F450085

General Info

Members Datasets Scaffolds Average Seq Length
468 181 468 76

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0044892|Ga0466969_0044892_67_294
Length 69
Sequence MDDDTARRRLLVYSLLRFGGVAIFFLGGLVRPGGWPQVGAIVAIVGVLDALLAPHLLKRAWDRQDQEDQ

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
140 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
141 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
142 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
175 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
176 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
177 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 1.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.06
Rhizosphere 95.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1046959 3300001915 Unclassified 635
2 JGI24741J21665_1068349 3300001915 Bacteria 526
3 JGI24740J21852_10000347 3300001979 Bacteria 19765
4 JGI24740J21852_10085495 3300001979 Unclassified 820
5 JGI24739J22299_10025342 3300001989 Bacteria 2086
6 JGI24739J22299_10102976 3300001989 Bacteria 861
7 JGI24737J22298_10002262 3300001990 Bacteria 6862
8 JGI24737J22298_10024647 3300001990 Bacteria 1905
9 JGI24737J22298_10210776 3300001990 Bacteria 573
10 JGI24735J21928_10071544 3300002067 Bacteria 993
11 JGI24735J21928_10115300 3300002067 Bacteria 773
12 JGI24738J21930_10006068 3300002075 Bacteria 2859
13 Ga0065715_10311770 3300005293 Bacteria 1019
14 Ga0070658_10005858 3300005327 Bacteria 9966
15 Ga0070658_10023792 3300005327 Bacteria 4913
16 Ga0070658_10094540 3300005327 Bacteria 2466
17 Ga0070658_10245800 3300005327 Bacteria 1517
18 Ga0070658_10360807 3300005327 Bacteria 1244
19 Ga0070658_10436619 3300005327 Bacteria 1127
20 Ga0070658_10453989 3300005327 Bacteria 1104
21 Ga0070676_10133758 3300005328 Bacteria 1571
22 Ga0070676_10856087 3300005328 Bacteria 674
23 Ga0070683_100002263 3300005329 Bacteria 15247
24 Ga0070683_100163502 3300005329 Bacteria 2112
25 Ga0070683_100274516 3300005329 Bacteria 1603
26 Ga0070683_102260946 3300005329 Bacteria 522
27 Ga0070670_100043672 3300005331 Bacteria 3853
28 Ga0070670_100468110 3300005331 Bacteria 1118
29 Ga0068869_101435119 3300005334 Unclassified 611
30 Ga0070666_11275969 3300005335 Bacteria 548
31 Ga0070680_100725275 3300005336 Unclassified 855
32 Ga0070682_100044377 3300005337 Bacteria 2752
33 Ga0070682_100141821 3300005337 Bacteria 1639
34 Ga0070660_100018067 3300005339 Bacteria 5146
35 Ga0070660_100047401 3300005339 Bacteria 3298
36 Ga0070660_100117522 3300005339 Bacteria 2121
37 Ga0070660_100201613 3300005339 Bacteria 1614
38 Ga0070689_100338807 3300005340 Bacteria 1259
39 Ga0070691_10370465 3300005341 Bacteria 800
40 Ga0070661_100000079 3300005344 Bacteria 77180
41 Ga0070661_100465512 3300005344 Bacteria 1007
42 Ga0070661_100746323 3300005344 Unclassified 800
43 Ga0070692_10005986 3300005345 Bacteria 5241
44 Ga0070692_10259732 3300005345 Bacteria 1043
45 Ga0070692_11015380 3300005345 Unclassified 581
46 Ga0070668_100094415 3300005347 Bacteria 2361
47 Ga0070668_100115554 3300005347 Bacteria 2139
48 Ga0070671_100000469 3300005355 Bacteria 28112
49 Ga0070674_101526644 3300005356 Unclassified 601
50 Ga0070673_100011976 3300005364 Bacteria 5940
51 Ga0070659_100000165 3300005366 Bacteria 51041
52 Ga0070659_100009589 3300005366 Bacteria 7117
