F450106

General Info

Members Datasets Scaffolds Average Seq Length
468 226 936 183

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0849504|Ga0495630_0849504_61_633
Length 190
Sequence MATAAGPNQRKSKEVRREEILDAALEEFAERGYHGASTEDIARRAGISQPYVFRLFGTKKELFRAVAVRCLRETLEMFQRAAEGKRGGEALEAMGRAYVERLASDPVRLRAQMQAYVACDDPEICEGVRDGYGDLVAYVERVSGVPPAEVMRFFAKGMLLNVFASMGQFGESADEWAVRLLQGFQEEAPS

Samples

Sample ID Description Type Environment
1 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
117 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
118 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
119 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
134 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
135 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
136 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
137 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
138 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
139 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
140 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
141 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
142 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
143 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
183 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.86
Metatranscriptomes 2.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.74
Rhizosphere 84.83
Stem 0
Stem Tuber 0
Unclassified 3.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495630_0849504 3300046517 Unclassified 696
2 Ga0070658_10487522 3300005327 Bacteria 1064
3 Ga0070683_100134305 3300005329 Bacteria 2342
4 Ga0070670_100114004 3300005331 Bacteria 2330
5 Ga0070680_100013080 3300005336 Bacteria 6460
6 Ga0070680_100649234 3300005336 Bacteria 907
7 Ga0070680_100837949 3300005336 Bacteria 793
8 Ga0070682_100041267 3300005337 Bacteria 2844
9 Ga0070660_100009695 3300005339 Bacteria 6783
10 Ga0070660_100013350 3300005339 Bacteria 5889
11 Ga0070668_100243815 3300005347 Bacteria 1489
12 Ga0070673_100135245 3300005364 Bacteria 2074
13 Ga0070659_100012678 3300005366 Bacteria 6255
14 Ga0070709_10068838 3300005434 Bacteria 2278
15 Ga0070709_10512768 3300005434 Unclassified 913
16 Ga0070714_100020586 3300005435 Bacteria 5390
17 Ga0070714_100048922 3300005435 Bacteria 3598
18 Ga0070714_101183926 3300005435 Bacteria 745
19 Ga0070713_100053004 3300005436 Bacteria 3360
20 Ga0070713_100212881 3300005436 Bacteria 1750
21 Ga0070713_100407604 3300005436 Bacteria 1270
22 Ga0070710_10505766 3300005437 Bacteria 828
23 Ga0070701_10032571 3300005438 Bacteria 2597
24 Ga0070711_100005647 3300005439 Bacteria 7491
25 Ga0070711_100013331 3300005439 Bacteria 5160
26 Ga0070711_100139365 3300005439 Bacteria 1816
27 Ga0070711_100177208 3300005439 Bacteria 1629
28 Ga0070705_100016959 3300005440 Bacteria 3794
29 Ga0070705_100068055 3300005440 Bacteria 2142
30 Ga0070705_100090878 3300005440 Bacteria 1901
31 Ga0070700_100376887 3300005441 Bacteria 1060
32 Ga0070694_100023812 3300005444 Bacteria 3944
33 Ga0070694_100140814 3300005444 Bacteria 1752
34 Ga0070708_100033403 3300005445 Bacteria 4470
35 Ga0070708_101295479 3300005445 Bacteria 681
36 Ga0070678_100385491 3300005456 Bacteria 1214
37 Ga0070662_100147454 3300005457 Bacteria 1829
38 Ga0070681_10545823 3300005458 Bacteria 1073
39 Ga0070681_10678831 3300005458 Bacteria 945
40 Ga0070706_100310079 3300005467 Bacteria 1472
41 Ga0070706_100471441 3300005467 Bacteria 1168
42 Ga0070706_100677521 3300005467 Bacteria 957
43 Ga0070698_100027582 3300005471 Bacteria 5903
44 Ga0070698_100056415 3300005471 Bacteria 3980
45 Ga0070698_100132915 3300005471 Bacteria 2443
46 Ga0070699_100168755 3300005518 Bacteria 1939
47 Ga0070699_100330122 3300005518 Bacteria 1372
48 Ga0070679_100026415 3300005530 Bacteria 5704
49 Ga0070679_100156859 3300005530 Bacteria 2251
50 Ga0070684_100069390 3300005535 Bacteria 3100
51 Ga0070684_101183544 3300005535 Unclassified 719
52 Ga0070697_100041534 3300005536 Bacteria 3723
53 Ga0070697_100296386 3300005536 Bacteria 1390
54 Ga0070695_100000001 3300005545 Bacteria 150757
55 Ga0070695_100140699 3300005545 Bacteria 1673
56 Ga0070696_100101792 3300005546 Bacteria 2059
57 Ga0070696_100220665 3300005546 Bacteria 1422
58 Ga0070696_100436587 3300005546 Bacteria 1031
59 Ga0070704_100059382 3300005549 Bacteria 2728
60 Ga0070704_100062333 3300005549 Bacteria 2672
61 Ga0068855_100030394 3300005563 Bacteria 6461
62 Ga0068855_100125303 3300005563 Bacteria 2937
63 Ga0068855_100147728 3300005563 Bacteria 2674
64 Ga0068855_101599533 3300005563 Bacteria 667
