga0439463_011657_219_818 199
105 3300049571 Ga0501034_0571774 Ga0501034_0571774_307_915 199
106 iso_pu_bacteria 2511231007 2511274597 199
107 iso_pu_bacteria 2919385768 2919390312 199
108 3300003322 rootL2_10000530 rootL2_1000053074 200
109 3300005288 Ga0065714_10212418 Ga0065714_102124181 200
110 3300013100 Ga0157373_10002562 Ga0157373_100025628 200
111 3300013104 Ga0157370_10819374 Ga0157370_108193741 200
112 3300014497 Ga0182008_10006137 Ga0182008_100061371 200
113 3300015261 Ga0182006_1001203 Ga0182006_100120311 200
114 3300025321 Ga0207656_10021279 Ga0207656_100212793 200
115 3300025728 Ga0207655_1010548 Ga0207655_10105483 200
116 3300031548 Ga0307408_101028850 Ga0307408_1010288501 200
117 3300031901 Ga0307406_10026453 Ga0307406_100264534 200
118 3300031911 Ga0307412_10521816 Ga0307412_105218162 200
119 3300041411 Ga0439466_0000354 Ga0439466_0000354_1096_1710 200
120 3300042006 Ga0439432_000467 Ga0439432_000467_9826_10428 200
121 3300042016 Ga0439463_012553 Ga0439463_012553_1206_1808 200
122 3300046452 Ga0495617_001809 Ga0495617_001809_668_1282 200
123 3300046455 Ga0495603_0000015 Ga0495603_0000015_29791_30393 200
124 3300046458 Ga0495591_000418 Ga0495591_000418_11024_11626 200
125 3300046458 Ga0495591_025982 Ga0495591_025982_1105_1719 200
126 3300046459 Ga0495629_0115939 Ga0495629_0115939_395_997 200
127 3300046501 Ga0495607_0000670 Ga0495607_0000670_13265_13867 200
128 3300046512 Ga0495610_0045518 Ga0495610_0045518_972_1574 200
129 3300046520 Ga0495637_0000869 Ga0495637_0000869_6242_6844 200
130 3300046530 Ga0495654_0001075 Ga0495654_0001075_4012_4626 200
131 3300046665 Ga0495661_0000163 Ga0495661_0000163_21807_22409 200
132 3300046665 Ga0495661_0287266 Ga0495661_0287266_203_817 200
133 3300047323 Ga0495683_0000731 Ga0495683_0000731_2162_2764 200
134 3300047323 Ga0495683_0001722 Ga0495683_0001722_13247_13849 200
135 3300048091 Ga0495626_0000690 Ga0495626_0000690_28564_29166 200
136 3300048920 Ga0496117_0009488 Ga0496117_0009488_3266_3883 200
137 3300048922 Ga0496119_0000120 Ga0496119_0000120_47581_48195 200
138 3300048923 Ga0496120_0000540 Ga0496120_0000540_31439_32053 200
139 3300048927 Ga0496124_0003445 Ga0496124_0003445_3063_3677 200
140 3300048927 Ga0496124_0104485 Ga0496124_0104485_10_612 200
141 3300048928 Ga0496125_0011807 Ga0496125_0011807_3083_3700 200
142 3300048928 Ga0496125_0041436 Ga0496125_0041436_1785_2387 200
143 3300049665 Ga0501227_001109 Ga0501227_001109_5203_5805 200
144 3300049853 Ga0501226_000399 Ga0501226_000399_3511_4113 200
145 iso_pu_bacteria 2900051742 2900052162 200
146 3300048919 Ga0496116_0029145 Ga0496116_0029145_120_737 201
147 3300048921 Ga0496118_0164193 Ga0496118_0164193_713_1330 201
148 3300048924 Ga0496121_0008826 Ga0496121_0008826_4247_4852 201
149 3300003784 Ga0055534_1018171 Ga0055534_10181712 202
150 3300017792 Ga0163161_10356261 Ga0163161_103562612 202
151 3300025291 Ga0209675_1008531 Ga0209675_10085313 202
152 3300025299 Ga0209256_1001780 Ga0209256_10017803 202
