F450089

General Info

Members Datasets Scaffolds Average Seq Length
468 206 447 200

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0004412|Ga0466957_0004412_5052_5762
Length 236
Sequence VSARGLRSSVAGANMKMMFQPSGLRFCWRDRVSYRSMALTLLSPVHHELVIKKSRFIACVQPMGDRAAAQQVVARLRAEHPAATHVCWALLAGGQSAAVDDGEPSGTAGRPMLDVLRHQDLEGVLATVVRYFGGVKLGAGGLVRAYTDSVAQALLQAQKVAIVRLQGLRCRVPYALEGLLRRELELAGATLEQVAHGDAVDLAFRLPAGRAEALVARLNEAGNGRVAWIGVPDGPA

Samples

Sample ID Description Type Environment
1 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2643221556 Massilia sp. Root1485 Isolate Unclassified
7 2643221664 Massilia sp. Root418 Isolate Unclassified
8 2643221684 Massilia sp. Root133 Isolate Unclassified
9 2738541307 Variovorax sp. GV008 Isolate Unclassified
10 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
11 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
12 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
13 2885266251 Ralstonia sp. SET104 Isolate Nodule
14 2899924645 Variovorax sp. 369 Isolate Unclassified
15 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
16 2928037797 Variovorax sp. 1126 Isolate Unclassified
17 2928044640 Variovorax sp. 1128 Isolate Unclassified
18 2928051484 Variovorax sp. 1133 Isolate Unclassified
19 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
20 2928070936 Variovorax gossypii 1167 Isolate Unclassified
21 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
38 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
51 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
56 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
94 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
95 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
96 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
97 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
98 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
99 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
113 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
125 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
131 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
132 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
135 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
136 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
137 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
140 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
141 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
162 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
163 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
172 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
175 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
176 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
177 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
182 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
198 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
203 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
206 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.51
Metatranscriptomes 0
Isolates 4.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.48
Nodule 0.85
Rhizoplane 5.34
Rhizosphere 79.27
Stem 0
Stem Tuber 0
Unclassified 7.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1001038 3300002987 Bacteria 11872
2 JGI25159J45721_1023191 3300002987 Bacteria 1131
3 JGI25151J46595_10023679 3300003187 Bacteria 2524
4 JGI25153J46596_10018252 3300003215 Bacteria 2732
5 rootH1_10021326 3300003316 Bacteria 3706
6 Ga0055526_1023180 3300003771 Bacteria 2081
7 Ga0055524_1000015 3300003775 Bacteria 246493
8 Ga0055543_1012304 3300004625 Bacteria 1726
9 Ga0055543_1019108 3300004625 Bacteria 1270
10 Ga0055543_1024313 3300004625 Bacteria 1088
11 Ga0065165_1000455 3300005262 Bacteria 64259
12 Ga0065165_1001096 3300005262 Bacteria 32206
13 Ga0065165_1014936 3300005262 Bacteria 2989
14 Ga0070658_10169217 3300005327 Bacteria 1835
15 Ga0070680_100058181 3300005336 Bacteria 3161
16 Ga0070659_100095367 3300005366 Bacteria 2389
17 Ga0070659_100373820 3300005366 Bacteria 1199
18 Ga0070665_100467762 3300005548 Bacteria 1271
19 Ga0068855_100046129 3300005563 Bacteria 5152
20 Ga0068855_100258502 3300005563 Bacteria 1941
21 Ga0068855_100450962 3300005563 Bacteria 1404
22 Ga0068855_100654863 3300005563 Bacteria 1127
23 Ga0070664_100322601 3300005564 Bacteria 1400
24 Ga0068856_100423869 3300005614 Bacteria 1351
25 Ga0068852_100028411 3300005616 Bacteria 4577
26 Ga0099826_10000003 3300006948 Bacteria 1067817
27 Ga0105244_10025698 3300009036 Bacteria 3197
28 Ga0105240_10223997 3300009093 Bacteria 2189
29 Ga0105245_10185822 3300009098 Bacteria 1988
30 Ga0105242_10063790 3300009176 Bacteria 3034
31 Ga0105237_10019084 3300009545 Bacteria 7088
32 Ga0105238_10107863 3300009551 Bacteria 2765
33 Ga0105239_10318971 3300010375 Bacteria 1752
34 Ga0157370_10876985 3300013104 Bacteria 815
35 Ga0157372_10390962 3300013307 Bacteria 1620
36 Ga0157372_10988102 3300013307 Bacteria 975
37 Ga0182008_10060582 3300014497 Bacteria 1866
38 Ga0182006_1012197 3300015261 Bacteria 3763
39 Ga0182007_10024021 3300015262 Bacteria 2137
40 Ga0213872_10000763 3300021361 Bacteria 23609
41 Ga0213872_10001321 3300021361 Bacteria 16423
42 Ga0213872_10006091 3300021361 Bacteria 6103
43 Ga0213872_10056960 3300021361 Bacteria 1770
44 Ga0213872_10076865 3300021361 Bacteria 1501
45 Ga0209672_100962 3300025228 Bacteria 12795
46 Ga0209147_101143 3300025229 Bacteria 10894
47 Ga0209563_100015 3300025230 Bacteria 879901
48 Ga0209258_100015 3300025242 Bacteria 706310
49 Ga0207425_1004478 3300025245 Bacteria 4179
50 Ga0209677_104059 3300025253 Bacteria 4399
51 Ga0209148_1000028 3300025254 Bacteria 582773
52 Ga0209565_1023944 3300025263 Bacteria 1249
53 Ga0209673_1000356 3300025273 Bacteria 82432
54 Ga0209673_1001242 3300025273 Bacteria 26534
55 Ga0209130_1000296 3300025284 Bacteria 60641
56 Ga0209130_1001104 3300025284 Bacteria 19948
57 Ga0209675_1013555 3300025291 Bacteria 2539
58 Ga0209676_1021511 3300025292 Bacteria 2163
59 Ga0209025_1034578 3300025294 Bacteria 2303
60 Ga0209564_1000847 3300025295 Bacteria 40940
61 Ga0209564_1014599 3300025295 Bacteria 3253
62 Ga0209758_1036868 3300025297 Bacteria 1900
63 Ga0209256_1000005 3300025299 Bacteria 1315082
64 Ga0209256_1000787 3300025299 Bacteria 40940
65 Ga0207426_1000683 3300025302 Bacteria 40932
66 Ga0209051_1056497 3300025303 Bacteria 1265
67 Ga0207647_10279834 3300025904 Bacteria 952
68 Ga0207705_10014048 3300025909 Bacteria 5770
69 Ga0207705_10791527 3300025909 Bacteria 736
70 Ga0207654_10027385 3300025911 Bacteria 3097
71 Ga0207660_10044463 3300025917 Bacteria 3125
72 Ga0207657_10345046 3300025919 Bacteria 1175
73 Ga0207694_10097446 3300025924 Bacteria 2327
74 Ga0207690_10001619 3300025932 Bacteria 14018
75 Ga0207690_10016643 3300025932 Bacteria 4480
76 Ga0207706_10223391 3300025933 Bacteria 1649
77 Ga0207661_10919818 3300025944 Bacteria 806
78 Ga0207679_10506113 3300025945 Bacteria 1078
79 Ga0207667_10052904 3300025949 Bacteria 4274
80 Ga0207667_10525432 3300025949 Bacteria 1199
81 Ga0207640_10066449 3300025981 Bacteria 2409
82 Ga0207702_10050522 3300026078 Bacteria 3511
83 Ga0207698_10364185 3300026142 Bacteria 1370
84 Ga0209282_1000002 3300027666 Bacteria 1067825
85 Ga0307515_10000471 3300028794 Bacteria 96225
86 Ga0307408_100000488 3300031548 Bacteria 34667
87 Ga0307514_10000420 3300031649 Bacteria 94078
88 Ga0307514_10000842 3300031649 Bacteria 49580
89 Ga0395899_0000715 3300037312 Bacteria 33273
90 Ga0395899_0034324 3300037312 Bacteria 3808
91 Ga0395899_0164004 3300037312 Bacteria 1568
92 Ga0395899_0338452 3300037312 Bacteria 1009
93 Ga0395900_0000298 3300037418 Bacteria 74295
94 Ga0395900_0000372 3300037418 Bacteria 64606
95 Ga0395900_0002819 3300037418 Bacteria 18975
96 Ga0395900_0069892 3300037418 Bacteria 3609
97 Ga0395900_0203257 3300037418 Bacteria 2003
98 Ga0395900_0244296 3300037418 Bacteria 1799
99 Ga0395900_0431720 3300037418 Bacteria 1276
100 Ga0395900_0445082 3300037418 Bacteria 1252
101 Ga0395900_0670340 3300037418 Bacteria 972
102 Ga0395898_0022854 3300037466 Bacteria 6325
103 Ga0395898_0034127 3300037466 Bacteria 5073