65 Ga0068857_100212889 3300005577 Bacteria 1764
66 Ga0068857_101025944 3300005577 Bacteria 795
67 Ga0068856_100121010 3300005614 Bacteria 2619
68 Ga0070702_100057485 3300005615 Bacteria 2250
69 Ga0070702_100377601 3300005615 Bacteria 1007
70 Ga0068852_100436090 3300005616 Bacteria 1294
71 Ga0068866_10473790 3300005718 Bacteria 823
72 Ga0068860_100785814 3300005843 Bacteria 965
73 Ga0068862_100251150 3300005844 Bacteria 1612
74 Ga0081455_10369857 3300005937 Bacteria 1005
75 Ga0081455_10408077 3300005937 Bacteria 941
76 Ga0081455_10725650 3300005937 Bacteria 631
77 Ga0070717_10282071 3300006028 Bacteria 1474
78 Ga0070717_10287568 3300006028 Bacteria 1459
79 Ga0070717_10487861 3300006028 Unclassified 1113
80 Ga0070715_10019205 3300006163 Bacteria 2617
81 Ga0070716_100352345 3300006173 Bacteria 1042
82 Ga0070716_100640567 3300006173 Unclassified 805
83 Ga0070712_100003278 3300006175 Bacteria 9957
84 Ga0070712_100009699 3300006175 Bacteria 6068
85 Ga0070712_100054129 3300006175 Bacteria 2804
86 Ga0070712_100511903 3300006175 Bacteria 1007
87 Ga0075433_10055643 3300006852 Bacteria 3454
88 Ga0075434_100077282 3300006871 Bacteria 3324
89 Ga0075434_100287173 3300006871 Bacteria 1665
90 Ga0068865_100650898 3300006881 Bacteria 895
91 Ga0075436_100025108 3300006914 Bacteria 4098
92 Ga0075435_100054047 3300007076 Bacteria 3240
93 Ga0105240_10023654 3300009093 Bacteria 8116
94 Ga0105240_10067367 3300009093 Bacteria 4438
95 Ga0105240_10071667 3300009093 Bacteria 4284
96 Ga0111539_10215755 3300009094 Bacteria 2235
97 Ga0111539_10339690 3300009094 Bacteria 1748
98 Ga0111539_10344156 3300009094 Bacteria 1736
99 Ga0105245_10438348 3300009098 Bacteria 1313
100 Ga0105247_10370081 3300009101 Bacteria 1013
101 Ga0114129_10008934 3300009147 Bacteria 14276
102 Ga0114129_10045844 3300009147 Bacteria 6145
103 Ga0114129_10261856 3300009147 Bacteria 2317
104 Ga0114129_11247385 3300009147 Bacteria 924
105 Ga0114129_12222393 3300009147 Unclassified 660
106 Ga0105241_10211216 3300009174 Bacteria 1626
107 Ga0105242_10157090 3300009176 Bacteria 1988
108 Ga0105242_10701557 3300009176 Bacteria 990
109 Ga0105242_10960661 3300009176 Bacteria 859
110 Ga0105248_10839659 3300009177 Bacteria 1037
111 Ga0105237_10013009 3300009545 Bacteria 8739
112 Ga0105237_10936767 3300009545 Bacteria 873
113 Ga0105237_11058191 3300009545 Bacteria 818
114 Ga0105238_11175608 3300009551 Bacteria 791
115 Ga0105249_10056095 3300009553 Bacteria 3607
116 Ga0105249_10142699 3300009553 Bacteria 2298
117 Ga0105249_10165469 3300009553 Bacteria 2140
118 Ga0105239_10118663 3300010375 Bacteria 2936
119 Ga0105239_10644354 3300010375 Bacteria 1210
120 Ga0157338_1003073 3300012515 Bacteria 1357
121 Ga0157373_10187326 3300013100 Bacteria 1458
122 Ga0157370_10055537 3300013104 Bacteria 3772
123 Ga0157370_10059822 3300013104 Bacteria 3619
124 Ga0157369_10012518 3300013105 Bacteria 9624
125 Ga0157369_10028865 3300013105 Bacteria 6136
126 Ga0157369_10325607 3300013105 Bacteria 1597
127 Ga0157369_10491856 3300013105 Bacteria 1269
128 Ga0157369_10795655 3300013105 Bacteria 972
129 Ga0157369_11034707 3300013105 Bacteria 840
130 Ga0157374_10478863 3300013296 Bacteria 1248
131 Ga0157378_10181872 3300013297 Bacteria 1978
132 Ga0157378_11015458 3300013297 Bacteria 864
133 Ga0157372_10178128 3300013307 Bacteria 2461
134 Ga0157372_11019670 3300013307 Bacteria 958
135 Ga0157375_11210019 3300013308 Bacteria 886
136 Ga0163163_11570905 3300014325 Bacteria 719
137 Ga0157377_10149532 3300014745 Bacteria 1443
138 Ga0157376_10798071 3300014969 Bacteria 956
139 Ga0163161_10262073 3300017792 Bacteria 1350
140 Ga0197907_11426691 3300020069 Bacteria 929
141 Ga0206356_10501869 3300020070 Bacteria 3338
142 Ga0206354_10555859 3300020081 Bacteria 3708
143 Ga0206354_11037468 3300020081 Bacteria 2051
144 Ga0206354_11655213 3300020081 Bacteria 3123
145 Ga0206353_10174987 3300020082 Bacteria 2448
146 Ga0206353_10424721 3300020082 Bacteria 1035
147 Ga0206353_11037581 3300020082 Bacteria 1616
148 Ga0224712_10190124 3300022467 Bacteria 929
149 Ga0207653_10003260 3300025885 Bacteria 5122
150 Ga0207653_10161330 3300025885 Bacteria 830
151 Ga0207642_10283403 3300025899 Bacteria 954
152 Ga0207688_10012994 3300025901 Bacteria 4527
153 Ga0207685_10125999 3300025905 Bacteria 1131
154 Ga0207685_10402272 3300025905 Bacteria 702
155 Ga0207699_10162595 3300025906 Bacteria 1487
156 Ga0207699_10237417 3300025906 Bacteria 1251
157 Ga0207699_10254148 3300025906 Bacteria 1212
158 Ga0207705_10100781 3300025909 Bacteria 2124
159 Ga0207705_10692899 3300025909 Bacteria 792