53 Ga0070659_100040172 3300005366 Bacteria 3655
54 Ga0070659_100116178 3300005366 Bacteria 2163
55 Ga0070659_100466524 3300005366 Bacteria 1073
56 Ga0070659_101035345 3300005366 Unclassified 722
57 Ga0070659_101995759 3300005366 Bacteria 521
58 Ga0070667_100048153 3300005367 Bacteria 3588
59 Ga0070667_100622352 3300005367 Bacteria 995
60 Ga0070714_100016527 3300005435 Bacteria 5962
61 Ga0070714_100170013 3300005435 Bacteria 1978
62 Ga0070711_101254363 3300005439 Bacteria 642
63 Ga0070694_100021437 3300005444 Bacteria 4129
64 Ga0070663_100039111 3300005455 Bacteria 3313
65 Ga0070663_100046594 3300005455 Bacteria 3068
66 Ga0070663_100338414 3300005455 Bacteria 1215
67 Ga0070678_101509708 3300005456 Unclassified 629
68 Ga0070662_100000171 3300005457 Bacteria 37981
69 Ga0070662_100035087 3300005457 Bacteria 3540
70 Ga0070662_100847759 3300005457 Bacteria 778
71 Ga0070681_10266803 3300005458 Bacteria 1623
72 Ga0070681_10595238 3300005458 Bacteria 1020
73 Ga0070679_100557698 3300005530 Unclassified 1089
74 Ga0070679_100819771 3300005530 Bacteria 874
75 Ga0070679_101180509 3300005530 Bacteria 710
76 Ga0070684_100047459 3300005535 Bacteria 3721
77 Ga0070684_100078898 3300005535 Bacteria 2910
78 Ga0070684_101259097 3300005535 Bacteria 696
79 Ga0068853_100001092 3300005539 Bacteria 19210
80 Ga0068853_100226159 3300005539 Bacteria 1710
81 Ga0068853_100244195 3300005539 Bacteria 1646
82 Ga0070672_100072263 3300005543 Bacteria 2747
83 Ga0070672_100131765 3300005543 Bacteria 2055
84 Ga0070695_100854064 3300005545 Unclassified 733
85 Ga0070693_100025521 3300005547 Bacteria 3182
86 Ga0070693_100196301 3300005547 Bacteria 1308
87 Ga0070693_100618726 3300005547 Bacteria 784
88 Ga0070665_100051379 3300005548 Bacteria 4134
89 Ga0070665_100802632 3300005548 Bacteria 954
90 Ga0068855_100000447 3300005563 Bacteria 51000
91 Ga0068855_100033747 3300005563 Bacteria 6105
92 Ga0068855_100303136 3300005563 Bacteria 1769
93 Ga0068855_100342434 3300005563 Bacteria 1648
94 Ga0068855_100400098 3300005563 Bacteria 1505
95 Ga0068855_100843430 3300005563 Bacteria 971
96 Ga0068855_102379090 3300005563 Bacteria 529
97 Ga0070664_100000311 3300005564 Bacteria 35468
98 Ga0070664_100028355 3300005564 Bacteria 4656
99 Ga0070664_100065894 3300005564 Bacteria 3092
100 Ga0070664_100213687 3300005564 Bacteria 1724
101 Ga0070664_101265454 3300005564 Bacteria 696
102 Ga0068857_100102630 3300005577 Bacteria 2567
103 Ga0068857_100519082 3300005577 Bacteria 1119
104 Ga0068854_100087253 3300005578 Bacteria 2314
105 Ga0068854_100112215 3300005578 Bacteria 2058
106 Ga0068854_100129837 3300005578 Bacteria 1923
107 Ga0068854_101356755 3300005578 Bacteria 641
108 Ga0068856_100000979 3300005614 Bacteria 30480
109 Ga0068856_100464532 3300005614 Bacteria 1286
110 Ga0068856_100483881 3300005614 Bacteria 1259
111 Ga0068856_101035692 3300005614 Unclassified 839
112 Ga0068852_100003556 3300005616 Bacteria 10908
113 Ga0068852_100070138 3300005616 Bacteria 3074
114 Ga0068852_100488257 3300005616 Bacteria 1225
115 Ga0068852_100579464 3300005616 Bacteria 1125
116 Ga0068852_100627385 3300005616 Bacteria 1081
117 Ga0068852_100805057 3300005616 Bacteria 954
118 Ga0068852_101009712 3300005616 Bacteria 851
119 Ga0068852_101250219 3300005616 Bacteria 764
120 Ga0068859_100086475 3300005617 Bacteria 3182