104 Ga0395898_0114084 3300037466 Bacteria 2589
105 Ga0395898_0190337 3300037466 Bacteria 1960
106 Ga0395898_0250961 3300037466 Bacteria 1687
107 Ga0395898_0353039 3300037466 Bacteria 1402
108 Ga0395898_0407475 3300037466 Bacteria 1296
109 Ga0395898_0506331 3300037466 Bacteria 1148
110 Ga0395898_0559173 3300037466 Bacteria 1086
111 Ga0395898_0605119 3300037466 Bacteria 1039
112 Ga0395905_0001525 3300037471 Bacteria 27709
113 Ga0395905_0057667 3300037471 Bacteria 3632
114 Ga0395905_0069536 3300037471 Bacteria 3297
115 Ga0395905_0096368 3300037471 Bacteria 2777
116 Ga0395905_0101127 3300037471 Bacteria 2706
117 Ga0395905_0318312 3300037471 Bacteria 1445
118 Ga0395901_0001123 3300038443 Bacteria 28428
119 Ga0395901_0004045 3300038443 Bacteria 14768
120 Ga0395901_0223314 3300038443 Bacteria 1968
121 Ga0395901_0269160 3300038443 Bacteria 1772
122 Ga0395901_0295721 3300038443 Bacteria 1679
123 Ga0395901_0328465 3300038443 Bacteria 1581
124 Ga0395901_0427381 3300038443 Bacteria 1357
125 Ga0395901_0443463 3300038443 Bacteria 1328
126 Ga0395901_1007703 3300038443 Bacteria 808
127 Ga0436361_0298962 3300039447 Bacteria 11732
128 Ga0436361_0310853 3300039447 Bacteria 19766
129 Ga0436361_0367502 3300039447 Bacteria 3371
130 Ga0436361_0709224 3300039447 Bacteria 2786
131 Ga0436361_0768142 3300039447 Bacteria 56393
132 Ga0436361_0856154 3300039447 Bacteria 13774
133 Ga0436361_0980094 3300039447 Bacteria 2153
134 Ga0439448_0006205 3300042005 Bacteria 3429
135 Ga0439450_103080 3300042008 Bacteria 725
136 Ga0439455_0001966 3300042012 Bacteria 3627
137 Ga0439458_0029107 3300042157 Bacteria 1309
138 Ga0450893_0001215 3300042532 Bacteria 3882
139 Ga0466969_0156856 3300044656 Bacteria 1047
140 Ga0466978_0065463 3300044671 Bacteria 2268
141 Ga0466965_0008829 3300044683 Bacteria 4674
142 Ga0466965_0012721 3300044683 Bacteria 3963
143 Ga0466965_0020221 3300044683 Bacteria 3198
144 Ga0466966_0175000 3300044684 Bacteria 1303
145 Ga0466961_0000656 3300044693 Bacteria 21722
146 Ga0466961_0076924 3300044693 Bacteria 2114
147 Ga0466961_0095070 3300044693 Bacteria 1880
148 Ga0466961_0104614 3300044693 Bacteria 1782
149 Ga0466961_0137729 3300044693 Bacteria 1529
150 Ga0466963_0454809 3300044694 Bacteria 903
151 Ga0466964_0002408 3300044706 Bacteria 6648
152 Ga0466964_0002452 3300044706 Bacteria 6595
153 Ga0466964_0026627 3300044706 Bacteria 2264
154 Ga0466964_0082701 3300044706 Bacteria 1381
155 Ga0466971_0235826 3300044719 Bacteria 869
156 Ga0466968_0003377 3300044735 Bacteria 5900
157 Ga0466968_0381498 3300044735 Bacteria 688
158 Ga0466970_0023276 3300044765 Bacteria 3235
159 Ga0466970_0043322 3300044765 Bacteria 2394
160 Ga0466970_0112789 3300044765 Bacteria 1485
161 Ga0466957_0004412 3300044842 Bacteria 7833
162 Ga0466957_0011780 3300044842 Bacteria 5056
163 Ga0466957_0013067 3300044842 Bacteria 4810
164 Ga0466957_0016488 3300044842 Bacteria 4322
165 Ga0466957_0131043 3300044842 Bacteria 1606
166 Ga0466957_0169517 3300044842 Bacteria 1421
167 Ga0466959_0012554 3300045049 Bacteria 6126
168 Ga0466959_0016104 3300045049 Bacteria 5456
169 Ga0466959_0349310 3300045049 Bacteria 1008
170 Ga0466958_0036401 3300045836 Bacteria 2945
171 Ga0466958_0247105 3300045836 Bacteria 1141
172 Ga0466958_0256889 3300045836 Bacteria 1118
173 Ga0466967_0037103 3300045976 Bacteria 4167
174 Ga0466967_0038386 3300045976 Bacteria 4107
175 Ga0466967_0047699 3300045976 Bacteria 3735
176 Ga0466967_0106129 3300045976 Bacteria 2574
177 Ga0495617_000002 3300046452 Bacteria 710121
178 Ga0495627_000207 3300046453 Bacteria 63763
179 Ga0495627_016542 3300046453 Bacteria 2523
180 Ga0495603_0241892 3300046455 Bacteria 1039
181 Ga0495638_0023320 3300046460 Bacteria 4048
182 Ga0495653_0017874 3300046463 Bacteria 5764
183 Ga0495653_0027841 3300046463 Bacteria 4523
184 Ga0495650_0000124 3300046471 Bacteria 180310
185 Ga0495580_0055866 3300046472 Bacteria 2780
186 Ga0495582_0006734 3300046473 Bacteria 6390
187 Ga0495582_0029455 3300046473 Bacteria 3014
188 Ga0495582_0068834 3300046473 Bacteria 1956
189 Ga0495605_0000034 3300046474 Bacteria 208277
190 Ga0495605_0000293 3300046474 Bacteria 55067
191 Ga0495605_0022908 3300046474 Bacteria 3291
192 Ga0495605_0035996 3300046474 Bacteria 2498
193 Ga0495605_0057241 3300046474 Bacteria 1877
194 Ga0495584_0000255 3300046491 Bacteria 37941
195 Ga0495584_0002306 3300046491 Bacteria 10889
196 Ga0495584_0014023 3300046491 Bacteria 4082
197 Ga0495584_0023692 3300046491 Bacteria 3112
198 Ga0495584_0173965 3300046491 Bacteria 1094
199 Ga0495584_0222407 3300046491 Bacteria 959
200 Ga0495585_0000941 3300046492 Bacteria 24552
201 Ga0495585_0013154 3300046492 Bacteria 4849
202 Ga0495585_0032611 3300046492 Bacteria 2950
203 Ga0495585_0034948 3300046492 Bacteria 2841
204 Ga0495585_0281756 3300046492 Bacteria 821
205 Ga0495594_0004412 3300046499 Bacteria 7239
206 Ga0495594_0007895 3300046499 Bacteria 5470
207 Ga0495594_0018988 3300046499 Bacteria 3649
208 Ga0495594_0156727 3300046499 Bacteria 1293
209 Ga0495594_0376084 3300046499 Bacteria 808
210 Ga0495596_0002005 3300046500 Bacteria 11211
211 Ga0495596_0006431 3300046500 Bacteria 5405
212 Ga0495596_0017894 3300046500 Bacteria 2927
213 Ga0495596_0019506 3300046500 Bacteria 2784
214 Ga0495596_0020124 3300046500 Bacteria 2733
215 Ga0495596_0060516 3300046500 Bacteria 1475
216 Ga0495596_0079574 3300046500 Bacteria 1272
217 Ga0495607_0000398 3300046501 Bacteria 44114
218 Ga0495607_0003557 3300046501 Bacteria 11865
219 Ga0495607_0004032 3300046501 Bacteria 11012
220 Ga0495607_0023486 3300046501 Bacteria 3859
221 Ga0495607_0040201 3300046501 Bacteria 2786
222 Ga0495607_0073512 3300046501 Bacteria 1900
223 Ga0495607_0136454 3300046501 Bacteria 1270
224 Ga0495607_0139572 3300046501 Bacteria 1251
225 Ga0495607_0264365 3300046501 Bacteria 822
226 Ga0495583_0007672 3300046506 Bacteria 6725
227 Ga0495583_0040281 3300046506 Bacteria 2196
228 Ga0495583_0081981 3300046506 Bacteria 1400
229 Ga0495606_0003064 3300046507 Bacteria 18209
230 Ga0495606_0004415 3300046507 Bacteria 14071
231 Ga0495606_0018764 3300046507 Bacteria 5174
232 Ga0495606_0034865 3300046507 Bacteria 3448
233 Ga0495606_0055167 3300046507 Bacteria 2571
234 Ga0495606_0128817 3300046507 Bacteria 1506
235 Ga0495616_0000207 3300046513 Bacteria 48768
236 Ga0495616_0027210 3300046513 Bacteria 3036
237 Ga0495616_0038566 3300046513 Bacteria 2452
238 Ga0495616_0052803 3300046513 Bacteria 2022
239 Ga0495616_0060290 3300046513 Bacteria 1864
240 Ga0495616_0100557 3300046513 Bacteria 1356
241 Ga0495630_0023901 3300046517 Bacteria 4518
242 Ga0495630_0087913 3300046517 Bacteria 2347
243 Ga0495631_0001464 3300046518 Bacteria 14314
244 Ga0495631_0009529 3300046518 Bacteria 4848
245 Ga0495631_0013714 3300046518 Bacteria 3926
246 Ga0495631_0014136 3300046518 Bacteria 3857
247 Ga0495631_0014203 3300046518 Bacteria 3848
248 Ga0495631_0033002 3300046518 Bacteria 2328
249 Ga0495632_0000077 3300046519 Bacteria 100834
250 Ga0495632_0000129 3300046519 Bacteria 77134
251 Ga0495632_0000296 3300046519 Bacteria 48157
252 Ga0495632_0000375 3300046519 Bacteria 42575
253 Ga0495632_0016131 3300046519 Bacteria 4165
254 Ga0495637_0046850 3300046520 Bacteria 1827
255 Ga0495643_0000567 3300046522 Bacteria 45722
256 Ga0495643_0001819 3300046522 Bacteria 18186
257 Ga0495643_0007860 3300046522 Bacteria 6817
258 Ga0495643_0139465 3300046522 Bacteria 1210
259 Ga0495644_0016214 3300046523 Bacteria 2853
260 Ga0495644_0018036 3300046523 Bacteria 2695
261 Ga0495644_0052731 3300046523 Bacteria 1527
262 Ga0495648_0001105 3300046524 Bacteria 27423
263 Ga0495648_0004314 3300046524 Bacteria 12185
264 Ga0495648_0055635 3300046524 Bacteria 2384
265 Ga0495666_0011477 3300046526 Bacteria 4416
266 Ga0495666_0021155 3300046526 Bacteria 3220
267 Ga0495666_0023273 3300046526 Bacteria 3063
268 Ga0495642_0000085 3300046528 Bacteria 54372
269 Ga0495642_0000285 3300046528 Bacteria 28471
270 Ga0495642_0001143 3300046528 Bacteria 12193
271 Ga0495642_0008629 3300046528 Bacteria 3896
272 Ga0495642_0008644 3300046528 Bacteria 3892
273 Ga0495642_0011900 3300046528 Bacteria 3351
274 Ga0495642_0024816 3300046528 Bacteria 2373
275 Ga0495642_0056789 3300046528 Bacteria 1617