153 2162886011 MRS1b_contig_8706904 MRS1b_0244.00002920 203
154 3300002738 JGI25154J39366_1003733 JGI25154J39366_10037332 203
155 3300003752 Ga0055539_1000348 Ga0055539_10003482 203
156 3300003756 Ga0055533_1000340 Ga0055533_10003402 203
157 3300003758 Ga0055532_1000419 Ga0055532_100041926 203
158 3300003759 Ga0055525_1000490 Ga0055525_10004902 203
159 3300003761 Ga0055535_1006581 Ga0055535_10065813 203
160 3300003791 Ga0055530_10000703 Ga0055530_1000070347 203
161 3300003792 Ga0055540_1000623 Ga0055540_100062348 203
162 3300003792 Ga0055540_1000743 Ga0055540_10007431 203
163 3300003841 Ga0055541_1000240 Ga0055541_100024026 203
164 3300005288 Ga0065714_10009840 Ga0065714_100098404 203
165 3300005288 Ga0065714_10011990 Ga0065714_100119905 203
166 3300005288 Ga0065714_10064791 Ga0065714_1006479115 203
167 3300005288 Ga0065714_10077089 Ga0065714_100770893 203
168 3300005288 Ga0065714_10147193 Ga0065714_101471931 203
169 3300005289 Ga0065704_10090511 Ga0065704_100905113 203
170 3300005290 Ga0065712_10084107 Ga0065712_100841078 203
171 3300005331 Ga0070670_100000636 Ga0070670_10000063620 203
172 3300005564 Ga0070664_100000201 Ga0070664_10000020139 203
173 3300006946 Ga0079104_1000730 Ga0079104_10007303 203
174 3300006946 Ga0079104_1000878 Ga0079104_100087845 203
175 3300006946 Ga0079104_1014902 Ga0079104_10149023 203
176 3300009011 Ga0105251_10048598 Ga0105251_100485981 203
177 3300009036 Ga0105244_10007470 Ga0105244_1000747015 203
178 3300009036 Ga0105244_10059827 Ga0105244_100598272 203
179 3300009092 Ga0105250_10021250 Ga0105250_100212505 203
180 3300009545 Ga0105237_10000413 Ga0105237_1000041360 203
181 3300011119 Ga0105246_10002457 Ga0105246_100024575 203
182 3300011119 Ga0105246_10005408 Ga0105246_100054084 203
183 3300013100 Ga0157373_10000594 Ga0157373_1000059419 203
184 3300013100 Ga0157373_10008095 Ga0157373_100080953 203
185 3300013100 Ga0157373_10019046 Ga0157373_100190468 203
186 3300013100 Ga0157373_10032327 Ga0157373_100323278 203
187 3300013102 Ga0157371_10020270 Ga0157371_100202709 203
188 3300013102 Ga0157371_10023457 Ga0157371_100234578 203
189 3300013102 Ga0157371_10048472 Ga0157371_100484725 203
190 3300013102 Ga0157371_10059478 Ga0157371_100594786 203
191 3300013104 Ga0157370_10006088 Ga0157370_100060887 203
192 3300013104 Ga0157370_10019115 Ga0157370_100191159 203
193 3300013104 Ga0157370_10021368 Ga0157370_100213686 203
194 3300013104 Ga0157370_10027526 Ga0157370_1002752612 203
195 3300013104 Ga0157370_10135427 Ga0157370_101354271 203
196 3300013105 Ga0157369_10001400 Ga0157369_1000140010 203
197 3300013105 Ga0157369_10053904 Ga0157369_100539042 203
198 3300013105 Ga0157369_10089925 Ga0157369_100899251 203
199 3300013306 Ga0163162_10099451 Ga0163162_100994511 203
200 3300013308 Ga0157375_10000471 Ga0157375_1000047142 203
201 3300013308 Ga0157375_10020355 Ga0157375_100203554 203
202 3300013308 Ga0157375_10046943 Ga0157375_100469434 203
203 3300014497 Ga0182008_10001776 Ga0182008_1000177622 203
204 3300014497 Ga0182008_10070304 Ga0182008_100703044 203