121 Ga0068859_100319174 3300005617 Bacteria 1647
122 Ga0068859_102954601 3300005617 Bacteria 520
123 Ga0068864_100014358 3300005618 Bacteria 6578
124 Ga0068864_100056884 3300005618 Bacteria 3379
125 Ga0068864_101003407 3300005618 Bacteria 828
126 Ga0068861_102352209 3300005719 Unclassified 535
127 Ga0068851_10385298 3300005834 Bacteria 822
128 Ga0068851_10413462 3300005834 Bacteria 795
129 Ga0068851_10526635 3300005834 Bacteria 712
130 Ga0068851_10856120 3300005834 Archaea 567
131 Ga0068863_100181544 3300005841 Bacteria 2020
132 Ga0068863_100411942 3300005841 Bacteria 1323
133 Ga0068858_100103557 3300005842 Bacteria 2655
134 Ga0068858_100134540 3300005842 Bacteria 2319
135 Ga0068858_101323856 3300005842 Bacteria 709
136 Ga0068860_100049833 3300005843 Bacteria 3987
137 Ga0068860_100811544 3300005843 Bacteria 949
138 Ga0068860_100857480 3300005843 Bacteria 923
139 Ga0068862_100090518 3300005844 Bacteria 2664
140 Ga0068862_100103021 3300005844 Bacteria 2499
141 Ga0068862_101616454 3300005844 Bacteria 655
142 Ga0081540_1301444 3300005983 Unclassified 551
143 Ga0070712_100072236 3300006175 Bacteria 2471
144 Ga0097621_100081827 3300006237 Bacteria 2688
145 Ga0075434_100402937 3300006871 Bacteria 1389
146 Ga0068865_101133098 3300006881 Unclassified 690
147 Ga0097620_100086474 3300006931 Bacteria 3182
148 Ga0097620_100319172 3300006931 Bacteria 1647
149 Ga0097620_102954580 3300006931 Bacteria 520
150 Ga0105245_10010041 3300009098 Bacteria 8246
151 Ga0105245_10066363 3300009098 Bacteria 3265
152 Ga0105247_10174779 3300009101 Bacteria 1430
153 Ga0105243_10102278 3300009148 Bacteria 2380
154 Ga0105241_11956675 3300009174 Bacteria 576
155 Ga0105248_10000117 3300009177 Bacteria 90169
156 Ga0105248_10000928 3300009177 Bacteria 32626
157 Ga0105248_10808920 3300009177 Bacteria 1058
158 Ga0105248_13469399 3300009177 Bacteria 501
159 Ga0105238_10461603 3300009551 Bacteria 1268
160 Ga0105238_11657522 3300009551 Unclassified 670
161 Ga0105238_11685393 3300009551 Unclassified 665
162 Ga0105249_10115630 3300009553 Bacteria 2542
163 Ga0105249_10317648 3300009553 Bacteria 1568
164 Ga0105239_10249089 3300010375 Bacteria 1995
165 Ga0157373_10050008 3300013100 Bacteria 2978
166 Ga0157373_10129775 3300013100 Bacteria 1772
167 Ga0157373_10159823 3300013100 Bacteria 1585
168 Ga0157373_10220017 3300013100 Bacteria 1339
169 Ga0157373_10257038 3300013100 Unclassified 1236
170 Ga0157371_10007113 3300013102 Bacteria 9092
171 Ga0157371_10045436 3300013102 Bacteria 3125
172 Ga0157371_10085985 3300013102 Bacteria 2227
173 Ga0157371_10135757 3300013102 Bacteria 1752
174 Ga0157371_10224221 3300013102 Bacteria 1350
175 Ga0157371_10246233 3300013102 Bacteria 1287
176 Ga0157371_11311736 3300013102 Bacteria 560
177 Ga0157370_10005854 3300013104 Bacteria 13734
178 Ga0157369_10132324 3300013105 Bacteria 2642
179 Ga0157369_10191511 3300013105 Bacteria 2149
180 Ga0157369_10452744 3300013105 Bacteria 1329
181 Ga0157369_12625009 3300013105 Archaea 509
182 Ga0157374_10160267 3300013296 Bacteria 2191
183 Ga0163162_10219424 3300013306 Bacteria 2031
184 Ga0163162_12397024 3300013306 Bacteria 607
185 Ga0157372_10056479 3300013307 Bacteria 4386
186 Ga0157372_10675845 3300013307 Bacteria 1202
187 Ga0157372_10933962 3300013307 Bacteria 1006
188 Ga0157372_12893046 3300013307 Bacteria 550
189 Ga0163163_10000380 3300014325 Bacteria 42243