276 Ga0495642_0080114 3300046528 Bacteria 1374
277 Ga0495642_0109457 3300046528 Bacteria 1180
278 Ga0495652_0004715 3300046529 Bacteria 12985
279 Ga0495654_0001914 3300046530 Bacteria 13821
280 Ga0495654_0008948 3300046530 Bacteria 5501
281 Ga0495654_0062803 3300046530 Bacteria 1780
282 Ga0495665_0018035 3300046531 Bacteria 3794
283 Ga0495586_0005557 3300046535 Bacteria 6743
284 Ga0495586_0082910 3300046535 Bacteria 1763
285 Ga0495587_0013636 3300046536 Bacteria 5105
286 Ga0495609_0000002 3300046538 Bacteria 739816
287 Ga0495609_0001432 3300046538 Bacteria 15888
288 Ga0495609_0003372 3300046538 Bacteria 9189
289 Ga0495609_0029292 3300046538 Bacteria 2507
290 Ga0495597_0000226 3300046542 Bacteria 51108
291 Ga0495597_0000958 3300046542 Bacteria 22301
292 Ga0495597_0001519 3300046542 Bacteria 16517
293 Ga0495597_0002642 3300046542 Bacteria 11115
294 Ga0495645_0204452 3300046543 Bacteria 1337
295 Ga0495622_0027202 3300046557 Bacteria 2669
296 Ga0495633_0023706 3300046558 Bacteria 3038
297 Ga0495633_0083478 3300046558 Bacteria 1486
298 Ga0495656_0022620 3300046615 Bacteria 2464
299 Ga0495656_0155360 3300046615 Bacteria 1108
300 Ga0495668_0000274 3300046616 Bacteria 72330
301 Ga0495668_0000544 3300046616 Bacteria 46835
302 Ga0495668_0000941 3300046616 Bacteria 32463
303 Ga0495668_0007379 3300046616 Bacteria 7039
304 Ga0495668_0020194 3300046616 Bacteria 3832
305 Ga0495668_0039940 3300046616 Bacteria 2619
306 Ga0495668_0155468 3300046616 Bacteria 1252
307 Ga0495634_0004059 3300046642 Bacteria 11593
308 Ga0495611_0004463 3300046648 Bacteria 6058
309 Ga0495611_0091057 3300046648 Bacteria 1409
310 Ga0495611_0136390 3300046648 Bacteria 1146
311 Ga0495625_0015455 3300046660 Bacteria 6047
312 Ga0495625_0082309 3300046660 Bacteria 2239
313 Ga0495625_0087684 3300046660 Bacteria 2157
314 Ga0495625_0096763 3300046660 Bacteria 2033
315 Ga0495635_0007996 3300046663 Bacteria 7389
316 Ga0495661_0000281 3300046665 Bacteria 57922
317 Ga0495661_0000980 3300046665 Bacteria 25764
318 Ga0495661_0001170 3300046665 Bacteria 22890
319 Ga0495661_0011134 3300046665 Bacteria 6107
320 Ga0495661_0017463 3300046665 Bacteria 4737
321 Ga0495661_0025498 3300046665 Bacteria 3817
322 Ga0495661_0028318 3300046665 Bacteria 3587
323 Ga0495661_0031180 3300046665 Bacteria 3386
324 Ga0495661_0057392 3300046665 Bacteria 2324
325 Ga0495661_0196891 3300046665 Bacteria 1057
326 Ga0495588_0000177 3300046674 Bacteria 78598
327 Ga0495588_0192769 3300046674 Bacteria 1076
328 Ga0495588_0227369 3300046674 Bacteria 984
329 Ga0495623_0148735 3300046679 Bacteria 1386
330 Ga0495646_0409921 3300046680 Bacteria 704
331 Ga0495669_0000092 3300046684 Bacteria 59765
332 Ga0495669_0011936 3300046684 Bacteria 3695
333 Ga0495669_0028401 3300046684 Bacteria 2450
334 Ga0495613_0198299 3300046689 Bacteria 1416
335 Ga0495670_0000312 3300046691 Bacteria 23108
336 Ga0495670_0006596 3300046691 Bacteria 5705
337 Ga0495670_0170798 3300046691 Bacteria 1145
338 Ga0495671_0003576 3300046692 Bacteria 9494
339 Ga0495671_0058089 3300046692 Bacteria 1914
340 Ga0495649_0013521 3300046694 Bacteria 4707
341 Ga0495649_0015559 3300046694 Bacteria 4328
342 Ga0495589_0000128 3300046794 Bacteria 69997
343 Ga0495589_0000230 3300046794 Bacteria 47199
344 Ga0495589_0004614 3300046794 Bacteria 7322
345 Ga0495600_0365675 3300046809 Bacteria 902
346 Ga0495660_0000026 3300046810 Bacteria 256223
347 Ga0495660_0007209 3300046810 Bacteria 6544
348 Ga0495660_0013746 3300046810 Bacteria 4691
349 Ga0495660_0023409 3300046810 Bacteria 3522
350 Ga0495660_0224563 3300046810 Bacteria 883
351 Ga0495581_0012247 3300047315 Bacteria 4967
352 Ga0495581_0209799 3300047315 Bacteria 1139
353 Ga0495604_0022685 3300047317 Bacteria 5011
354 Ga0495604_0042475 3300047317 Bacteria 3562
355 Ga0495604_0228572 3300047317 Bacteria 1277
356 Ga0495672_0001178 3300047320 Bacteria 26523
357 Ga0495672_0001659 3300047320 Bacteria 21644
358 Ga0495672_0007797 3300047320 Bacteria 8005
359 Ga0495672_0008194 3300047320 Bacteria 7751
360 Ga0495676_0013666 3300047321 Bacteria 7286
361 Ga0495680_0012771 3300047322 Bacteria 7365
362 Ga0495680_0302837 3300047322 Bacteria 1122
363 Ga0495683_0006353 3300047323 Bacteria 6456
364 Ga0495683_0018861 3300047323 Bacteria 3562
365 Ga0495683_0155670 3300047323 Bacteria 1060
366 Ga0495687_000013 3300047443 Bacteria 371058
367 Ga0495687_000280 3300047443 Bacteria 67023
368 Ga0495687_000337 3300047443 Bacteria 60197
369 Ga0495675_0001600 3300047444 Bacteria 13611
370 Ga0495675_0058743 3300047444 Bacteria 2438
371 Ga0495675_0129774 3300047444 Bacteria 1567
372 Ga0495675_0136480 3300047444 Bacteria 1522
373 Ga0495675_0149395 3300047444 Bacteria 1444
374 Ga0495675_0176069 3300047444 Bacteria 1312
375 Ga0495677_0000041 3300047445 Bacteria 75366
376 Ga0495677_0000104 3300047445 Bacteria 41829
377 Ga0495677_0000925 3300047445 Bacteria 11857
378 Ga0495677_0004477 3300047445 Bacteria 5360
379 Ga0495677_0005455 3300047445 Bacteria 4823
380 Ga0495677_0022940 3300047445 Bacteria 2265
381 Ga0495679_030828 3300047446 Bacteria 1736
382 Ga0495685_007067 3300047447 Bacteria 3697
383 Ga0495681_0000667 3300047470 Bacteria 26095
384 Ga0495681_0000815 3300047470 Bacteria 23974
385 Ga0495681_0029032 3300047470 Bacteria 2836
386 Ga0495686_0000656 3300047472 Bacteria 47216
387 Ga0495593_0012889 3300047673 Bacteria 4776
388 Ga0495593_0032009 3300047673 Bacteria 2869
389 Ga0495593_0041624 3300047673 Bacteria 2469
390 Ga0495602_0008084 3300048088 Bacteria 10992
391 Ga0495602_0087835 3300048088 Bacteria 2590
392 Ga0495602_0145995 3300048088 Bacteria 1866
393 Ga0495614_0013115 3300048089 Bacteria 3635
394 Ga0495614_0031697 3300048089 Bacteria 2276
395 Ga0495626_0000003 3300048091 Bacteria 427774
396 Ga0495626_0000383 3300048091 Bacteria 45903
397 Ga0495626_0000478 3300048091 Bacteria 40390
398 Ga0495626_0003588 3300048091 Bacteria 9874
399 Ga0495626_0004649 3300048091 Bacteria 8338
400 Ga0495626_0005710 3300048091 Bacteria 7195
401 Ga0495626_0006035 3300048091 Bacteria 6964
402 Ga0495626_0007698 3300048091 Bacteria 5969
403 Ga0495626_0029701 3300048091 Bacteria 2643
404 Ga0496100_0394876 3300048903 Bacteria 1052
405 Ga0496101_0128191 3300048904 Bacteria 1924
406 Ga0496101_0357714 3300048904 Bacteria 1148
407 Ga0496102_0120884 3300048905 Bacteria 2446
408 Ga0496103_0337555 3300048906 Bacteria 969
409 Ga0496104_0525833 3300048907 Bacteria 1094
410 Ga0496105_0174773 3300048908 Bacteria 1760
411 Ga0496106_0009983 3300048909 Bacteria 7011
412 Ga0496106_0369326 3300048909 Bacteria 1153
413 Ga0496107_0566928 3300048910 Bacteria 840
414 Ga0496107_0575200 3300048910 Bacteria 834
415 Ga0496109_0009157 3300048912 Bacteria 8432
416 Ga0496109_0356571 3300048912 Bacteria 1382
417 Ga0496110_0000068 3300048913 Bacteria 51803
418 Ga0496110_0150029 3300048913 Bacteria 2110
419 Ga0496110_0299972 3300048913 Bacteria 1463
420 Ga0496111_0009513 3300048914 Bacteria 6493
421 Ga0496113_0006466 3300048916 Bacteria 7432
422 Ga0496113_0146283 3300048916 Bacteria 1862
423 Ga0496114_0038094 3300048917 Bacteria 3978
424 Ga0496115_0138120 3300048918 Bacteria 2010
425 Ga0496115_0319771 3300048918 Bacteria 1269
426 Ga0496122_0000445 3300048925 Bacteria 86566
427 Ga0496122_0001558 3300048925 Bacteria 36307
428 Ga0496122_0023667 3300048925 Bacteria 5401
429 Ga0496122_0100999 3300048925 Bacteria 1928
430 Ga0496123_0001531 3300048926 Bacteria 31933
431 Ga0496123_0020515 3300048926 Bacteria 5166
432 Ga0496123_0170610 3300048926 Bacteria 1148
433 Ga0496124_0012065 3300048927 Bacteria 8577
434 Ga0496124_0018475 3300048927 Bacteria 6528
435 Ga0496124_0031219 3300048927 Bacteria 4719
436 Ga0496124_0194656 3300048927 Bacteria 1548
437 Ga0496124_0216952 3300048927 Bacteria 1442
438 Ga0496124_0422873 3300048927 Bacteria 917
439 Ga0496125_0002859 3300048928 Bacteria 21722
440 Ga0496125_0093728 3300048928 Bacteria 2240
441 Ga0496126_0084087 3300048929 Bacteria 2807
442 Ga0495678_000316 3300049459 Bacteria 51625
443 Ga0495678_001703 3300049459 Bacteria 16504
444 Ga0495678_050832 3300049459 Bacteria 1604
445 Ga0495682_0000107 3300049460 Bacteria 73486
446 Ga0501035_0003556 3300049822 Bacteria 14885
447 Ga0466962_0010024 3300061719 Bacteria 4547