205 3300014497 Ga0182008_10088765 Ga0182008_100887652 203
206 3300014497 Ga0182008_10109219 Ga0182008_101092193 203
207 3300015261 Ga0182006_1001761 Ga0182006_10017615 203
208 3300015261 Ga0182006_1001798 Ga0182006_10017988 203
209 3300015261 Ga0182006_1013203 Ga0182006_10132033 203
210 3300015261 Ga0182006_1025294 Ga0182006_10252943 203
211 3300015262 Ga0182007_10000115 Ga0182007_1000011544 203
212 3300015262 Ga0182007_10000242 Ga0182007_1000024239 203
213 3300015262 Ga0182007_10007640 Ga0182007_100076405 203
214 3300015262 Ga0182007_10018447 Ga0182007_100184477 203
215 3300015265 Ga0182005_1002004 Ga0182005_10020046 203
216 3300015265 Ga0182005_1002751 Ga0182005_10027513 203
217 3300015265 Ga0182005_1007085 Ga0182005_10070853 203
218 3300015265 Ga0182005_1010172 Ga0182005_10101726 203
219 3300025224 Ga0209784_100368 Ga0209784_1003684 203
220 3300025225 Ga0209566_100664 Ga0209566_1006642 203
221 3300025226 Ga0209674_100420 Ga0209674_1004202 203
222 3300025229 Ga0209147_100549 Ga0209147_10054926 203
223 3300025230 Ga0209563_100296 Ga0209563_1002962 203
224 3300025233 Ga0209437_101174 Ga0209437_1011743 203
225 3300025242 Ga0209258_100754 Ga0209258_1007542 203
226 3300025246 Ga0209646_1000464 Ga0209646_10004642 203
227 3300025250 Ga0209026_1026571 Ga0209026_10265712 203
228 3300025253 Ga0209677_100561 Ga0209677_1005612 203
229 3300025292 Ga0209676_1000003 Ga0209676_1000003141 203
230 3300025298 Ga0209050_1000004 Ga0209050_1000004123 203
231 3300025298 Ga0209050_1000079 Ga0209050_1000079123 203
232 3300025298 Ga0209050_1007915 Ga0209050_100791510 203
233 3300025303 Ga0209051_1000006 Ga0209051_1000006851 203
234 3300025303 Ga0209051_1000054 Ga0209051_1000054126 203
235 3300025304 Ga0209257_1008525 Ga0209257_10085257 203
236 3300025711 Ga0207696_1000045 Ga0207696_100004536 203
237 3300025728 Ga0207655_1007431 Ga0207655_10074312 203
238 3300025728 Ga0207655_1104446 Ga0207655_11044462 203
239 3300025735 Ga0207713_1000259 Ga0207713_100025964 203
240 3300025735 Ga0207713_1038157 Ga0207713_10381571 203
241 3300025914 Ga0207671_10001061 Ga0207671_1000106122 203
242 3300025920 Ga0207649_10000183 Ga0207649_1000018327 203
243 3300025925 Ga0207650_10000369 Ga0207650_1000036937 203
244 3300025945 Ga0207679_10000016 Ga0207679_10000016124 203
245 3300027111 Ga0209281_1000015 Ga0209281_1000015485 203
246 3300027111 Ga0209281_1000018 Ga0209281_1000018116 203
247 3300027111 Ga0209281_1014078 Ga0209281_10140782 203
248 3300027111 Ga0209281_1017263 Ga0209281_10172633 203
249 3300030734 Ga0316179_1012668 Ga0316179_10126682 203
250 3300030735 Ga0316178_1002000 Ga0316178_100200033 203
251 3300030742 Ga0316183_1036010 Ga0316183_10360103 203
252 3300031548 Ga0307408_100100959 Ga0307408_1001009591 203
253 3300031731 Ga0307405_10000596 Ga0307405_100005962 203
254 3300031731 Ga0307405_10002850 Ga0307405_100028508 203
255 3300031911 Ga0307412_10057345 Ga0307412_100573453 203
256 3300032004 Ga0307414_10037503 Ga0307414_100375035 203
257 3300038705 Ga0237819_00264 Ga0237819_00264_17194_17805 203