190 Ga0157380_11246825 3300014326 Bacteria 789
191 Ga0157379_10018659 3300014968 Bacteria 6115
192 Ga0157379_10601696 3300014968 Bacteria 1026
193 Ga0157376_11035965 3300014969 Bacteria 844
194 Ga0206354_11010786 3300020081 Bacteria 910
195 Ga0206354_11689322 3300020081 Bacteria 506
196 Ga0206353_10036903 3300020082 Bacteria 1636
197 Ga0206353_10395856 3300020082 Bacteria 807
198 Ga0206353_10651727 3300020082 Bacteria 1030
199 Ga0207656_10175714 3300025321 Bacteria 1026
200 Ga0207656_10547265 3300025321 Archaea 589
201 Ga0207688_10341880 3300025901 Unclassified 921
202 Ga0207680_10383235 3300025903 Bacteria 991
203 Ga0207647_10000181 3300025904 Bacteria 50570
204 Ga0207647_10045581 3300025904 Bacteria 2735
205 Ga0207645_10140419 3300025907 Bacteria 1574
206 Ga0207645_10430539 3300025907 Bacteria 889
207 Ga0207705_10000222 3300025909 Bacteria 56707
208 Ga0207705_10021882 3300025909 Bacteria 4562
209 Ga0207705_10027115 3300025909 Bacteria 4083
210 Ga0207705_10063711 3300025909 Bacteria 2663
211 Ga0207705_10087387 3300025909 Bacteria 2279
212 Ga0207705_10827435 3300025909 Bacteria 718
213 Ga0207707_11086963 3300025912 Bacteria 652
214 Ga0207693_10306726 3300025915 Bacteria 1243
215 Ga0207660_10806249 3300025917 Unclassified 766
216 Ga0207660_11570031 3300025917 Bacteria 531
217 Ga0207657_10000378 3300025919 Bacteria 47118
218 Ga0207657_10032225 3300025919 Bacteria 4738
219 Ga0207657_10033167 3300025919 Bacteria 4657
220 Ga0207657_10067669 3300025919 Bacteria 3036
221 Ga0207657_10183324 3300025919 Bacteria 1691
222 Ga0207657_10184034 3300025919 Bacteria 1688
223 Ga0207657_10288906 3300025919 Bacteria 1301
224 Ga0207649_10000135 3300025920 Bacteria 63197
225 Ga0207649_10627939 3300025920 Unclassified 828
226 Ga0207649_10984839 3300025920 Bacteria 663
227 Ga0207652_10254521 3300025921 Bacteria 1584
228 Ga0207652_10716299 3300025921 Bacteria 892
229 Ga0207652_11054165 3300025921 Bacteria 713
230 Ga0207652_11057012 3300025921 Bacteria 712
231 Ga0207681_11152625 3300025923 Bacteria 651
232 Ga0207694_10390810 3300025924 Bacteria 1156
233 Ga0207650_10327292 3300025925 Bacteria 1256
234 Ga0207650_10451380 3300025925 Bacteria 1070
235 Ga0207687_10119611 3300025927 Bacteria 1968
236 Ga0207687_10136559 3300025927 Bacteria 1855
237 Ga0207664_10015281 3300025929 Bacteria 5566
238 Ga0207664_11053135 3300025929 Bacteria 728
239 Ga0207644_10000514 3300025931 Bacteria 25001
240 Ga0207690_10000509 3300025932 Bacteria 25193
241 Ga0207690_10016605 3300025932 Bacteria 4483
242 Ga0207690_10064682 3300025932 Bacteria 2498
243 Ga0207690_10093676 3300025932 Bacteria 2129
244 Ga0207690_10172477 3300025932 Bacteria 1622
245 Ga0207690_10308885 3300025932 Bacteria 1240
246 Ga0207690_11776569 3300025932 Bacteria 515
247 Ga0207706_10000513 3300025933 Bacteria 41181
248 Ga0207706_10003711 3300025933 Bacteria 14568
249 Ga0207706_10041755 3300025933 Bacteria 4065
250 Ga0207706_10689993 3300025933 Bacteria 873
251 Ga0207706_11724490 3300025933 Unclassified 504
252 Ga0207709_10173550 3300025935 Bacteria 1515
253 Ga0207670_10224779 3300025936 Bacteria 1439
254 Ga0207691_10114518 3300025940 Bacteria 2396
255 Ga0207711_10000243 3300025941 Bacteria 58447
256 Ga0207711_10000558 3300025941 Bacteria 37953
257 Ga0207711_10019840 3300025941 Bacteria 5603