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2596583598 2597032385 190
2 iso_pu_bacteria 2599185214 2599621544 191
3 iso_pu_bacteria 2599185226 2599670772 191
4 iso_pu_bacteria 2599185227 2599679262 191
5 iso_pu_bacteria 2599185229 2599691055 191
6 iso_pu_bacteria 2738541307 2738883535 191
7 iso_pu_bacteria 2838054893 2838058149 191
8 iso_pu_bacteria 2885266251 2885268790 191
9 iso_pu_bacteria 2899924645 2899929139 191
10 iso_pu_bacteria 2928037797 2928040426 191
11 iso_pu_bacteria 2928044640 2928046825 191
12 iso_pu_bacteria 2928051484 2928057987 191
13 iso_pu_bacteria 2928064002 2928067673 191
14 iso_pu_bacteria 2928070936 2928072206 191
15 3300005548 Ga0070665_100467762 Ga0070665_1004677622 193
16 3300048904 Ga0496101_0128191 Ga0496101_0128191_1270_1851 193
17 3300014497 Ga0182008_10060582 Ga0182008_100605821 194
18 3300015261 Ga0182006_1012197 Ga0182006_10121972 194
19 3300015262 Ga0182007_10024021 Ga0182007_100240212 194
20 3300025904 Ga0207647_10279834 Ga0207647_102798342 194
21 3300025932 Ga0207690_10001619 Ga0207690_1000161913 194
22 3300042532 Ga0450893_0001215 Ga0450893_0001215_790_1374 194
23 3300048909 Ga0496106_0369326 Ga0496106_0369326_543_1127 194
24 3300048929 Ga0496126_0084087 Ga0496126_0084087_2081_2665 194
25 3300002987 JGI25159J45721_1023191 JGI25159J45721_10231912 195
26 3300003187 JGI25151J46595_10023679 JGI25151J46595_100236795 195
27 3300003215 JGI25153J46596_10018252 JGI25153J46596_100182522 195
28 3300003316 rootH1_10021326 rootH1_100213263 195
29 3300003771 Ga0055526_1023180 Ga0055526_10231802 195
30 3300004625 Ga0055543_1019108 Ga0055543_10191082 195
31 3300005563 Ga0068855_100450962 Ga0068855_1004509622 195
32 3300005614 Ga0068856_100423869 Ga0068856_1004238692 195
33 3300005616 Ga0068852_100028411 Ga0068852_1000284113 195
34 3300009545 Ga0105237_10019084 Ga0105237_100190847 195
35 3300010375 Ga0105239_10318971 Ga0105239_103189712 195
36 3300013104 Ga0157370_10876985 Ga0157370_108769851 195
37 3300013307 Ga0157372_10988102 Ga0157372_109881022 195
38 3300025228 Ga0209672_100962 Ga0209672_1009627 195
39 3300025229 Ga0209147_101143 Ga0209147_1011437 195
40 3300025242 Ga0209258_100015 Ga0209258_100015451 195
41 3300025245 Ga0207425_1004478 Ga0207425_10044783 195
42 3300025254 Ga0209148_1000028 Ga0209148_1000028218 195
43 3300025273 Ga0209673_1000356 Ga0209673_100035613 195
44 3300025273 Ga0209673_1001242 Ga0209673_100124220 195
45 3300025284 Ga0209130_1001104 Ga0209130_10011044 195
46 3300025291 Ga0209675_1013555 Ga0209675_10135553 195
47 3300025292 Ga0209676_1021511 Ga0209676_10215112 195
48 3300025294 Ga0209025_1034578 Ga0209025_10345783 195
49 3300025295 Ga0209564_1000847 Ga0209564_100084720 195
50 3300025297 Ga0209758_1036868 Ga0209758_10368682 195
51 3300025299 Ga0209256_1000787 Ga0209256_100078720 195
52 3300025302 Ga0207426_1000683 Ga0207426_100068319 195
53 3300025303 Ga0209051_1056497 Ga0209051_10564972 195
54 3300025981 Ga0207640_10066449 Ga0207640_100664493 195
55 3300026078 Ga0207702_10050522 Ga0207702_100505223 195
56 3300026142 Ga0207698_10364185 Ga0207698_103641852 195
57 3300031649 Ga0307514_10000420 Ga0307514_1000042021 195
58 3300048905 Ga0496102_0120884 Ga0496102_0120884_1558_2145 195
59 3300048913 Ga0496110_0000068 Ga0496110_0000068_16421_17008 195
60 3300048925 Ga0496122_0100999 Ga0496122_0100999_1035_1622 195
61 3300048927 Ga0496124_0422873 Ga0496124_0422873_49_636 195
62 3300048928 Ga0496125_0093728 Ga0496125_0093728_488_1075 195
63 3300037466 Ga0395898_0353039 Ga0395898_0353039_64_654 196
64 3300037466 Ga0395898_0605119 Ga0395898_0605119_261_851 196
65 3300037471 Ga0395905_0001525 Ga0395905_0001525_23891_24481 196
66 3300037471 Ga0395905_0057667 Ga0395905_0057667_1464_2054 196
67 3300039447 Ga0436361_0980094 Ga0436361_0980094_153_743 196
68 3300044671 Ga0466978_0065463 Ga0466978_0065463_1346_1939 196
69 3300044683 Ga0466965_0012721 Ga0466965_0012721_1815_2408 196
70 3300044693 Ga0466961_0000656 Ga0466961_0000656_8913_9506 196
71 3300044694 Ga0466963_0454809 Ga0466963_0454809_181_774 196
72 3300044706 Ga0466964_0026627 Ga0466964_0026627_1269_1862 196
73 3300044735 Ga0466968_0381498 Ga0466968_0381498_61_654 196
74 3300044765 Ga0466970_0043322 Ga0466970_0043322_220_813 196
75 3300044842 Ga0466957_0013067 Ga0466957_0013067_366_959 196
76 3300045049 Ga0466959_0016104 Ga0466959_0016104_4724_5317 196
77 3300045976 Ga0466967_0047699 Ga0466967_0047699_1498_2091 196
78 3300046491 Ga0495584_0023692 Ga0495584_0023692_167_757 196
79 3300046492 Ga0495585_0000941 Ga0495585_0000941_23181_23771 196
80 3300046492 Ga0495585_0013154 Ga0495585_0013154_3955_4545 196
81 3300046506 Ga0495583_0040281 Ga0495583_0040281_803_1393 196
82 3300046506 Ga0495583_0081981 Ga0495583_0081981_450_1040 196
83 3300046507 Ga0495606_0003064 Ga0495606_0003064_7349_7939 196
84 3300046507 Ga0495606_0034865 Ga0495606_0034865_83_673 196
85 3300046507 Ga0495606_0055167 Ga0495606_0055167_1594_2184 196
86 3300046518 Ga0495631_0009529 Ga0495631_0009529_1492_2082 196
87 3300046518 Ga0495631_0013714 Ga0495631_0013714_778_1368 196
88 3300046522 Ga0495643_0139465 Ga0495643_0139465_194_784 196
89 3300046528 Ga0495642_0008629 Ga0495642_0008629_1276_1866 196
90 3300046528 Ga0495642_0008644 Ga0495642_0008644_510_1100 196
91 3300046528 Ga0495642_0024816 Ga0495642_0024816_978_1568 196
92 3300046538 Ga0495609_0003372 Ga0495609_0003372_4527_5117 196
93 3300046558 Ga0495633_0023706 Ga0495633_0023706_785_1375 196
94 3300046558 Ga0495633_0083478 Ga0495633_0083478_342_932 196
95 3300046616 Ga0495668_0007379 Ga0495668_0007379_1378_1968 196
96 3300046648 Ga0495611_0136390 Ga0495611_0136390_194_784 196
97 3300046660 Ga0495625_0087684 Ga0495625_0087684_906_1496 196
98 3300046665 Ga0495661_0000980 Ga0495661_0000980_24371_24961 196
99 3300046665 Ga0495661_0196891 Ga0495661_0196891_415_1005 196
100 3300046674 Ga0495588_0227369 Ga0495588_0227369_306_896 196
101 3300046679 Ga0495623_0148735 Ga0495623_0148735_668_1258 196
102 3300046691 Ga0495670_0000312 Ga0495670_0000312_21618_22208 196
103 3300046691 Ga0495670_0170798 Ga0495670_0170798_253_843 196
104 3300046692 Ga0495671_0058089 Ga0495671_0058089_1024_1614 196
105 3300047317 Ga0495604_0228572 Ga0495604_0228572_268_858 196
106 3300047323 Ga0495683_0155670 Ga0495683_0155670_418_1008 196
107 3300047444 Ga0495675_0176069 Ga0495675_0176069_496_1086 196
108 3300047470 Ga0495681_0000667 Ga0495681_0000667_786_1376 196
109 3300047470 Ga0495681_0000815 Ga0495681_0000815_662_1252 196
110 3300047673 Ga0495593_0012889 Ga0495593_0012889_3097_3687 196
111 3300048089 Ga0495614_0031697 Ga0495614_0031697_1201_1791 196
112 3300048918 Ga0496115_0138120 Ga0496115_0138120_873_1463 196
113 3300048918 Ga0496115_0319771 Ga0496115_0319771_495_1085 196
114 3300061719 Ga0466962_0010024 Ga0466962_0010024_1646_2239 196
115 3300005262 Ga0065165_1014936 Ga0065165_10149362 197
116 3300028794 Ga0307515_10000471 Ga0307515_100004719 197
117 3300031548 Ga0307408_100000488 Ga0307408_1000004882 197
118 3300031649 Ga0307514_10000842 Ga0307514_100008428 197
119 3300046460 Ga0495638_0023320 Ga0495638_0023320_1118_1711 197
120 3300046474 Ga0495605_0035996 Ga0495605_0035996_1404_1997 197
121 3300046491 Ga0495584_0173965 Ga0495584_0173965_423_1016 197
122 3300046492 Ga0495585_0032611 Ga0495585_0032611_1896_2537 197
123 3300046499 Ga0495594_0004412 Ga0495594_0004412_3043_3636 197