160 Ga0207684_10520271 3300025910 Bacteria 1019
161 Ga0207684_10665286 3300025910 Bacteria 887
162 Ga0207654_10125376 3300025911 Bacteria 1618
163 Ga0207695_10054536 3300025913 Bacteria 4173
164 Ga0207695_10397491 3300025913 Bacteria 1263
165 Ga0207695_10528580 3300025913 Bacteria 1061
166 Ga0207693_10020359 3300025915 Bacteria 5277
167 Ga0207693_10024842 3300025915 Bacteria 4752
168 Ga0207693_10132123 3300025915 Bacteria 1962
169 Ga0207693_10460011 3300025915 Bacteria 994
170 Ga0207663_10001579 3300025916 Bacteria 10707
171 Ga0207663_10043891 3300025916 Bacteria 2741
172 Ga0207663_10100340 3300025916 Bacteria 1942
173 Ga0207660_10042604 3300025917 Bacteria 3187
174 Ga0207660_10297774 3300025917 Bacteria 1284
175 Ga0207660_10769859 3300025917 Bacteria 785
176 Ga0207657_10013988 3300025919 Bacteria 7851
177 Ga0207657_10433272 3300025919 Bacteria 1033
178 Ga0207657_10602014 3300025919 Bacteria 857
179 Ga0207649_10634396 3300025920 Bacteria 824
180 Ga0207652_10026010 3300025921 Bacteria 4871
181 Ga0207652_10091335 3300025921 Bacteria 2677
182 Ga0207652_10557847 3300025921 Bacteria 1029
183 Ga0207646_10193200 3300025922 Bacteria 1838
184 Ga0207650_10046691 3300025925 Bacteria 3190
185 Ga0207700_10000001 3300025928 Bacteria 1122509
186 Ga0207664_10519409 3300025929 Unclassified 1067
187 Ga0207664_10996017 3300025929 Bacteria 751
188 Ga0207690_10327795 3300025932 Bacteria 1205
189 Ga0207706_10097096 3300025933 Bacteria 2591
190 Ga0207686_10186858 3300025934 Bacteria 1474
191 Ga0207686_10992400 3300025934 Bacteria 681
192 Ga0207665_10003489 3300025939 Bacteria 10503
193 Ga0207665_10008218 3300025939 Bacteria 6891
194 Ga0207665_10011273 3300025939 Bacteria 5866
195 Ga0207691_10557038 3300025940 Bacteria 972
196 Ga0207661_10631114 3300025944 Bacteria 984
197 Ga0207667_10554453 3300025949 Bacteria 1162
198 Ga0207667_10573060 3300025949 Bacteria 1140
199 Ga0207712_10156107 3300025961 Bacteria 1768
200 Ga0207668_10103101 3300025972 Bacteria 2124
201 Ga0207677_10450430 3300026023 Bacteria 1103
202 Ga0207708_10585222 3300026075 Bacteria 944
203 Ga0207708_10617286 3300026075 Bacteria 920
204 Ga0207708_11311434 3300026075 Bacteria 634
205 Ga0207702_10014692 3300026078 Bacteria 6496
206 Ga0207702_10089173 3300026078 Bacteria 2697
207 Ga0207702_11295154 3300026078 Bacteria 723
208 Ga0207702_11733058 3300026078 Bacteria 617
209 Ga0207674_10112404 3300026116 Bacteria 2697
210 Ga0207674_10781244 3300026116 Unclassified 922
211 Ga0207683_10399035 3300026121 Bacteria 1265
212 Ga0207698_10826295 3300026142 Bacteria 930
213 Ga0207428_10045206 3300027907 Bacteria 3548
214 Ga0268265_10506835 3300028380 Bacteria 1138
215 Ga0265319_1008972 3300028563 Bacteria 4319
216 Ga0265334_10020062 3300028573 Bacteria 2740
217 Ga0265318_10003962 3300028577 Bacteria 7297
218 Ga0265322_10018392 3300028654 Bacteria 2009
219 Ga0265338_10114807 3300028800 Bacteria 2160
220 Ga0265338_10119009 3300028800 Bacteria 2109
221 Ga0265338_10232779 3300028800 Bacteria 1369
222 Ga0265330_10018603 3300031235 Bacteria 3190
223 Ga0265332_10029799 3300031238 Bacteria 2384
224 Ga0265325_10013617 3300031241 Bacteria 4623
225 Ga0265329_10014676 3300031242 Bacteria 2759
226 Ga0265340_10039225 3300031247 Bacteria 2338
227 Ga0265339_10047111 3300031249 Bacteria 2367
228 Ga0265331_10032273 3300031250 Bacteria 2596
229 Ga0265327_10037076 3300031251 Bacteria 2673
230 Ga0265327_10294404 3300031251 Bacteria 715
231 Ga0265316_10078471 3300031344 Bacteria 2534
232 Ga0265316_10230583 3300031344 Bacteria 1364
233 Ga0265313_10014875 3300031595 Bacteria 4568
234 Ga0265342_10066081 3300031712 Bacteria 2118
235 Ga0307409_101429789 3300031995 Bacteria 718
236 Ga0373930_0063335 3300034816 Bacteria 829
237 Ga0373958_0005279 3300034819 Bacteria 1956
238 Ga0373959_0003729 3300034820 Bacteria 2438
239 Ga0373928_0002149 3300035084 Bacteria 3845
240 Ga0373929_0001772 3300035085 Bacteria 4048
241 Ga0373949_0060661 3300035090 Bacteria 972
242 Ga0373951_0002901 3300035091 Bacteria 4263
243 Ga0373932_0035024 3300035112 Bacteria 1417
244 Ga0373939_0001328 3300035114 Bacteria 6007
245 Ga0373957_0149424 3300035120 Bacteria 958
246 Ga0373942_0133692 3300035207 Bacteria 784
247 Ga0373931_0008560 3300035691 Bacteria 4856
248 Ga0373931_0720676 3300035691 Unclassified 660
249 Ga0373937_0002057 3300036401 Bacteria 16811
250 Ga0373937_0330165 3300036401 Bacteria 1443
251 Ga0373925_0608965 3300037068 Bacteria 900
252 Ga0395899_0006902 3300037312 Bacteria 8793
253 Ga0395899_0158591 3300037312 Bacteria 1600