258 Ga0207689_10019298 3300025942 Bacteria 5747
259 Ga0207661_10014630 3300025944 Bacteria 5754
260 Ga0207661_11021612 3300025944 Bacteria 761
261 Ga0207679_10000460 3300025945 Bacteria 28726
262 Ga0207679_10001962 3300025945 Bacteria 12761
263 Ga0207679_10063699 3300025945 Bacteria 2753
264 Ga0207679_10083792 3300025945 Bacteria 2445
265 Ga0207679_10549011 3300025945 Bacteria 1036
266 Ga0207679_10811697 3300025945 Unclassified 853
267 Ga0207667_10001204 3300025949 Bacteria 32354
268 Ga0207667_10016616 3300025949 Bacteria 8308
269 Ga0207667_10073272 3300025949 Bacteria 3558
270 Ga0207667_10161775 3300025949 Bacteria 2302
271 Ga0207667_10407694 3300025949 Bacteria 1384
272 Ga0207667_10814284 3300025949 Bacteria 930
273 Ga0207667_12185851 3300025949 Bacteria 511
274 Ga0207651_10009419 3300025960 Bacteria 5347
275 Ga0207712_10030569 3300025961 Bacteria 3622
276 Ga0207712_10089088 3300025961 Bacteria 2268
277 Ga0207668_10066451 3300025972 Bacteria 2556
278 Ga0207668_10082200 3300025972 Bacteria 2339
279 Ga0207640_10066880 3300025981 Bacteria 2402
280 Ga0207640_10111282 3300025981 Bacteria 1942
281 Ga0207640_10227387 3300025981 Bacteria 1433
282 Ga0207658_10089384 3300025986 Bacteria 2384
283 Ga0207658_11542865 3300025986 Bacteria 607
284 Ga0207677_10780757 3300026023 Bacteria 854
285 Ga0207703_10118506 3300026035 Bacteria 2270
286 Ga0207703_10350678 3300026035 Bacteria 1359
287 Ga0207703_11809556 3300026035 Unclassified 587
288 Ga0207639_10034273 3300026041 Bacteria 3752
289 Ga0207639_10364832 3300026041 Bacteria 1293
290 Ga0207678_10013189 3300026067 Bacteria 7252
291 Ga0207678_10159123 3300026067 Bacteria 1929
292 Ga0207678_10373036 3300026067 Bacteria 1233
293 Ga0207678_11328863 3300026067 Bacteria 636
294 Ga0207702_10001066 3300026078 Bacteria 28071
295 Ga0207702_10145868 3300026078 Bacteria 2148
296 Ga0207702_11060757 3300026078 Bacteria 804
297 Ga0207641_10412507 3300026088 Bacteria 1299
298 Ga0207676_10004790 3300026095 Bacteria 9602
299 Ga0207676_10125046 3300026095 Bacteria 2176
300 Ga0207674_10017715 3300026116 Bacteria 7763
301 Ga0207674_10311866 3300026116 Bacteria 1522
302 Ga0207674_10654524 3300026116 Bacteria 1014
303 Ga0207698_10000675 3300026142 Bacteria 19796
304 Ga0207698_10068739 3300026142 Bacteria 2798
305 Ga0207698_10268060 3300026142 Bacteria 1572
306 Ga0207698_10449694 3300026142 Bacteria 1243
307 Ga0207698_10630541 3300026142 Bacteria 1060
308 Ga0207698_11686466 3300026142 Bacteria 649
309 Ga0268266_10010722 3300028379 Bacteria 7985
310 Ga0268266_11110496 3300028379 Bacteria 765
311 Ga0268265_10012968 3300028380 Bacteria 5659
312 Ga0268265_10064990 3300028380 Bacteria 2813
313 Ga0268265_11295721 3300028380 Unclassified 728
314 Ga0268264_10003847 3300028381 Bacteria 12881
315 Ga0268264_10829830 3300028381 Bacteria 925
316 Ga0307408_100211859 3300031548 Bacteria 1575
317 Ga0307408_100482126 3300031548 Bacteria 1082
318 Ga0307408_101666864 3300031548 Bacteria 607
319 Ga0307405_10013485 3300031731 Bacteria 4362
320 Ga0307405_10519927 3300031731 Bacteria 957
321 Ga0307413_10013600 3300031824 Bacteria 4097
322 Ga0307413_10026213 3300031824 Bacteria 3209
323 Ga0307413_10369447 3300031824 Bacteria 1113
324 Ga0307413_10385950 3300031824 Bacteria 1093
325 Ga0307413_11233279 3300031824 Unclassified 652
326 Ga0307410_10002679 3300031852 Bacteria 8686