124 3300046500 Ga0495596_0002005 Ga0495596_0002005_10510_11103 197
125 3300046501 Ga0495607_0004032 Ga0495607_0004032_3966_4559 197
126 3300046501 Ga0495607_0040201 Ga0495607_0040201_2147_2740 197
127 3300046501 Ga0495607_0264365 Ga0495607_0264365_47_640 197
128 3300046506 Ga0495583_0007672 Ga0495583_0007672_5980_6573 197
129 3300046513 Ga0495616_0038566 Ga0495616_0038566_1702_2295 197
130 3300046513 Ga0495616_0100557 Ga0495616_0100557_529_1122 197
131 3300046517 Ga0495630_0087913 Ga0495630_0087913_1361_2005 197
132 3300046518 Ga0495631_0001464 Ga0495631_0001464_12623_13216 197
133 3300046519 Ga0495632_0000077 Ga0495632_0000077_55767_56360 197
134 3300046519 Ga0495632_0000129 Ga0495632_0000129_43680_44273 197
135 3300046519 Ga0495632_0000375 Ga0495632_0000375_20166_20759 197
136 3300046520 Ga0495637_0046850 Ga0495637_0046850_1218_1811 197
137 3300046522 Ga0495643_0000567 Ga0495643_0000567_29032_29625 197
138 3300046524 Ga0495648_0055635 Ga0495648_0055635_1281_1874 197
139 3300046526 Ga0495666_0021155 Ga0495666_0021155_993_1586 197
140 3300046526 Ga0495666_0023273 Ga0495666_0023273_519_1160 197
141 3300046528 Ga0495642_0080114 Ga0495642_0080114_31_624 197
142 3300046530 Ga0495654_0008948 Ga0495654_0008948_4480_5073 197
143 3300046536 Ga0495587_0013636 Ga0495587_0013636_2037_2681 197
144 3300046542 Ga0495597_0001519 Ga0495597_0001519_14886_15479 197
145 3300046557 Ga0495622_0027202 Ga0495622_0027202_249_890 197
146 3300046616 Ga0495668_0000274 Ga0495668_0000274_26871_27464 197
147 3300046616 Ga0495668_0000544 Ga0495668_0000544_30037_30630 197
148 3300046665 Ga0495661_0017463 Ga0495661_0017463_3326_3919 197
149 3300046665 Ga0495661_0057392 Ga0495661_0057392_19_612 197
150 3300046694 Ga0495649_0015559 Ga0495649_0015559_3425_4018 197
151 3300046810 Ga0495660_0013746 Ga0495660_0013746_3134_3727 197
152 3300046810 Ga0495660_0224563 Ga0495660_0224563_248_841 197
153 3300047315 Ga0495581_0012247 Ga0495581_0012247_2313_2957 197
154 3300047317 Ga0495604_0042475 Ga0495604_0042475_2636_3280 197
155 3300047321 Ga0495676_0013666 Ga0495676_0013666_3740_4381 197
156 3300047444 Ga0495675_0136480 Ga0495675_0136480_596_1240 197
157 3300047444 Ga0495675_0149395 Ga0495675_0149395_35_628 197
158 3300047445 Ga0495677_0004477 Ga0495677_0004477_113_706 197
159 3300047446 Ga0495679_030828 Ga0495679_030828_150_743 197
160 3300047447 Ga0495685_007067 Ga0495685_007067_1298_1891 197
161 3300047673 Ga0495593_0032009 Ga0495593_0032009_1451_2095 197
162 3300048088 Ga0495602_0145995 Ga0495602_0145995_20_664 197
163 3300048091 Ga0495626_0003588 Ga0495626_0003588_3179_3772 197
164 3300048091 Ga0495626_0005710 Ga0495626_0005710_6258_6851 197
165 3300048091 Ga0495626_0006035 Ga0495626_0006035_2099_2692 197
166 3300048913 Ga0496110_0150029 Ga0496110_0150029_799_1392 197
167 3300048914 Ga0496111_0009513 Ga0496111_0009513_170_763 197
168 3300048927 Ga0496124_0031219 Ga0496124_0031219_3353_3946 197
169 3300049459 Ga0495678_000316 Ga0495678_000316_17932_18525 197
170 3300049459 Ga0495678_001703 Ga0495678_001703_455_1048 197
171 iso_pu_bacteria 2643221664 2644358200 197
172 3300021361 Ga0213872_10000763 Ga0213872_1000076321 198
173 3300021361 Ga0213872_10006091 Ga0213872_100060912 198
174 3300021361 Ga0213872_10076865 Ga0213872_100768652 198
175 3300039447 Ga0436361_0298962 Ga0436361_0298962_898_1545 198
176 3300039447 Ga0436361_0310853 Ga0436361_0310853_12288_12884 198
177 3300039447 Ga0436361_0367502 Ga0436361_0367502_2431_3027 198
178 3300039447 Ga0436361_0768142 Ga0436361_0768142_45958_46554 198
179 3300046452 Ga0495617_000002 Ga0495617_000002_622777_623373 198
180 3300046453 Ga0495627_000207 Ga0495627_000207_31564_32160 198
181 3300046453 Ga0495627_016542 Ga0495627_016542_1158_1754 198
182 3300046463 Ga0495653_0017874 Ga0495653_0017874_1455_2051 198
183 3300046474 Ga0495605_0000293 Ga0495605_0000293_11777_12373 198
184 3300046491 Ga0495584_0014023 Ga0495584_0014023_1418_2014 198
185 3300046492 Ga0495585_0034948 Ga0495585_0034948_744_1340 198
186 3300046499 Ga0495594_0007895 Ga0495594_0007895_4266_4862 198
187 3300046500 Ga0495596_0006431 Ga0495596_0006431_4644_5240 198
188 3300046500 Ga0495596_0060516 Ga0495596_0060516_661_1257 198
189 3300046501 Ga0495607_0003557 Ga0495607_0003557_5779_6375 198
190 3300046507 Ga0495606_0128817 Ga0495606_0128817_209_805 198
191 3300046513 Ga0495616_0027210 Ga0495616_0027210_2078_2674 198
192 3300046513 Ga0495616_0052803 Ga0495616_0052803_1129_1725 198
193 3300046518 Ga0495631_0014203 Ga0495631_0014203_1376_1972 198
194 3300046523 Ga0495644_0016214 Ga0495644_0016214_2075_2671 198
195 3300046523 Ga0495644_0018036 Ga0495644_0018036_22_618 198
196 3300046523 Ga0495644_0052731 Ga0495644_0052731_918_1514 198
197 3300046524 Ga0495648_0001105 Ga0495648_0001105_26677_27273 198
198 3300046528 Ga0495642_0000085 Ga0495642_0000085_21496_22092 198
199 3300046530 Ga0495654_0001914 Ga0495654_0001914_6604_7200 198
200 3300046530 Ga0495654_0062803 Ga0495654_0062803_575_1171 198
201 3300046535 Ga0495586_0005557 Ga0495586_0005557_5922_6518 198
202 3300046542 Ga0495597_0002642 Ga0495597_0002642_6772_7368 198
203 3300046543 Ga0495645_0204452 Ga0495645_0204452_348_944 198
204 3300046615 Ga0495656_0022620 Ga0495656_0022620_1154_1750 198
205 3300046616 Ga0495668_0000941 Ga0495668_0000941_5970_6566 198
206 3300046616 Ga0495668_0020194 Ga0495668_0020194_125_721 198
207 3300046616 Ga0495668_0039940 Ga0495668_0039940_534_1130 198
208 3300046648 Ga0495611_0004463 Ga0495611_0004463_4159_4755 198
209 3300046660 Ga0495625_0082309 Ga0495625_0082309_1080_1676 198
210 3300046663 Ga0495635_0007996 Ga0495635_0007996_174_770 198
211 3300046665 Ga0495661_0011134 Ga0495661_0011134_225_821 198
212 3300046665 Ga0495661_0025498 Ga0495661_0025498_3153_3749 198
213 3300046684 Ga0495669_0011936 Ga0495669_0011936_2633_3229 198
214 3300046684 Ga0495669_0028401 Ga0495669_0028401_796_1392 198
215 3300046689 Ga0495613_0198299 Ga0495613_0198299_768_1364 198
216 3300046692 Ga0495671_0003576 Ga0495671_0003576_7704_8300 198
217 3300046694 Ga0495649_0013521 Ga0495649_0013521_3252_3848 198
218 3300046794 Ga0495589_0004614 Ga0495589_0004614_5546_6142 198
219 3300047320 Ga0495672_0007797 Ga0495672_0007797_7302_7898 198
220 3300047322 Ga0495680_0012771 Ga0495680_0012771_5684_6280 198
221 3300047323 Ga0495683_0018861 Ga0495683_0018861_2104_2700 198
222 3300047444 Ga0495675_0001600 Ga0495675_0001600_5504_6100 198
223 3300047445 Ga0495677_0005455 Ga0495677_0005455_2004_2600 198
224 3300047445 Ga0495677_0022940 Ga0495677_0022940_1492_2088 198
225 3300047470 Ga0495681_0029032 Ga0495681_0029032_2078_2674 198
226 3300047673 Ga0495593_0041624 Ga0495593_0041624_1757_2353 198
227 3300048088 Ga0495602_0087835 Ga0495602_0087835_110_706 198
228 3300048089 Ga0495614_0013115 Ga0495614_0013115_2886_3482 198
229 3300048091 Ga0495626_0007698 Ga0495626_0007698_4667_5263 198
230 3300048091 Ga0495626_0029701 Ga0495626_0029701_376_972 198
231 3300049459 Ga0495678_050832 Ga0495678_050832_29_625 198
232 3300049460 Ga0495682_0000107 Ga0495682_0000107_50903_51499 198
233 iso_pu_bacteria 2643221556 2643798107 198
234 iso_pu_bacteria 2643221684 2644473285 198
235 iso_pu_bacteria 2808606418 2809144570 198
236 iso_pu_bacteria 2919704043 2919706771 198
237 iso_pu_bacteria 8047673197 8047678121 198
238 3300003775 Ga0055524_1000015 Ga0055524_1000015167 199