254 Ga0395899_0262043 3300037312 Bacteria 1182
255 Ga0395900_0017968 3300037418 Bacteria 7219
256 Ga0395900_0051279 3300037418 Bacteria 4251
257 Ga0395900_0186660 3300037418 Bacteria 2104
258 Ga0395900_0188539 3300037418 Bacteria 2093
259 Ga0395900_0226959 3300037418 Bacteria 1880
260 Ga0395900_0516650 3300037418 Bacteria 1143
261 Ga0395900_1299551 3300037418 Bacteria 641
262 Ga0395898_0018503 3300037466 Bacteria 7101
263 Ga0395898_0027293 3300037466 Bacteria 5734
264 Ga0395905_0069614 3300037471 Bacteria 3296
265 Ga0395905_0136572 3300037471 Bacteria 2307
266 Ga0395901_0003036 3300038443 Bacteria 16914
267 Ga0395901_0009979 3300038443 Bacteria 9623
268 Ga0395901_0073376 3300038443 Bacteria 3569
269 Ga0395901_0126416 3300038443 Bacteria 2686
270 Ga0395901_0139789 3300038443 Bacteria 2545
271 Ga0395901_0179141 3300038443 Bacteria 2223
272 Ga0395901_0333265 3300038443 Bacteria 1568
273 Ga0395901_0514808 3300038443 Bacteria 1216
274 Ga0395901_0669370 3300038443 Bacteria 1039
275 Ga0242420_039583 3300038996 Bacteria 898
276 Ga0451853_1028052 3300041512 Bacteria 1196
277 Ga0451853_2934395 3300041512 Bacteria 861
278 Ga0439458_0160647 3300042157 Bacteria 605
279 Ga0466969_0047298 3300044656 Bacteria 2130
280 Ga0466965_0428669 3300044683 Unclassified 734
281 Ga0466966_0036842 3300044684 Bacteria 3157
282 Ga0466966_0058444 3300044684 Bacteria 2437
283 Ga0466961_0051955 3300044693 Bacteria 2616
284 Ga0466961_0089852 3300044693 Bacteria 1940
285 Ga0466963_0003715 3300044694 Bacteria 8777
286 Ga0466963_0005960 3300044694 Bacteria 7178
287 Ga0466963_0030578 3300044694 Bacteria 3476
288 Ga0466963_0179114 3300044694 Bacteria 1479
289 Ga0466963_0378985 3300044694 Bacteria 997
290 Ga0466963_0494654 3300044694 Bacteria 863
291 Ga0466963_1051415 3300044694 Bacteria 573
292 Ga0466964_0014568 3300044706 Bacteria 2990
293 Ga0466968_0002137 3300044735 Bacteria 7200
294 Ga0466970_0014920 3300044765 Bacteria 3994
295 Ga0466957_0005734 3300044842 Bacteria 6981
296 Ga0466957_0330586 3300044842 Bacteria 1030
297 Ga0466957_0553655 3300044842 Bacteria 802
298 Ga0466960_0131262 3300044901 Bacteria 1322
299 Ga0466959_0013995 3300045049 Bacteria 5824
300 Ga0466959_0410535 3300045049 Bacteria 920
301 Ga0451576_1780235 3300045051 Bacteria 637
302 Ga0466958_0005065 3300045836 Bacteria 7041
303 Ga0466958_0007955 3300045836 Bacteria 5859
304 Ga0466958_0137337 3300045836 Bacteria 1538
305 Ga0466967_0002741 3300045976 Bacteria 11144
306 Ga0466967_0073461 3300045976 Bacteria 3068
307 Ga0466967_0079439 3300045976 Bacteria 2957
308 Ga0466967_0082401 3300045976 Bacteria 2907
309 Ga0466967_0093946 3300045976 Bacteria 2730
310 Ga0466967_0117226 3300045976 Bacteria 2454
311 Ga0466967_0151734 3300045976 Bacteria 2166
312 Ga0466967_0718683 3300045976 Bacteria 990
313 Ga0466967_0789504 3300045976 Unclassified 942
314 Ga0466967_1145602 3300045976 Bacteria 775
315 Ga0466967_1207164 3300045976 Bacteria 754
316 Ga0466967_1561754 3300045976 Bacteria 657
317 Ga0495592_0002123 3300046454 Bacteria 13981
318 Ga0495629_0174614 3300046459 Bacteria 1490
319 Ga0495651_0000861 3300046462 Bacteria 23540
320 Ga0495651_0096564 3300046462 Bacteria 2208
321 Ga0495651_0135718 3300046462 Bacteria 1791
322 Ga0495653_0000781 3300046463 Bacteria 24458
323 Ga0495608_0001978 3300046511 Bacteria 14690
324 Ga0495608_0085582 3300046511 Bacteria 2043
325 Ga0495608_0160982 3300046511 Bacteria 1427
326 Ga0495618_0008354 3300046514 Bacteria 6267
327 Ga0495618_0212336 3300046514 Bacteria 1223
328 Ga0495628_0001898 3300046516 Bacteria 18971
329 Ga0495652_0001592 3300046529 Bacteria 24775
330 Ga0495652_0193157 3300046529 Bacteria 1552
331 Ga0495587_0000529 3300046536 Bacteria 26440
332 Ga0495587_0177186 3300046536 Bacteria 1210
333 Ga0495587_0467800 3300046536 Bacteria 698
334 Ga0495645_0000793 3300046543 Bacteria 21666
335 Ga0495667_0031376 3300046559 Bacteria 3567
336 Ga0495667_0085336 3300046559 Bacteria 2049
337 Ga0495667_0129800 3300046559 Bacteria 1626
338 Ga0495634_0013788 3300046642 Bacteria 5837
339 Ga0495635_0052576 3300046663 Bacteria 2806
340 Ga0495657_0002005 3300046675 Bacteria 17342
341 Ga0495657_0072987 3300046675 Bacteria 2237
342 Ga0495657_0095127 3300046675 Bacteria 1904
343 Ga0495657_0184401 3300046675 Bacteria 1279
344 Ga0495599_0000233 3300046678 Bacteria 34817
345 Ga0495623_0001047 3300046679 Bacteria 18688
346 Ga0495646_0002848 3300046680 Bacteria 10707
347 Ga0495613_0508823 3300046689 Bacteria 810
348 Ga0495600_0014687 3300046809 Bacteria 4937
349 Ga0495600_0053011 3300046809 Bacteria 2649