258 3300041405 Ga0439438_000107 Ga0439438_000107_3980_4591 203
259 3300041405 Ga0439438_001162 Ga0439438_001162_2185_2808 203
260 3300041405 Ga0439438_013211 Ga0439438_013211_37_660 203
261 3300041407 Ga0439447_000006 Ga0439447_000006_28482_29105 203
262 3300041407 Ga0439447_000729 Ga0439447_000729_4924_5565 203
263 3300041407 Ga0439447_001053 Ga0439447_001053_4107_4730 203
264 3300041407 Ga0439447_002349 Ga0439447_002349_58_681 203
265 3300041407 Ga0439447_004538 Ga0439447_004538_1894_2517 203
266 3300041411 Ga0439466_0000036 Ga0439466_0000036_27523_28146 203
267 3300041411 Ga0439466_0000121 Ga0439466_0000121_5893_6534 203
268 3300041411 Ga0439466_0000224 Ga0439466_0000224_6907_7530 203
269 3300041411 Ga0439466_0002829 Ga0439466_0002829_4938_5561 203
270 3300041411 Ga0439466_0060441 Ga0439466_0060441_563_1186 203
271 3300042006 Ga0439432_000070 Ga0439432_000070_24600_25223 203
272 3300042006 Ga0439432_004533 Ga0439432_004533_1378_2001 203
273 3300042009 Ga0439451_000026 Ga0439451_000026_26772_27383 203
274 3300042010 Ga0439452_000241 Ga0439452_000241_27758_28369 203
275 3300042010 Ga0439452_000572 Ga0439452_000572_10190_10813 203
276 3300042013 Ga0439456_000035 Ga0439456_000035_29238_29849 203
277 3300042013 Ga0439456_010855 Ga0439456_010855_650_1273 203
278 3300042016 Ga0439463_000180 Ga0439463_000180_14231_14842 203
279 3300042142 Ga0450905_000001 Ga0450905_000001_24626_25249 203
280 3300042146 Ga0450907_000015 Ga0450907_000015_68252_68875 203
281 3300042532 Ga0450893_0003793 Ga0450893_0003793_128_739 203
282 3300042993 Ga0439440_0002233 Ga0439440_0002233_431_1054 203
283 3300046452 Ga0495617_008850 Ga0495617_008850_1499_2110 203
284 3300046452 Ga0495617_014041 Ga0495617_014041_1284_1907 203
285 3300046453 Ga0495627_000244 Ga0495627_000244_30470_31081 203
286 3300046453 Ga0495627_002243 Ga0495627_002243_1948_2559 203
287 3300046453 Ga0495627_019677 Ga0495627_019677_1119_1739 203
288 3300046454 Ga0495592_0000277 Ga0495592_0000277_14913_15536 203
289 3300046457 Ga0495590_0018216 Ga0495590_0018216_64_675 203
290 3300046458 Ga0495591_002948 Ga0495591_002948_998_1618 203
291 3300046459 Ga0495629_0188327 Ga0495629_0188327_755_1378 203
292 3300046460 Ga0495638_0000372 Ga0495638_0000372_29049_29660 203
293 3300046460 Ga0495638_0002771 Ga0495638_0002771_4103_4726 203
294 3300046460 Ga0495638_0004999 Ga0495638_0004999_5097_5708 203
295 3300046460 Ga0495638_0422956 Ga0495638_0422956_11_634 203
296 3300046471 Ga0495650_0001331 Ga0495650_0001331_3248_3871 203
297 3300046474 Ga0495605_0000020 Ga0495605_0000020_164919_165542 203
298 3300046474 Ga0495605_0005300 Ga0495605_0005300_6780_7403 203
299 3300046474 Ga0495605_0025274 Ga0495605_0025274_1352_1978 203
300 3300046491 Ga0495584_0006183 Ga0495584_0006183_2669_3292 203
301 3300046491 Ga0495584_0012524 Ga0495584_0012524_3667_4278 203
302 3300046491 Ga0495584_0030978 Ga0495584_0030978_563_1174 203
303 3300046492 Ga0495585_0000182 Ga0495585_0000182_31585_32208 203