239 3300006948 Ga0099826_10000003 Ga0099826_10000003254 199
240 3300025263 Ga0209565_1023944 Ga0209565_10239441 199
241 3300025295 Ga0209564_1014599 Ga0209564_10145992 199
242 3300025299 Ga0209256_1000005 Ga0209256_1000005168 199
243 3300027666 Ga0209282_1000002 Ga0209282_1000002743 199
244 3300046455 Ga0495603_0241892 Ga0495603_0241892_121_720 199
245 3300046499 Ga0495594_0156727 Ga0495594_0156727_172_771 199
246 3300046513 Ga0495616_0000207 Ga0495616_0000207_26310_26909 199
247 3300046518 Ga0495631_0033002 Ga0495631_0033002_1609_2208 199
248 3300046519 Ga0495632_0000296 Ga0495632_0000296_22840_23439 199
249 3300046528 Ga0495642_0000285 Ga0495642_0000285_25115_25714 199
250 3300046542 Ga0495597_0000226 Ga0495597_0000226_13961_14560 199
251 3300046542 Ga0495597_0000958 Ga0495597_0000958_8285_8884 199
252 3300046660 Ga0495625_0015455 Ga0495625_0015455_3972_4571 199
253 3300046674 Ga0495588_0192769 Ga0495588_0192769_329_928 199
254 3300046680 Ga0495646_0409921 Ga0495646_0409921_35_634 199
255 3300046810 Ga0495660_0023409 Ga0495660_0023409_1078_1677 199
256 3300047315 Ga0495581_0209799 Ga0495581_0209799_474_1073 199
257 iso_pu_bacteria 2858688981 2858691479 199
258 3300013307 Ga0157372_10390962 Ga0157372_103909622 200
259 3300044842 Ga0466957_0004412 Ga0466957_0004412_5052_5762 200
260 3300047320 Ga0495672_0001178 Ga0495672_0001178_5815_6417 200
261 3300048091 Ga0495626_0000003 Ga0495626_0000003_395760_396362 200
262 3300048927 Ga0496124_0018475 Ga0496124_0018475_1538_2140 200
263 3300046472 Ga0495580_0055866 Ga0495580_0055866_253_858 201
264 3300046473 Ga0495582_0006734 Ga0495582_0006734_5657_6262 201
265 3300046517 Ga0495630_0023901 Ga0495630_0023901_3782_4387 201
266 3300046526 Ga0495666_0011477 Ga0495666_0011477_3776_4381 201
267 3300046529 Ga0495652_0004715 Ga0495652_0004715_3234_3839 201
268 3300046531 Ga0495665_0018035 Ga0495665_0018035_2552_3157 201
269 3300046535 Ga0495586_0082910 Ga0495586_0082910_639_1244 201
270 3300046642 Ga0495634_0004059 Ga0495634_0004059_1185_1790 201
271 3300046665 Ga0495661_0001170 Ga0495661_0001170_19560_20165 201
272 3300046809 Ga0495600_0365675 Ga0495600_0365675_76_681 201
273 3300047317 Ga0495604_0022685 Ga0495604_0022685_1225_1830 201
274 3300047322 Ga0495680_0302837 Ga0495680_0302837_181_786 201
275 3300047444 Ga0495675_0058743 Ga0495675_0058743_641_1246 201
276 3300048903 Ga0496100_0394876 Ga0496100_0394876_88_693 201
277 3300048912 Ga0496109_0009157 Ga0496109_0009157_856_1461 201
278 3300048916 Ga0496113_0006466 Ga0496113_0006466_1138_1743 201
279 3300048925 Ga0496122_0000445 Ga0496122_0000445_55821_56426 201
280 3300048926 Ga0496123_0001531 Ga0496123_0001531_1186_1791 201
281 3300048928 Ga0496125_0002859 Ga0496125_0002859_15251_15856 201
282 3300002987 JGI25159J45721_1001038 JGI25159J45721_10010388 202
283 3300004625 Ga0055543_1012304 Ga0055543_10123042 202
284 3300004625 Ga0055543_1024313 Ga0055543_10243131 202
285 3300005262 Ga0065165_1000455 Ga0065165_100045526 202
286 3300005262 Ga0065165_1001096 Ga0065165_100109631 202
287 3300005327 Ga0070658_10169217 Ga0070658_101692172 202
288 3300005336 Ga0070680_100058181 Ga0070680_1000581812 202
289 3300005366 Ga0070659_100095367 Ga0070659_1000953672 202
290 3300005366 Ga0070659_100373820 Ga0070659_1003738201 202
291 3300005563 Ga0068855_100046129 Ga0068855_1000461292 202
292 3300005563 Ga0068855_100258502 Ga0068855_1002585022 202
293 3300005563 Ga0068855_100654863 Ga0068855_1006548632 202
294 3300005564 Ga0070664_100322601 Ga0070664_1003226012 202
295 3300009036 Ga0105244_10025698 Ga0105244_100256983 202
296 3300009093 Ga0105240_10223997 Ga0105240_102239972 202
297 3300009098 Ga0105245_10185822 Ga0105245_101858221 202
298 3300009176 Ga0105242_10063790 Ga0105242_100637902 202
299 3300009551 Ga0105238_10107863 Ga0105238_101078632 202
300 3300021361 Ga0213872_10001321 Ga0213872_1000132115 202
301 3300021361 Ga0213872_10056960 Ga0213872_100569602 202
302 3300025230 Ga0209563_100015 Ga0209563_100015121 202
303 3300025253 Ga0209677_104059 Ga0209677_1040593 202
304 3300025284 Ga0209130_1000296 Ga0209130_100029632 202
305 3300025909 Ga0207705_10014048 Ga0207705_100140483 202
306 3300025909 Ga0207705_10791527 Ga0207705_107915271 202
307 3300025911 Ga0207654_10027385 Ga0207654_100273852 202
308 3300025917 Ga0207660_10044463 Ga0207660_100444632 202
309 3300025919 Ga0207657_10345046 Ga0207657_103450462 202
310 3300025924 Ga0207694_10097446 Ga0207694_100974462 202
311 3300025932 Ga0207690_10016643 Ga0207690_100166432 202
312 3300025933 Ga0207706_10223391 Ga0207706_102233912 202
313 3300025944 Ga0207661_10919818 Ga0207661_109198181 202
314 3300025945 Ga0207679_10506113 Ga0207679_105061131 202
315 3300025949 Ga0207667_10052904 Ga0207667_100529043 202
316 3300025949 Ga0207667_10525432 Ga0207667_105254322 202
317 3300037312 Ga0395899_0000715 Ga0395899_0000715_24698_25312 202
318 3300037312 Ga0395899_0034324 Ga0395899_0034324_112_726 202
319 3300037312 Ga0395899_0164004 Ga0395899_0164004_784_1398 202
320 3300037312 Ga0395899_0338452 Ga0395899_0338452_147_761 202
321 3300037418 Ga0395900_0000298 Ga0395900_0000298_69605_70219 202
322 3300037418 Ga0395900_0000372 Ga0395900_0000372_26931_27545 202
323 3300037418 Ga0395900_0002819 Ga0395900_0002819_8654_9268 202
324 3300037418 Ga0395900_0069892 Ga0395900_0069892_878_1492 202
325 3300037418 Ga0395900_0203257 Ga0395900_0203257_482_1096 202
326 3300037418 Ga0395900_0244296 Ga0395900_0244296_250_864 202
327 3300037418 Ga0395900_0431720 Ga0395900_0431720_475_1089 202
328 3300037418 Ga0395900_0445082 Ga0395900_0445082_487_1101 202
329 3300037418 Ga0395900_0670340 Ga0395900_0670340_116_730 202
330 3300037466 Ga0395898_0022854 Ga0395898_0022854_2472_3086 202
331 3300037466 Ga0395898_0034127 Ga0395898_0034127_3121_3735 202
332 3300037466 Ga0395898_0114084 Ga0395898_0114084_1010_1624 202
333 3300037466 Ga0395898_0190337 Ga0395898_0190337_84_698 202
334 3300037466 Ga0395898_0250961 Ga0395898_0250961_320_934 202
335 3300037466 Ga0395898_0407475 Ga0395898_0407475_369_983 202
336 3300037466 Ga0395898_0506331 Ga0395898_0506331_477_1091 202
337 3300037466 Ga0395898_0559173 Ga0395898_0559173_105_719 202
338 3300037471 Ga0395905_0069536 Ga0395905_0069536_724_1338 202
339 3300037471 Ga0395905_0096368 Ga0395905_0096368_665_1279 202
340 3300037471 Ga0395905_0101127 Ga0395905_0101127_1194_1808 202
341 3300037471 Ga0395905_0318312 Ga0395905_0318312_245_859 202
342 3300038443 Ga0395901_0001123 Ga0395901_0001123_26184_26798 202
343 3300038443 Ga0395901_0004045 Ga0395901_0004045_12573_13187 202
344 3300038443 Ga0395901_0223314 Ga0395901_0223314_217_831 202
345 3300038443 Ga0395901_0269160 Ga0395901_0269160_80_694 202
346 3300038443 Ga0395901_0295721 Ga0395901_0295721_851_1465 202
347 3300038443 Ga0395901_0328465 Ga0395901_0328465_66_680 202
348 3300038443 Ga0395901_0427381 Ga0395901_0427381_635_1249 202
349 3300038443 Ga0395901_0443463 Ga0395901_0443463_145_759 202
350 3300038443 Ga0395901_1007703 Ga0395901_1007703_30_644 202
351 3300039447 Ga0436361_0709224 Ga0436361_0709224_1121_1735 202
352 3300039447 Ga0436361_0856154 Ga0436361_0856154_8920_9543 202
353 3300042005 Ga0439448_0006205 Ga0439448_0006205_2634_3248 202
354 3300042008 Ga0439450_103080 Ga0439450_103080_91_705 202
355 3300042012 Ga0439455_0001966 Ga0439455_0001966_1207_1821 202
356 3300042157 Ga0439458_0029107 Ga0439458_0029107_32_646 202