350 Ga0495604_0001532 3300047317 Bacteria 19030
351 Ga0495604_0181965 3300047317 Bacteria 1470
352 Ga0495680_0006075 3300047322 Bacteria 11280
353 Ga0495680_0085119 3300047322 Bacteria 2381
354 Ga0495680_0135343 3300047322 Bacteria 1807
355 Ga0495675_0000956 3300047444 Bacteria 17569
356 Ga0495675_0227049 3300047444 Bacteria 1128
357 Ga0495684_0031840 3300047471 Bacteria 4051
358 Ga0495684_0068788 3300047471 Bacteria 2692
359 Ga0495593_0049491 3300047673 Bacteria 2230
360 Ga0495602_0000080 3300048088 Bacteria 94171
361 Ga0496100_0025474 3300048903 Bacteria 3618
362 Ga0496100_0145874 3300048903 Bacteria 1683
363 Ga0496100_0285955 3300048903 Bacteria 1230
364 Ga0496100_0442739 3300048903 Bacteria 995
365 Ga0496100_0560935 3300048903 Bacteria 884
366 Ga0496101_0139396 3300048904 Bacteria 1847
367 Ga0496101_0189894 3300048904 Bacteria 1585
368 Ga0496101_0193325 3300048904 Unclassified 1571
369 Ga0496101_0360565 3300048904 Bacteria 1143
370 Ga0496101_0866992 3300048904 Bacteria 711
371 Ga0496101_1185810 3300048904 Bacteria 598
372 Ga0496102_0065664 3300048905 Bacteria 3326
373 Ga0496102_0312200 3300048905 Bacteria 1482
374 Ga0496102_0485620 3300048905 Bacteria 1157
375 Ga0496102_0487842 3300048905 Bacteria 1154
376 Ga0496102_0600629 3300048905 Bacteria 1023
377 Ga0496103_0023479 3300048906 Bacteria 3719
378 Ga0496103_0051286 3300048906 Bacteria 2553
379 Ga0496103_0402693 3300048906 Unclassified 879
380 Ga0496104_0001903 3300048907 Bacteria 18081
381 Ga0496104_0044920 3300048907 Bacteria 4152
382 Ga0496104_0224133 3300048907 Bacteria 1792
383 Ga0496104_0404953 3300048907 Bacteria 1276
384 Ga0496104_0839473 3300048907 Bacteria 824
385 Ga0496105_0000330 3300048908 Bacteria 31113
386 Ga0496105_0121554 3300048908 Bacteria 2153
387 Ga0496105_0137198 3300048908 Bacteria 2015
388 Ga0496105_0285120 3300048908 Bacteria 1331
389 Ga0496105_0731768 3300048908 Bacteria 757
390 Ga0496106_0004665 3300048909 Bacteria 10160
391 Ga0496106_0034637 3300048909 Bacteria 3772
392 Ga0496106_0174011 3300048909 Bacteria 1707
393 Ga0496106_0229390 3300048909 Bacteria 1482
394 Ga0496107_0001188 3300048910 Bacteria 15843
395 Ga0496107_0013176 3300048910 Bacteria 5777
396 Ga0496107_0028971 3300048910 Bacteria 3937
397 Ga0496107_0478294 3300048910 Bacteria 924
398 Ga0496108_0021818 3300048911 Bacteria 5263
399 Ga0496108_0085346 3300048911 Bacteria 2680
400 Ga0496109_0035963 3300048912 Bacteria 4470
401 Ga0496109_0200760 3300048912 Bacteria 1874
402 Ga0496109_0231085 3300048912 Bacteria 1740
403 Ga0496109_0231796 3300048912 Bacteria 1737
404 Ga0496109_0762669 3300048912 Bacteria 905
405 Ga0496109_1102339 3300048912 Unclassified 731
406 Ga0496110_0022747 3300048913 Bacteria 5326
407 Ga0496110_0075279 3300048913 Bacteria 2999
408 Ga0496110_0126725 3300048913 Bacteria 2304
409 Ga0496110_1126223 3300048913 Bacteria 693
410 Ga0496111_0012791 3300048914 Bacteria 5693
411 Ga0496111_0040027 3300048914 Bacteria 3362
412 Ga0496111_0060595 3300048914 Bacteria 2743
413 Ga0496111_0112572 3300048914 Bacteria 2005
414 Ga0496111_0322064 3300048914 Bacteria 1145
415 Ga0496112_0087021 3300048915 Bacteria 3091
416 Ga0496112_0093284 3300048915 Bacteria 2981
417 Ga0496112_0178098 3300048915 Bacteria 2090
418 Ga0496112_0418617 3300048915 Bacteria 1279
419 Ga0496112_0578836 3300048915 Bacteria 1055
420 Ga0496113_0749559 3300048916 Bacteria 777
421 Ga0496114_0002274 3300048917 Bacteria 14629
422 Ga0496114_0040290 3300048917 Bacteria 3867
423 Ga0496114_0096990 3300048917 Bacteria 2511
424 Ga0496114_0380613 3300048917 Bacteria 1249
425 Ga0496115_0055025 3300048918 Bacteria 3196
426 Ga0496115_0126314 3300048918 Bacteria 2107
427 Ga0496115_0467014 3300048918 Bacteria 1017
428 Ga0496115_0562225 3300048918 Bacteria 910
429 Ga0496115_0566297 3300048918 Bacteria 906
430 Ga0501047_0063509 3300049581 Bacteria 3562
431 Ga0501069_0071625 3300049585 Bacteria 1943
432 Ga0501069_0467860 3300049585 Bacteria 750
433 Ga0501070_0000124 3300049586 Bacteria 68928
434 Ga0501072_0626726 3300049588 Unclassified 847
435 Ga0501080_0511609 3300049742 Bacteria 1072
436 Ga0501044_0489571 3300049823 Bacteria 1132
437 Ga0501044_0501364 3300049823 Bacteria 1115
438 nmdc:mga05p37_108090_c1 3300050507 Bacteria 3422
439 nmdc:mga05p37_126665_c1 3300050507 Bacteria 3136
440 nmdc:mga05p37_24119_c1 3300050507 Bacteria 7389
441 nmdc:mga05p37_41134_c1 3300050507 Bacteria 5676
442 nmdc:mga06r32_289678_c1 3300050510 Bacteria 1624
443 nmdc:mga08y16_217080_c1 3300050511 Bacteria 1980
444 nmdc:mga08y16_401926_c1 3300050511 Bacteria 1402
445 nmdc:mga08y16_61212_c1 3300050511 Bacteria 3931