304 3300046492 Ga0495585_0006409 Ga0495585_0006409_6123_6746 203
305 3300046492 Ga0495585_0006454 Ga0495585_0006454_6021_6632 203
306 3300046501 Ga0495607_0000255 Ga0495607_0000255_42392_43015 203
307 3300046501 Ga0495607_0006076 Ga0495607_0006076_6696_7307 203
308 3300046501 Ga0495607_0043749 Ga0495607_0043749_740_1363 203
309 3300046501 Ga0495607_0152029 Ga0495607_0152029_354_992 203
310 3300046506 Ga0495583_0000393 Ga0495583_0000393_33214_33825 203
311 3300046507 Ga0495606_0055011 Ga0495606_0055011_1526_2152 203
312 3300046512 Ga0495610_0049486 Ga0495610_0049486_1043_1654 203
313 3300046513 Ga0495616_0002982 Ga0495616_0002982_6805_7416 203
314 3300046513 Ga0495616_0055930 Ga0495616_0055930_1252_1863 203
315 3300046518 Ga0495631_0000905 Ga0495631_0000905_7978_8589 203
316 3300046519 Ga0495632_0000266 Ga0495632_0000266_23541_24152 203
317 3300046519 Ga0495632_0003623 Ga0495632_0003623_1525_2148 203
318 3300046519 Ga0495632_0020008 Ga0495632_0020008_2061_2672 203
319 3300046519 Ga0495632_0144890 Ga0495632_0144890_30_641 203
320 3300046520 Ga0495637_0000136 Ga0495637_0000136_31171_31782 203
321 3300046520 Ga0495637_0000190 Ga0495637_0000190_18097_18708 203
322 3300046520 Ga0495637_0061160 Ga0495637_0061160_16_639 203
323 3300046522 Ga0495643_0000381 Ga0495643_0000381_27929_28552 203
324 3300046522 Ga0495643_0000803 Ga0495643_0000803_19877_20500 203
325 3300046522 Ga0495643_0003752 Ga0495643_0003752_6295_6906 203
326 3300046522 Ga0495643_0121213 Ga0495643_0121213_236_859 203
327 3300046523 Ga0495644_0002283 Ga0495644_0002283_5092_5703 203
328 3300046523 Ga0495644_0003260 Ga0495644_0003260_5259_5882 203
329 3300046523 Ga0495644_0011025 Ga0495644_0011025_2767_3390 203
330 3300046524 Ga0495648_0000284 Ga0495648_0000284_27829_28452 203
331 3300046524 Ga0495648_0000927 Ga0495648_0000927_26961_27587 203
332 3300046524 Ga0495648_0007289 Ga0495648_0007289_6434_7045 203
333 3300046524 Ga0495648_0118414 Ga0495648_0118414_424_1047 203
334 3300046526 Ga0495666_0000028 Ga0495666_0000028_22551_23162 203
335 3300046526 Ga0495666_0004608 Ga0495666_0004608_6305_6928 203
336 3300046528 Ga0495642_0000042 Ga0495642_0000042_32687_33298 203
337 3300046530 Ga0495654_0000229 Ga0495654_0000229_33931_34554 203
338 3300046530 Ga0495654_0001174 Ga0495654_0001174_2567_3217 203
339 3300046530 Ga0495654_0001837 Ga0495654_0001837_8783_9406 203
340 3300046530 Ga0495654_0007965 Ga0495654_0007965_2103_2714 203
341 3300046530 Ga0495654_0014311 Ga0495654_0014311_1104_1727 203
342 3300046530 Ga0495654_0034209 Ga0495654_0034209_264_887 203
343 3300046530 Ga0495654_0073018 Ga0495654_0073018_72_695 203
344 3300046538 Ga0495609_0000205 Ga0495609_0000205_29120_29743 203
345 3300046538 Ga0495609_0000301 Ga0495609_0000301_24093_24716 203
346 3300046538 Ga0495609_0028437 Ga0495609_0028437_1357_1968 203
347 3300046542 Ga0495597_0017312 Ga0495597_0017312_1598_2221 203
348 3300046542 Ga0495597_0050207 Ga0495597_0050207_401_1099 203
349 3300046542 Ga0495597_0146438 Ga0495597_0146438_68_691 203