357 3300044656 Ga0466969_0156856 Ga0466969_0156856_90_704 202
358 3300044683 Ga0466965_0008829 Ga0466965_0008829_3149_3763 202
359 3300044683 Ga0466965_0020221 Ga0466965_0020221_2160_2774 202
360 3300044684 Ga0466966_0175000 Ga0466966_0175000_399_1013 202
361 3300044693 Ga0466961_0076924 Ga0466961_0076924_384_998 202
362 3300044693 Ga0466961_0095070 Ga0466961_0095070_523_1137 202
363 3300044693 Ga0466961_0104614 Ga0466961_0104614_1141_1755 202
364 3300044693 Ga0466961_0137729 Ga0466961_0137729_615_1229 202
365 3300044706 Ga0466964_0002408 Ga0466964_0002408_5112_5726 202
366 3300044706 Ga0466964_0002452 Ga0466964_0002452_2362_2976 202
367 3300044706 Ga0466964_0082701 Ga0466964_0082701_332_946 202
368 3300044719 Ga0466971_0235826 Ga0466971_0235826_121_735 202
369 3300044735 Ga0466968_0003377 Ga0466968_0003377_2836_3450 202
370 3300044765 Ga0466970_0023276 Ga0466970_0023276_230_844 202
371 3300044765 Ga0466970_0112789 Ga0466970_0112789_364_978 202
372 3300044842 Ga0466957_0011780 Ga0466957_0011780_1432_2046 202
373 3300044842 Ga0466957_0016488 Ga0466957_0016488_2215_2829 202
374 3300044842 Ga0466957_0131043 Ga0466957_0131043_60_674 202
375 3300044842 Ga0466957_0169517 Ga0466957_0169517_377_991 202
376 3300045049 Ga0466959_0012554 Ga0466959_0012554_4209_4823 202
377 3300045049 Ga0466959_0349310 Ga0466959_0349310_13_627 202
378 3300045836 Ga0466958_0036401 Ga0466958_0036401_1089_1703 202
379 3300045836 Ga0466958_0247105 Ga0466958_0247105_358_972 202
380 3300045836 Ga0466958_0256889 Ga0466958_0256889_156_770 202
381 3300045976 Ga0466967_0037103 Ga0466967_0037103_2062_2676 202
382 3300045976 Ga0466967_0038386 Ga0466967_0038386_2019_2633 202
383 3300045976 Ga0466967_0106129 Ga0466967_0106129_1854_2468 202
384 3300046463 Ga0495653_0027841 Ga0495653_0027841_604_1212 202
385 3300046471 Ga0495650_0000124 Ga0495650_0000124_153415_154023 202
386 3300046473 Ga0495582_0029455 Ga0495582_0029455_1820_2431 202
387 3300046473 Ga0495582_0068834 Ga0495582_0068834_255_866 202
388 3300046474 Ga0495605_0000034 Ga0495605_0000034_158780_159394 202
389 3300046474 Ga0495605_0022908 Ga0495605_0022908_2429_3040 202
390 3300046474 Ga0495605_0057241 Ga0495605_0057241_1017_1631 202
391 3300046491 Ga0495584_0000255 Ga0495584_0000255_8585_9199 202
392 3300046491 Ga0495584_0002306 Ga0495584_0002306_353_967 202
393 3300046491 Ga0495584_0222407 Ga0495584_0222407_144_773 202
394 3300046492 Ga0495585_0281756 Ga0495585_0281756_129_740 202
395 3300046499 Ga0495594_0018988 Ga0495594_0018988_1906_2565 202
396 3300046499 Ga0495594_0376084 Ga0495594_0376084_63_674 202
397 3300046500 Ga0495596_0017894 Ga0495596_0017894_1096_1704 202
398 3300046500 Ga0495596_0019506 Ga0495596_0019506_792_1403 202
399 3300046500 Ga0495596_0020124 Ga0495596_0020124_179_787 202
400 3300046500 Ga0495596_0079574 Ga0495596_0079574_76_684 202
401 3300046501 Ga0495607_0000398 Ga0495607_0000398_27474_28088 202
402 3300046501 Ga0495607_0023486 Ga0495607_0023486_338_952 202
403 3300046501 Ga0495607_0073512 Ga0495607_0073512_559_1167 202
404 3300046501 Ga0495607_0136454 Ga0495607_0136454_128_739 202
405 3300046501 Ga0495607_0139572 Ga0495607_0139572_271_885 202
406 3300046507 Ga0495606_0004415 Ga0495606_0004415_183_797 202
407 3300046507 Ga0495606_0018764 Ga0495606_0018764_2293_2901 202
408 3300046513 Ga0495616_0060290 Ga0495616_0060290_1205_1819 202
409 3300046518 Ga0495631_0014136 Ga0495631_0014136_118_726 202
410 3300046519 Ga0495632_0016131 Ga0495632_0016131_3442_4050 202
411 3300046522 Ga0495643_0001819 Ga0495643_0001819_14600_15208 202
412 3300046522 Ga0495643_0007860 Ga0495643_0007860_5837_6451 202
413 3300046524 Ga0495648_0004314 Ga0495648_0004314_177_791 202
414 3300046528 Ga0495642_0001143 Ga0495642_0001143_8374_8988 202
415 3300046528 Ga0495642_0011900 Ga0495642_0011900_1584_2192 202
416 3300046528 Ga0495642_0056789 Ga0495642_0056789_680_1291 202
417 3300046528 Ga0495642_0109457 Ga0495642_0109457_443_1054 202
418 3300046538 Ga0495609_0000002 Ga0495609_0000002_388109_388723 202
419 3300046538 Ga0495609_0001432 Ga0495609_0001432_170_778 202
420 3300046538 Ga0495609_0029292 Ga0495609_0029292_127_741 202
421 3300046615 Ga0495656_0155360 Ga0495656_0155360_233_847 202
422 3300046616 Ga0495668_0155468 Ga0495668_0155468_501_1109 202
423 3300046648 Ga0495611_0091057 Ga0495611_0091057_238_849 202
424 3300046660 Ga0495625_0096763 Ga0495625_0096763_1315_1926 202
425 3300046665 Ga0495661_0000281 Ga0495661_0000281_22378_22992 202
426 3300046665 Ga0495661_0028318 Ga0495661_0028318_2323_2937 202
427 3300046665 Ga0495661_0031180 Ga0495661_0031180_1960_2574 202
428 3300046674 Ga0495588_0000177 Ga0495588_0000177_61808_62422 202
429 3300046684 Ga0495669_0000092 Ga0495669_0000092_26602_27213 202
430 3300046691 Ga0495670_0006596 Ga0495670_0006596_2336_2947 202
431 3300046794 Ga0495589_0000128 Ga0495589_0000128_34643_35257 202
432 3300046794 Ga0495589_0000230 Ga0495589_0000230_23777_24391 202
433 3300046810 Ga0495660_0000026 Ga0495660_0000026_206960_207574 202
434 3300046810 Ga0495660_0007209 Ga0495660_0007209_5793_6401 202
435 3300047320 Ga0495672_0001659 Ga0495672_0001659_19217_19825 202
436 3300047320 Ga0495672_0008194 Ga0495672_0008194_360_974 202
437 3300047323 Ga0495683_0006353 Ga0495683_0006353_4988_5596 202
438 3300047443 Ga0495687_000013 Ga0495687_000013_348133_348747 202
439 3300047443 Ga0495687_000280 Ga0495687_000280_41060_41674 202
440 3300047443 Ga0495687_000337 Ga0495687_000337_30138_30752 202
441 3300047444 Ga0495675_0129774 Ga0495675_0129774_229_837 202
442 3300047445 Ga0495677_0000041 Ga0495677_0000041_34941_35555 202
443 3300047445 Ga0495677_0000104 Ga0495677_0000104_13763_14371 202
444 3300047445 Ga0495677_0000925 Ga0495677_0000925_3706_4320 202
445 3300047472 Ga0495686_0000656 Ga0495686_0000656_16176_16784 202
446 3300048088 Ga0495602_0008084 Ga0495602_0008084_5882_6490 202
447 3300048091 Ga0495626_0000383 Ga0495626_0000383_21714_22328 202
448 3300048091 Ga0495626_0000478 Ga0495626_0000478_25182_25796 202
449 3300048091 Ga0495626_0004649 Ga0495626_0004649_4498_5106 202
450 3300048904 Ga0496101_0357714 Ga0496101_0357714_512_1126 202
451 3300048906 Ga0496103_0337555 Ga0496103_0337555_205_819 202
452 3300048907 Ga0496104_0525833 Ga0496104_0525833_123_737 202
453 3300048908 Ga0496105_0174773 Ga0496105_0174773_492_1106 202
454 3300048909 Ga0496106_0009983 Ga0496106_0009983_3065_3679 202
455 3300048910 Ga0496107_0566928 Ga0496107_0566928_35_649 202
456 3300048910 Ga0496107_0575200 Ga0496107_0575200_141_755 202
457 3300048912 Ga0496109_0356571 Ga0496109_0356571_273_887 202
458 3300048913 Ga0496110_0299972 Ga0496110_0299972_65_679 202
459 3300048916 Ga0496113_0146283 Ga0496113_0146283_26_640 202
460 3300048917 Ga0496114_0038094 Ga0496114_0038094_1687_2301 202
461 3300048925 Ga0496122_0001558 Ga0496122_0001558_18210_18824 202
462 3300048925 Ga0496122_0023667 Ga0496122_0023667_679_1293 202
463 3300048926 Ga0496123_0020515 Ga0496123_0020515_2538_3152 202
464 3300048926 Ga0496123_0170610 Ga0496123_0170610_398_1012 202
465 3300048927 Ga0496124_0012065 Ga0496124_0012065_4865_5479 202
466 3300048927 Ga0496124_0194656 Ga0496124_0194656_318_932 202
467 3300048927 Ga0496124_0216952 Ga0496124_0216952_813_1427 202
468 3300049822 Ga0501035_0003556 Ga0501035_0003556_10114_10728 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09186