446 nmdc:mga08y16_998500_c1 3300050511 Bacteria 817
447 nmdc:mga0n895_103165_c1 3300050512 Bacteria 2863
448 nmdc:mga0n895_24305_c1 3300050512 Bacteria 5708
449 nmdc:mga0n895_425743_c1 3300050512 Bacteria 1342
450 nmdc:mga0n895_77546_c1 3300050512 Bacteria 3306
451 nmdc:mga0rr50_2405_c1 3300050513 Bacteria 10535
452 nmdc:mga0rr50_4841_c1 3300050513 Bacteria 7957
453 nmdc:mga08x19_181364_c1 3300050514 Bacteria 1438
454 nmdc:mga08x19_34794_c1 3300050514 Bacteria 3186
455 nmdc:mga08x19_673105_c1 3300050514 Bacteria 734
456 nmdc:mga0a205_23882_c1 3300050515 Bacteria 5803
457 nmdc:mga0a205_288931_c1 3300050515 Bacteria 1514
458 nmdc:mga0a205_311246_c1 3300050515 Bacteria 1447
459 Ga0495601_0000743 3300053077 Bacteria 17546
460 Ga0495601_0249553 3300053077 Bacteria 1159
461 Ga0495601_0660440 3300053077 Unclassified 669
462 Ga0495595_0035243 3300053084 Bacteria 2267
463 Ga0495595_0115685 3300053084 Bacteria 1303
464 Ga0495619_0000340 3300053085 Bacteria 32830
465 Ga0495619_0013597 3300053085 Bacteria 5128
466 Ga0495619_0019832 3300053085 Bacteria 4279
467 Ga0495619_0057738 3300053085 Bacteria 2575
468 Ga0587083_0116802 3300059505 Bacteria 684
469 Ga0495630_0849504
470 Ga0070658_10487522
471 Ga0070683_100134305
472 Ga0070670_100114004
473 Ga0070680_100013080
474 Ga0070680_100649234
475 Ga0070680_100837949
476 Ga0070682_100041267
477 Ga0070660_100009695
478 Ga0070660_100013350
479 Ga0070668_100243815
480 Ga0070673_100135245
481 Ga0070659_100012678
482 Ga0070709_10068838
483 Ga0070709_10512768
484 Ga0070714_100020586
485 Ga0070714_100048922
486 Ga0070714_101183926
487 Ga0070713_100053004
488 Ga0070713_100212881
489 Ga0070713_100407604
490 Ga0070710_10505766
491 Ga0070701_10032571
492 Ga0070711_100005647
493 Ga0070711_100013331
494 Ga0070711_100139365
495 Ga0070711_100177208
496 Ga0070705_100016959
497 Ga0070705_100068055
498 Ga0070705_100090878
499 Ga0070700_100376887
500 Ga0070694_100023812
501 Ga0070694_100140814
502 Ga0070708_100033403
503 Ga0070708_101295479
504 Ga0070678_100385491
505 Ga0070662_100147454
506 Ga0070681_10545823
507 Ga0070681_10678831
508 Ga0070706_100310079
509 Ga0070706_100471441
510 Ga0070706_100677521
511 Ga0070698_100027582
512 Ga0070698_100056415
513 Ga0070698_100132915
514 Ga0070699_100168755
515 Ga0070699_100330122
516 Ga0070679_100026415
517 Ga0070679_100156859
518 Ga0070684_100069390
519 Ga0070684_101183544
520 Ga0070697_100041534
521 Ga0070697_100296386
522 Ga0070695_100000001
523 Ga0070695_100140699
524 Ga0070696_100101792
525 Ga0070696_100220665
526 Ga0070696_100436587
527 Ga0070704_100059382
528 Ga0070704_100062333
529 Ga0068855_100030394
530 Ga0068855_100125303
531 Ga0068855_100147728
532 Ga0068855_101599533
533 Ga0068857_100212889
534 Ga0068857_101025944
535 Ga0068856_100121010
536 Ga0070702_100057485
537 Ga0070702_100377601
538 Ga0068852_100436090
539 Ga0068866_10473790
540 Ga0068860_100785814
541 Ga0068862_100251150
542 Ga0081455_10369857
543 Ga0081455_10408077
544 Ga0081455_10725650
545 Ga0070717_10282071
546 Ga0070717_10287568
547 Ga0070717_10487861
548 Ga0070715_10019205
549 Ga0070716_100352345
550 Ga0070716_100640567
551 Ga0070712_100003278
552 Ga0070712_100009699
553 Ga0070712_100054129
554 Ga0070712_100511903
555 Ga0075433_10055643
556 Ga0075434_100077282
557 Ga0075434_100287173
558 Ga0068865_100650898
559 Ga0075436_100025108
560 Ga0075435_100054047
561 Ga0105240_10023654
562 Ga0105240_10067367
563 Ga0105240_10071667
564 Ga0111539_10215755
565 Ga0111539_10339690
566 Ga0111539_10344156
567 Ga0105245_10438348
568 Ga0105247_10370081
569 Ga0114129_10008934
570 Ga0114129_10045844
571 Ga0114129_10261856
572 Ga0114129_11247385
573 Ga0114129_12222393
574 Ga0105241_10211216
575 Ga0105242_10157090
576 Ga0105242_10701557
577 Ga0105242_10960661
578 Ga0105248_10839659
579 Ga0105237_10013009
580 Ga0105237_10936767
581 Ga0105237_11058191
582 Ga0105238_11175608
583 Ga0105249_10056095
584 Ga0105249_10142699
585 Ga0105249_10165469
586 Ga0105239_10118663
587 Ga0105239_10644354
588 Ga0157338_1003073
589 Ga0157373_10187326
590 Ga0157370_10055537
591 Ga0157370_10059822
592 Ga0157369_10012518
593 Ga0157369_10028865
594 Ga0157369_10325607
595 Ga0157369_10491856
596 Ga0157369_10795655
597 Ga0157369_11034707
598 Ga0157374_10478863
599 Ga0157378_10181872
600 Ga0157378_11015458
601 Ga0157372_10178128
602 Ga0157372_11019670
603 Ga0157375_11210019
604 Ga0163163_11570905
605 Ga0157377_10149532
606 Ga0157376_10798071
607 Ga0163161_10262073
608 Ga0197907_11426691
609 Ga0206356_10501869
610 Ga0206354_10555859