327 Ga0307410_10115030 3300031852 Bacteria 1952
328 Ga0307410_10540571 3300031852 Unclassified 964
329 Ga0307410_10583197 3300031852 Unclassified 930
330 Ga0307410_11007696 3300031852 Bacteria 718
331 Ga0307410_11178017 3300031852 Bacteria 667
332 Ga0307406_10037962 3300031901 Bacteria 2979
333 Ga0307407_10019722 3300031903 Bacteria 3439
334 Ga0307407_11522004 3300031903 Bacteria 529
335 Ga0307407_11665729 3300031903 Unclassified 507
336 Ga0307412_10696308 3300031911 Bacteria 871
337 Ga0307412_11507188 3300031911 Bacteria 611
338 Ga0307409_100026845 3300031995 Bacteria 4069
339 Ga0307409_100221168 3300031995 Bacteria 1709
340 Ga0307409_100248891 3300031995 Bacteria 1623
341 Ga0307409_100272925 3300031995 Bacteria 1558
342 Ga0307409_100606584 3300031995 Bacteria 1082
343 Ga0307409_101099931 3300031995 Bacteria 816
344 Ga0307409_102028576 3300031995 Bacteria 605
345 Ga0307416_100003493 3300032002 Bacteria 9243
346 Ga0307416_101481255 3300032002 Bacteria 784
347 Ga0307414_10102556 3300032004 Bacteria 2156
348 Ga0307414_10187610 3300032004 Bacteria 1670
349 Ga0307414_10412054 3300032004 Bacteria 1176
350 Ga0307414_10602318 3300032004 Bacteria 985
351 Ga0307414_10684182 3300032004 Bacteria 927
352 Ga0307411_10191078 3300032005 Bacteria 1563
353 Ga0307411_10460301 3300032005 Bacteria 1066
354 Ga0307411_10705076 3300032005 Bacteria 879
355 Ga0307411_10838147 3300032005 Bacteria 812
356 Ga0307411_12223384 3300032005 Bacteria 514
357 Ga0307415_100008828 3300032126 Bacteria 5611
358 Ga0307415_100714621 3300032126 Bacteria 906
359 Ga0307415_100849367 3300032126 Bacteria 837
360 Ga0373958_0043241 3300034819 Bacteria 928
361 Ga0373959_0040663 3300034820 Bacteria 974
362 Ga0373929_0005703 3300035085 Bacteria 2246
363 Ga0373941_0529449 3300035115 Unclassified 505
364 Ga0395899_0013200 3300037312 Bacteria 6320
365 Ga0395899_0109034 3300037312 Bacteria 1992
366 Ga0395899_0161842 3300037312 Bacteria 1580
367 Ga0395899_0221623 3300037312 Bacteria 1310
368 Ga0395899_0246494 3300037312 Bacteria 1227
369 Ga0395899_0250509 3300037312 Bacteria 1215
370 Ga0395899_0268964 3300037312 Unclassified 1163
371 Ga0395899_0323421 3300037312 Bacteria 1038
372 Ga0395899_0425261 3300037312 Bacteria 874
373 Ga0395899_0451564 3300037312 Bacteria 841
374 Ga0395900_0019881 3300037418 Bacteria 6846
375 Ga0395900_0033961 3300037418 Bacteria 5250
376 Ga0395900_0062881 3300037418 Bacteria 3815
377 Ga0395900_0084972 3300037418 Bacteria 3252
378 Ga0395900_0207662 3300037418 Bacteria 1978
379 Ga0395900_0383205 3300037418 Bacteria 1373
380 Ga0395900_0542502 3300037418 Bacteria 1108
381 Ga0395900_0583623 3300037418 Bacteria 1059
382 Ga0395900_0738167 3300037418 Bacteria 916
383 Ga0395900_1091394 3300037418 Bacteria 715
384 Ga0395900_1432795 3300037418 Bacteria 603
385 Ga0395900_1842547 3300037418 Bacteria 515
386 Ga0395900_1901914 3300037418 Unclassified 505
387 Ga0395898_0115205 3300037466 Bacteria 2575
388 Ga0395898_0140346 3300037466 Bacteria 2313
389 Ga0395898_0315510 3300037466 Bacteria 1491
390 Ga0395898_0321213 3300037466 Bacteria 1477
391 Ga0395898_0478049 3300037466 Bacteria 1185
392 Ga0395898_0629883 3300037466 Bacteria 1015
393 Ga0395905_0007664 3300037471 Bacteria 10715
394 Ga0395905_0063946 3300037471 Bacteria 3442
395 Ga0395905_0106888 3300037471 Bacteria 2627