350 3300046557 Ga0495622_0000728 Ga0495622_0000728_4690_5313 203
351 3300046616 Ga0495668_0000594 Ga0495668_0000594_38056_38679 203
352 3300046616 Ga0495668_0046646 Ga0495668_0046646_1417_2028 203
353 3300046660 Ga0495625_0001201 Ga0495625_0001201_26126_26737 203
354 3300046660 Ga0495625_0001690 Ga0495625_0001690_22223_22849 203
355 3300046660 Ga0495625_0012605 Ga0495625_0012605_814_1437 203
356 3300046660 Ga0495625_0013123 Ga0495625_0013123_2089_2700 203
357 3300046660 Ga0495625_0028269 Ga0495625_0028269_2833_3453 203
358 3300046660 Ga0495625_0048965 Ga0495625_0048965_952_1575 203
359 3300046660 Ga0495625_0188622 Ga0495625_0188622_703_1326 203
360 3300046664 Ga0495659_0000099 Ga0495659_0000099_24262_24873 203
361 3300046665 Ga0495661_0002441 Ga0495661_0002441_9549_10211 203
362 3300046684 Ga0495669_0004536 Ga0495669_0004536_4297_4908 203
363 3300046684 Ga0495669_0017971 Ga0495669_0017971_1329_1952 203
364 3300046689 Ga0495613_0000182 Ga0495613_0000182_26123_26734 203
365 3300046690 Ga0495624_0102066 Ga0495624_0102066_1075_1686 203
366 3300046691 Ga0495670_0002456 Ga0495670_0002456_2912_3538 203
367 3300046691 Ga0495670_0010289 Ga0495670_0010289_1034_1645 203
368 3300046691 Ga0495670_0076017 Ga0495670_0076017_12_635 203
369 3300046691 Ga0495670_0245842 Ga0495670_0245842_320_943 203
370 3300046692 Ga0495671_0000284 Ga0495671_0000284_35863_36501 203
371 3300046692 Ga0495671_0005120 Ga0495671_0005120_2188_2799 203
372 3300046692 Ga0495671_0090758 Ga0495671_0090758_367_990 203
373 3300046694 Ga0495649_0000310 Ga0495649_0000310_17696_18319 203
374 3300046694 Ga0495649_0014342 Ga0495649_0014342_521_1132 203
375 3300046694 Ga0495649_0019584 Ga0495649_0019584_218_841 203
376 3300046694 Ga0495649_0191557 Ga0495649_0191557_21_632 203
377 3300046694 Ga0495649_0193041 Ga0495649_0193041_280_903 203
378 3300046794 Ga0495589_0000520 Ga0495589_0000520_24503_25114 203
379 3300046794 Ga0495589_0000902 Ga0495589_0000902_7375_7986 203
380 3300046809 Ga0495600_0006383 Ga0495600_0006383_6332_6955 203
381 3300046810 Ga0495660_0012348 Ga0495660_0012348_4109_4732 203
382 3300046810 Ga0495660_0012823 Ga0495660_0012823_3028_3639 203
383 3300047320 Ga0495672_0000268 Ga0495672_0000268_42433_43056 203
384 3300047320 Ga0495672_0000318 Ga0495672_0000318_44443_45066 203
385 3300047320 Ga0495672_0113243 Ga0495672_0113243_713_1336 203
386 3300047322 Ga0495680_0003372 Ga0495680_0003372_11983_12594 203
387 3300047322 Ga0495680_0007255 Ga0495680_0007255_5014_5637 203
388 3300047322 Ga0495680_0019917 Ga0495680_0019917_3217_3840 203
389 3300047322 Ga0495680_0315012 Ga0495680_0315012_319_930 203
390 3300047323 Ga0495683_0001971 Ga0495683_0001971_12036_12647 203
391 3300047445 Ga0495677_0000879 Ga0495677_0000879_5517_6128 203
392 3300047447 Ga0495685_002726 Ga0495685_002726_1447_2058 203
393 3300047469 Ga0495673_0000276 Ga0495673_0000276_43585_44208 203
394 3300047469 Ga0495673_0000281 Ga0495673_0000281_62117_62728 203
395 3300047469 Ga0495673_0000732 Ga0495673_0000732_2415_3038 203