611 Ga0206354_11037468
612 Ga0206354_11655213
613 Ga0206353_10174987
614 Ga0206353_10424721
615 Ga0206353_11037581
616 Ga0224712_10190124
617 Ga0207653_10003260
618 Ga0207653_10161330
619 Ga0207642_10283403
620 Ga0207688_10012994
621 Ga0207685_10125999
622 Ga0207685_10402272
623 Ga0207699_10162595
624 Ga0207699_10237417
625 Ga0207699_10254148
626 Ga0207705_10100781
627 Ga0207705_10692899
628 Ga0207684_10520271
629 Ga0207684_10665286
630 Ga0207654_10125376
631 Ga0207695_10054536
632 Ga0207695_10397491
633 Ga0207695_10528580
634 Ga0207693_10020359
635 Ga0207693_10024842
636 Ga0207693_10132123
637 Ga0207693_10460011
638 Ga0207663_10001579
639 Ga0207663_10043891
640 Ga0207663_10100340
641 Ga0207660_10042604
642 Ga0207660_10297774
643 Ga0207660_10769859
644 Ga0207657_10013988
645 Ga0207657_10433272
646 Ga0207657_10602014
647 Ga0207649_10634396
648 Ga0207652_10026010
649 Ga0207652_10091335
650 Ga0207652_10557847
651 Ga0207646_10193200
652 Ga0207650_10046691
653 Ga0207700_10000001
654 Ga0207664_10519409
655 Ga0207664_10996017
656 Ga0207690_10327795
657 Ga0207706_10097096
658 Ga0207686_10186858
659 Ga0207686_10992400
660 Ga0207665_10003489
661 Ga0207665_10008218
662 Ga0207665_10011273
663 Ga0207691_10557038
664 Ga0207661_10631114
665 Ga0207667_10554453
666 Ga0207667_10573060
667 Ga0207712_10156107
668 Ga0207668_10103101
669 Ga0207677_10450430
670 Ga0207708_10585222
671 Ga0207708_10617286
672 Ga0207708_11311434
673 Ga0207702_10014692
674 Ga0207702_10089173
675 Ga0207702_11295154
676 Ga0207702_11733058
677 Ga0207674_10112404
678 Ga0207674_10781244
679 Ga0207683_10399035
680 Ga0207698_10826295
681 Ga0207428_10045206
682 Ga0268265_10506835
683 Ga0265319_1008972
684 Ga0265334_10020062
685 Ga0265318_10003962
686 Ga0265322_10018392
687 Ga0265338_10114807
688 Ga0265338_10119009
689 Ga0265338_10232779
690 Ga0265330_10018603
691 Ga0265332_10029799
692 Ga0265325_10013617
693 Ga0265329_10014676
694 Ga0265340_10039225
695 Ga0265339_10047111
696 Ga0265331_10032273
697 Ga0265327_10037076
698 Ga0265327_10294404
699 Ga0265316_10078471
700 Ga0265316_10230583
701 Ga0265313_10014875
702 Ga0265342_10066081
703 Ga0307409_101429789
704 Ga0373930_0063335
705 Ga0373958_0005279
706 Ga0373959_0003729
707 Ga0373928_0002149
708 Ga0373929_0001772
709 Ga0373949_0060661
710 Ga0373951_0002901
711 Ga0373932_0035024
712 Ga0373939_0001328
713 Ga0373957_0149424
714 Ga0373942_0133692
715 Ga0373931_0008560
716 Ga0373931_0720676
717 Ga0373937_0002057
718 Ga0373937_0330165
719 Ga0373925_0608965
720 Ga0395899_0006902
721 Ga0395899_0158591
722 Ga0395899_0262043
723 Ga0395900_0017968
724 Ga0395900_0051279
725 Ga0395900_0186660
726 Ga0395900_0188539
727 Ga0395900_0226959
728 Ga0395900_0516650
729 Ga0395900_1299551
730 Ga0395898_0018503
731 Ga0395898_0027293
732 Ga0395905_0069614
733 Ga0395905_0136572
734 Ga0395901_0003036
735 Ga0395901_0009979
736 Ga0395901_0073376
737 Ga0395901_0126416
738 Ga0395901_0139789
739 Ga0395901_0179141
740 Ga0395901_0333265
741 Ga0395901_0514808
742 Ga0395901_0669370
743 Ga0242420_039583
744 Ga0451853_1028052
745 Ga0451853_2934395
746 Ga0439458_0160647
747 Ga0466969_0047298
748 Ga0466965_0428669
749 Ga0466966_0036842
750 Ga0466966_0058444
751 Ga0466961_0051955
752 Ga0466961_0089852
753 Ga0466963_0003715
754 Ga0466963_0005960
755 Ga0466963_0030578
756 Ga0466963_0179114
757 Ga0466963_0378985
758 Ga0466963_0494654
759 Ga0466963_1051415
760 Ga0466964_0014568
761 Ga0466968_0002137
762 Ga0466970_0014920
763 Ga0466957_0005734
764 Ga0466957_0330586
765 Ga0466957_0553655
766 Ga0466960_0131262
767 Ga0466959_0013995
768 Ga0466959_0410535
769 Ga0451576_1780235
770 Ga0466958_0005065
771 Ga0466958_0007955
772 Ga0466958_0137337
773 Ga0466967_0002741
774 Ga0466967_0073461
775 Ga0466967_0079439
776 Ga0466967_0082401
777 Ga0466967_0093946
778 Ga0466967_0117226
779 Ga0466967_0151734
780 Ga0466967_0718683
781 Ga0466967_0789504
782 Ga0466967_1145602
783 Ga0466967_1207164
784 Ga0466967_1561754
785 Ga0495592_0002123
786 Ga0495629_0174614
787 Ga0495651_0000861
788 Ga0495651_0096564
789 Ga0495651_0135718
790 Ga0495653_0000781
791 Ga0495608_0001978
792 Ga0495608_0085582
793 Ga0495608_0160982
794 Ga0495618_0008354
795 Ga0495618_0212336
796 Ga0495628_0001898
797 Ga0495652_0001592
798 Ga0495652_0193157
799 Ga0495587_0000529
800 Ga0495587_0177186
801 Ga0495587_0467800
802 Ga0495645_0000793
803 Ga0495667_0031376
804 Ga0495667_0085336
805 Ga0495667_0129800
806 Ga0495634_0013788
807 Ga0495635_0052576
808 Ga0495657_0002005
809 Ga0495657_0072987
810 Ga0495657_0095127
811 Ga0495657_0184401
812 Ga0495599_0000233