DUF1949

Domain of unknown function (DUF1949)

170

225

0.98

PF01205

UPF0029

Uncharacterized protein family UPF0029

52

154

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cve-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein tt1547 from thermus thermophilus hb8 0.9139 3 193
2cve-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein tt1547 from thermus thermophilus hb8 0.9049 3 193
7oya-assembly1.cif.gz_v2 cryo-em structure of the 1 hpf zebrafish embryo 80s ribosome 0.8704 131 193
4wk3-assembly1.cif.gz_A structure of staphyloccus aureus psta 0.8447 129 193
4ro5-assembly1.cif.gz_A crystal structure of the sat domain from the non-reducing fungal polyketide synthase cazm 0.8254 129 193
ID Description Score Start End Superfamily
af_Q2G059_1_130_3.30.230.30 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain 0.9433 1 124 3.30.230.30
af_Q6ZJC5_65_187_3.30.230.30 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain 0.9416 3 126 3.30.230.30
af_P27862_1_132_3.30.230.30 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain 0.9358 1 125 3.30.230.30
af_Q6ZJC5_65_187_3.30.230.30 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain 0.927 3 126 3.30.230.30
2wbmB03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9262 128 193 3.30.70.240
ID Description Score Start End GO Terms
AF-A0A4Y6KQ28-F1-model_v4 IMPACT family protein 0.9725 1 194 GO:0005737
GO:0006446
GO:0017111
AF-C9YG92-F1-model_v4 IMPACT family member YigZ 0.9711 1 201 GO:0005737
GO:0006446
GO:0016805
GO:0017111
AF-B2JNM8-F1-model_v4 Impact N-terminal domain-containing protein 0.9626 2 195 GO:0005737
GO:0006446
GO:0017111
AF-C9YG92-F1-model_v4 IMPACT family member YigZ 0.9617 1 201 GO:0005737
GO:0006446
GO:0016805
GO:0017111
AF-A0A7C6L6S6-F1-model_v4 YigZ family protein 0.957 2 124 GO:0005737
GO:0006446

Feature Viewer

pLDDT pTM Quality
89.88 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map