396 3300047469 Ga0495673_0000764 Ga0495673_0000764_26961_27587 203
397 3300047469 Ga0495673_0002249 Ga0495673_0002249_5297_5920 203
398 3300047470 Ga0495681_0000097 Ga0495681_0000097_27060_27671 203
399 3300047470 Ga0495681_0000367 Ga0495681_0000367_26131_26754 203
400 3300047470 Ga0495681_0002355 Ga0495681_0002355_9567_10190 203
401 3300047470 Ga0495681_0005913 Ga0495681_0005913_5230_5841 203
402 3300047470 Ga0495681_0043004 Ga0495681_0043004_663_1274 203
403 3300047472 Ga0495686_0000546 Ga0495686_0000546_52599_53222 203
404 3300047472 Ga0495686_0136709 Ga0495686_0136709_583_1194 203
405 3300047673 Ga0495593_0000260 Ga0495593_0000260_23578_24201 203
406 3300047673 Ga0495593_0004162 Ga0495593_0004162_1851_2462 203
407 3300048088 Ga0495602_0010283 Ga0495602_0010283_1810_2433 203
408 3300048091 Ga0495626_0000045 Ga0495626_0000045_135566_136192 203
409 3300048091 Ga0495626_0000442 Ga0495626_0000442_23838_24461 203
410 3300048091 Ga0495626_0025108 Ga0495626_0025108_1034_1645 203
411 3300048091 Ga0495626_0028320 Ga0495626_0028320_982_1605 203
412 3300048920 Ga0496117_0002888 Ga0496117_0002888_20143_20766 203
413 3300048920 Ga0496117_0006564 Ga0496117_0006564_4997_5620 203
414 3300048920 Ga0496117_0073769 Ga0496117_0073769_104_727 203
415 3300048921 Ga0496118_0024269 Ga0496118_0024269_4559_5182 203
416 3300048921 Ga0496118_0127374 Ga0496118_0127374_421_1044 203
417 3300048923 Ga0496120_0112741 Ga0496120_0112741_76_687 203
418 3300048924 Ga0496121_0004216 Ga0496121_0004216_14871_15494 203
419 3300048924 Ga0496121_0006691 Ga0496121_0006691_2016_2627 203
420 3300048925 Ga0496122_0001523 Ga0496122_0001523_30375_30986 203
421 3300048926 Ga0496123_0000683 Ga0496123_0000683_30424_31035 203
422 3300048927 Ga0496124_0054262 Ga0496124_0054262_1792_2415 203
423 3300048927 Ga0496124_0177553 Ga0496124_0177553_616_1239 203
424 3300048928 Ga0496125_0001262 Ga0496125_0001262_37009_37632 203
425 3300048928 Ga0496125_0001332 Ga0496125_0001332_20615_21247 203
426 3300048928 Ga0496125_0004139 Ga0496125_0004139_14883_15506 203
427 3300048928 Ga0496125_0004993 Ga0496125_0004993_13551_14174 203
428 3300048928 Ga0496125_0057541 Ga0496125_0057541_650_1273 203
429 3300049459 Ga0495678_023354 Ga0495678_023354_250_861 203
430 3300049460 Ga0495682_0000143 Ga0495682_0000143_34115_34738 203
431 3300049460 Ga0495682_0001702 Ga0495682_0001702_9599_10222 203
432 3300049460 Ga0495682_0006549 Ga0495682_0006549_58_681 203
433 3300049460 Ga0495682_0015208 Ga0495682_0015208_1034_1645 203
434 3300049460 Ga0495682_0021811 Ga0495682_0021811_842_1465 203
435 3300049460 Ga0495682_0029815 Ga0495682_0029815_769_1395 203
436 3300049460 Ga0495682_0031475 Ga0495682_0031475_572_1195 203
437 3300049669 Ga0501235_036049 Ga0501235_036049_459_1070 203
438 3300049682 Ga0501252_006015 Ga0501252_006015_214_825 203
439 3300053111 Ga0500572_000011 Ga0500572_000011_36535_37158 203
440 iso_pu_bacteria 2511231011 2511296074 203
441 iso_pu_bacteria 2554235341 2555670757 203
442 iso_pu_bacteria 2599185309 2599982303 203