813 Ga0495623_0001047
814 Ga0495646_0002848
815 Ga0495613_0508823
816 Ga0495600_0014687
817 Ga0495600_0053011
818 Ga0495604_0001532
819 Ga0495604_0181965
820 Ga0495680_0006075
821 Ga0495680_0085119
822 Ga0495680_0135343
823 Ga0495675_0000956
824 Ga0495675_0227049
825 Ga0495684_0031840
826 Ga0495684_0068788
827 Ga0495593_0049491
828 Ga0495602_0000080
829 Ga0496100_0025474
830 Ga0496100_0145874
831 Ga0496100_0285955
832 Ga0496100_0442739
833 Ga0496100_0560935
834 Ga0496101_0139396
835 Ga0496101_0189894
836 Ga0496101_0193325
837 Ga0496101_0360565
838 Ga0496101_0866992
839 Ga0496101_1185810
840 Ga0496102_0065664
841 Ga0496102_0312200
842 Ga0496102_0485620
843 Ga0496102_0487842
844 Ga0496102_0600629
845 Ga0496103_0023479
846 Ga0496103_0051286
847 Ga0496103_0402693
848 Ga0496104_0001903
849 Ga0496104_0044920
850 Ga0496104_0224133
851 Ga0496104_0404953
852 Ga0496104_0839473
853 Ga0496105_0000330
854 Ga0496105_0121554
855 Ga0496105_0137198
856 Ga0496105_0285120
857 Ga0496105_0731768
858 Ga0496106_0004665
859 Ga0496106_0034637
860 Ga0496106_0174011
861 Ga0496106_0229390
862 Ga0496107_0001188
863 Ga0496107_0013176
864 Ga0496107_0028971
865 Ga0496107_0478294
866 Ga0496108_0021818
867 Ga0496108_0085346
868 Ga0496109_0035963
869 Ga0496109_0200760
870 Ga0496109_0231085
871 Ga0496109_0231796
872 Ga0496109_0762669
873 Ga0496109_1102339
874 Ga0496110_0022747
875 Ga0496110_0075279
876 Ga0496110_0126725
877 Ga0496110_1126223
878 Ga0496111_0012791
879 Ga0496111_0040027
880 Ga0496111_0060595
881 Ga0496111_0112572
882 Ga0496111_0322064
883 Ga0496112_0087021
884 Ga0496112_0093284
885 Ga0496112_0178098
886 Ga0496112_0418617
887 Ga0496112_0578836
888 Ga0496113_0749559
889 Ga0496114_0002274
890 Ga0496114_0040290
891 Ga0496114_0096990
892 Ga0496114_0380613
893 Ga0496115_0055025
894 Ga0496115_0126314
895 Ga0496115_0467014
896 Ga0496115_0562225
897 Ga0496115_0566297
898 Ga0501047_0063509
899 Ga0501069_0071625
900 Ga0501069_0467860
901 Ga0501070_0000124
902 Ga0501072_0626726
903 Ga0501080_0511609
904 Ga0501044_0489571
905 Ga0501044_0501364
906 nmdc:mga05p37_108090_c1
907 nmdc:mga05p37_126665_c1
908 nmdc:mga05p37_24119_c1
909 nmdc:mga05p37_41134_c1
910 nmdc:mga06r32_289678_c1
911 nmdc:mga08y16_217080_c1
912 nmdc:mga08y16_401926_c1
913 nmdc:mga08y16_61212_c1
914 nmdc:mga08y16_998500_c1
915 nmdc:mga0n895_103165_c1
916 nmdc:mga0n895_24305_c1
917 nmdc:mga0n895_425743_c1
918 nmdc:mga0n895_77546_c1
919 nmdc:mga0rr50_2405_c1
920 nmdc:mga0rr50_4841_c1
921 nmdc:mga08x19_181364_c1
922 nmdc:mga08x19_34794_c1
923 nmdc:mga08x19_673105_c1
924 nmdc:mga0a205_23882_c1
925 nmdc:mga0a205_288931_c1
926 nmdc:mga0a205_311246_c1
927 Ga0495601_0000743
928 Ga0495601_0249553
929 Ga0495601_0660440
930 Ga0495595_0035243
931 Ga0495595_0115685
932 Ga0495619_0000340
933 Ga0495619_0013597
934 Ga0495619_0019832
935 Ga0495619_0057738
936 Ga0587083_0116802

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

20

66

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3crj-assembly1.cif.gz_B crystal structure of a tetr transcription regulator from haloarcula marismortui atcc 43049 0.8067 11 163
3whc-assembly2.cif.gz_D crystal structure of a transcriptional regulator fadr from bacillus subtilis in complex with stearoyl-coa 0.7866 13 185
5gpc-assembly1.cif.gz_B structural analysis of fatty acid degradation regulator fadr from bacillus halodurans 0.7808 13 182
2hyj-assembly1.cif.gz_A-2 the crystal structure of a tetr-family transcriptional regulator from streptomyces coelicolor 0.7784 11 182
2zcm-assembly1.cif.gz_B crystal structure of icar, a repressor of the tetr family 0.7773 15 165
ID Description Score Start End Superfamily
1pb6B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9841 11 62 1.10.10.60
4x1eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9791 16 62 1.10.10.60
2np3B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9756 13 63 1.10.10.60
4jykB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9675 12 62 1.10.10.60
4xk4A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9669 12 62 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7K2YLE7-F1-model_v4 TetR family transcriptional regulator 0.9832 13 164 GO:0000976
GO:0003700
AF-C7Q2J5-F1-model_v4 Transcriptional regulator, TetR family 0.9691 11 185 GO:0003677
GO:0006355
AF-A0A7V8XL63-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9687 13 182 GO:0000976
GO:0003700
AF-A0A1S1QXY1-F1-model_v4 TetR family transcriptional regulator 0.967 11 178 GO:0000976
GO:0003700
AF-A0A4R1D0E5-F1-model_v4 deleted 0.9668 13 178

Map