396 Ga0395905_0112556 3300037471 Bacteria 2556
397 Ga0395905_0128376 3300037471 Bacteria 2384
398 Ga0395905_0216251 3300037471 Bacteria 1794
399 Ga0395905_0233270 3300037471 Bacteria 1720
400 Ga0395905_0233776 3300037471 Bacteria 1718
401 Ga0395905_0350311 3300037471 Bacteria 1368
402 Ga0395905_0446148 3300037471 Bacteria 1191
403 Ga0395905_0507302 3300037471 Bacteria 1106
404 Ga0395905_0531359 3300037471 Unclassified 1077
405 Ga0395905_0709073 3300037471 Unclassified 908
406 Ga0395905_1779419 3300037471 Bacteria 522
407 Ga0395901_0049408 3300038443 Bacteria 4370
408 Ga0395901_0074241 3300038443 Bacteria 3548
409 Ga0395901_0143740 3300038443 Bacteria 2507
410 Ga0395901_0290579 3300038443 Bacteria 1696
411 Ga0395901_0304591 3300038443 Bacteria 1651
412 Ga0395901_0449193 3300038443 Bacteria 1318
413 Ga0395901_0499494 3300038443 Bacteria 1238
414 Ga0395901_0594478 3300038443 Bacteria 1116
415 Ga0395901_0674102 3300038443 Bacteria 1034
416 Ga0395901_0732568 3300038443 Bacteria 983
417 Ga0395901_0758783 3300038443 Bacteria 962
418 Ga0395901_0759827 3300038443 Bacteria 962
419 Ga0466969_0044892 3300044656 Bacteria 2196
420 Ga0466966_0250647 3300044684 Bacteria 1066
421 Ga0466966_0846612 3300044684 Bacteria 551
422 Ga0466961_0275430 3300044693 Bacteria 1030
423 Ga0466963_0046907 3300044694 Bacteria 2850
424 Ga0466963_0073336 3300044694 Bacteria 2307
425 Ga0466963_0084381 3300044694 Bacteria 2155
426 Ga0466971_0058365 3300044719 Bacteria 1742
427 Ga0466957_0328617 3300044842 Bacteria 1033
428 Ga0466959_0080519 3300045049 Bacteria 2347
429 Ga0466959_0629057 3300045049 Bacteria 721
430 Ga0466958_0245483 3300045836 Bacteria 1144
431 Ga0466967_0028602 3300045976 Bacteria 4655
432 Ga0466967_0100563 3300045976 Bacteria 2642
433 Ga0466967_0724331 3300045976 Bacteria 986
434 Ga0466967_1065016 3300045976 Bacteria 805
435 Ga0466967_1978653 3300045976 Bacteria 579
436 Ga0495639_0497820 3300046475 Bacteria 622
437 Ga0495588_0730575 3300046674 Unclassified 518
438 Ga0495669_0020108 3300046684 Bacteria 2886
439 Ga0496100_0014427 3300048903 Bacteria 4586
440 Ga0496101_0004188 3300048904 Bacteria 9038
441 Ga0496101_0177776 3300048904 Bacteria 1638
442 Ga0496102_0696555 3300048905 Unclassified 939
443 Ga0496106_0000666 3300048909 Bacteria 24598
444 Ga0496106_1380920 3300048909 Bacteria 545
445 Ga0496107_0000181 3300048910 Bacteria 32803
446 Ga0496107_0170686 3300048910 Bacteria 1614
447 Ga0496107_0559367 3300048910 Bacteria 847
448 Ga0496108_0000229 3300048911 Bacteria 50203
449 Ga0496108_0101492 3300048911 Bacteria 2454
450 Ga0496108_0227384 3300048911 Bacteria 1622
451 Ga0496109_0000774 3300048912 Bacteria 26581
452 Ga0496109_0612406 3300048912 Bacteria 1025
453 Ga0496110_0000647 3300048913 Bacteria 23828
454 Ga0496111_0010055 3300048914 Bacteria 6330
455 Ga0496112_0000354 3300048915 Bacteria 29882
456 Ga0496112_0679861 3300048915 Bacteria 958
457 Ga0496113_0012911 3300048916 Bacteria 5633
458 Ga0501070_0018388 3300049586 Bacteria 5864
459 Ga0501071_0667052 3300049587 Bacteria 800
460 Ga0501074_0675150 3300049590 Bacteria 729
461 Ga0501233_043566 3300049668 Bacteria 1064
462 Ga0501247_024071 3300049677 Bacteria 804
463 Ga0501249_031732 3300049679 Bacteria 1180
464 Ga0501225_0231371 3300049705 Bacteria 600
465 Ga0501080_0238337 3300049742 Bacteria 1661
466 Ga0501268_089910 3300049765 Bacteria 645