443 iso_pu_bacteria 2619619299 2621299044 203
444 iso_pu_bacteria 2643221633 2644185702 203
445 iso_pu_bacteria 2713897149 2715759433 203
446 iso_pu_bacteria 2721755607 2723249227 203
447 iso_pu_bacteria 2784132063 2784264740 203
448 iso_pu_bacteria 2791355520 2794597459 203
449 iso_pu_bacteria 2808606376 2808927069 203
450 iso_pu_bacteria 2808606377 2808927875 203
451 iso_pu_bacteria 2808606380 2808949188 203
452 iso_pu_bacteria 2808606381 2808949585 203
453 iso_pu_bacteria 2816332298 2817492229 203
454 iso_pu_bacteria 2842826826 2842830384 203
455 iso_pu_bacteria 2842854478 2842854843 203
456 iso_pu_bacteria 2852612431 2852614771 203
457 iso_pu_bacteria 2852667396 2852667490 203
458 iso_pu_bacteria 2880230671 2880233220 203
459 iso_pu_bacteria 2904518522 2904522051 203
460 iso_pu_bacteria 2917070673 2917074594 203
461 iso_pu_bacteria 2919487758 2919491607 203
462 iso_pu_bacteria 2919697872 2919703067 203
463 iso_pu_bacteria 2974289157 2974291175 203
464 iso_pu_bacteria 2998139840 2998142015 203
465 iso_pu_bacteria 3007511990 3007513479 203
466 iso_pu_bacteria 3007614139 3007616081 203
467 iso_pu_bacteria 3007866637 3007869542 203
468 iso_pu_bacteria 8054347763 8054348683 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18894

PhageMetallopep

Putative phage metallopeptidase

55

210

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3in9-assembly1.cif.gz_A crystal structure of heparin lyase i complexed with disaccharide heparin 0.8609 130 153
3ikw-assembly1.cif.gz_A structure of heparinase i from bacteroides thetaiotaomicron 0.7145 130 152
3ina-assembly1.cif.gz_A crystal structure of heparin lyase i h151a mutant complexed with a dodecasaccharide heparin 0.7035 123 152
3ilr-assembly1.cif.gz_A structure of heparinase i from bacteroides thetaiotaomicron in complex with tetrasaccharide product 0.6754 130 152
6ut3-assembly1.cif.gz_B x-ray structure of thermococcus gammatolerans mcrb aaa+ domain hexamer in p21 symmetry 0.4652 129 167
ID Description Score Start End Superfamily
3inaA02 Alpha Beta;Roll;duf1285 like fold; 0.8127 130 152 3.10.540.20
af_Q59076_58_147_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.772 101 129 3.30.2010.10
af_A0A1D6I433_58_177_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7528 46 129 3.30.2010.10
af_P25894_60_145_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7302 103 129 3.30.2010.10
af_A0A1D6JTF3_15_142_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7059 52 129 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A3A4A4V1-F1-model_v4 deleted 0.9748 2 129
AF-A0A3M4AVS5-F1-model_v4 Putative phage metallopeptidase domain-containing protein 0.9737 2 129
AF-A0A351NIN4-F1-model_v4 deleted 0.965 2 155
AF-A0A3A8FJT5-F1-model_v4 Putative phage metallopeptidase domain-containing protein 0.9253 1 113
AF-A0A6I4ILQ0-F1-model_v4 Putative phage metallopeptidase domain-containing protein 0.9234 1 154

Feature Viewer

pLDDT pTM Quality
82.25 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map