467 nmdc:mga0n895_625483_c1 3300050512 Bacteria 1077
468 Ga0466962_0054774 3300061719 Bacteria 1906

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035115 Ga0373941_0529449 Ga0373941_0529449_286_486 66
2 3300044656 Ga0466969_0044892 Ga0466969_0044892_67_294 69
3 3300044684 Ga0466966_0250647 Ga0466966_0250647_151_378 69
4 3300044693 Ga0466961_0275430 Ga0466961_0275430_287_514 69
5 3300044694 Ga0466963_0046907 Ga0466963_0046907_1317_1544 69
6 3300045049 Ga0466959_0080519 Ga0466959_0080519_1323_1550 69
7 3300045836 Ga0466958_0245483 Ga0466958_0245483_704_931 69
8 3300005366 Ga0070659_100040172 Ga0070659_1000401726 71
9 3300005834 Ga0068851_10856120 Ga0068851_108561202 71
10 3300025321 Ga0207656_10547265 Ga0207656_105472652 71
11 3300025932 Ga0207690_10016605 Ga0207690_100166057 71
12 3300009551 Ga0105238_11685393 Ga0105238_116853932 72
13 3300013105 Ga0157369_12625009 Ga0157369_126250092 72
14 3300031548 Ga0307408_100211859 Ga0307408_1002118592 72
15 3300031731 Ga0307405_10519927 Ga0307405_105199272 72
16 3300031824 Ga0307413_10026213 Ga0307413_100262135 72
17 3300031824 Ga0307413_10369447 Ga0307413_103694472 72
18 3300031852 Ga0307410_10115030 Ga0307410_101150303 72
19 3300031852 Ga0307410_10540571 Ga0307410_105405711 72
20 3300031852 Ga0307410_10583197 Ga0307410_105831972 72
21 3300031903 Ga0307407_11522004 Ga0307407_115220042 72
22 3300031903 Ga0307407_11665729 Ga0307407_116657292 72
23 3300031911 Ga0307412_10696308 Ga0307412_106963082 72
24 3300031911 Ga0307412_11507188 Ga0307412_115071882 72
25 3300031995 Ga0307409_100221168 Ga0307409_1002211682 72
26 3300031995 Ga0307409_100248891 Ga0307409_1002488912 72
27 3300031995 Ga0307409_100606584 Ga0307409_1006065843 72
28 3300032002 Ga0307416_101481255 Ga0307416_1014812552 72
29 3300032004 Ga0307414_10187610 Ga0307414_101876102 72
30 3300032004 Ga0307414_10412054 Ga0307414_104120542 72
31 3300032005 Ga0307411_10705076 Ga0307411_107050762 72
32 3300032005 Ga0307411_10838147 Ga0307411_108381472 72
33 3300032005 Ga0307411_12223384 Ga0307411_122233842 72
34 3300032126 Ga0307415_100849367 Ga0307415_1008493672 72
35 3300005547 Ga0070693_100196301 Ga0070693_1001963012 73
36 3300005618 Ga0068864_101003407 Ga0068864_1010034072 73
37 3300025945 Ga0207679_10063699 Ga0207679_100636994 73
38 3300006175 Ga0070712_100072236 Ga0070712_1000722363 74
39 3300025915 Ga0207693_10306726 Ga0207693_103067262 74
40 3300031548 Ga0307408_101666864 Ga0307408_1016668642 74
41 3300031824 Ga0307413_10385950 Ga0307413_103859502 74
42 3300031852 Ga0307410_11007696 Ga0307410_110076962 74
43 3300031995 Ga0307409_100272925 Ga0307409_1002729252 74
44 3300032005 Ga0307411_10460301 Ga0307411_104603012 74
45 3300032126 Ga0307415_100714621 Ga0307415_1007146212 74
46 3300049668 Ga0501233_043566 Ga0501233_043566_557_784 74
47 3300049677 Ga0501247_024071 Ga0501247_024071_303_530 74
48 3300049679 Ga0501249_031732 Ga0501249_031732_465_692 74
49 3300049705 Ga0501225_0231371 Ga0501225_0231371_89_316 74
50 3300049765 Ga0501268_089910 Ga0501268_089910_181_408 74
51 3300001915 JGI24741J21665_1068349 JGI24741J21665_10683492 75
52 3300001989 JGI24739J22299_10025342 JGI24739J22299_100253423 75
53 3300001990 JGI24737J22298_10002262 JGI24737J22298_100022627 75
54 3300001990 JGI24737J22298_10024647 JGI24737J22298_100246473 75
55 3300002067 JGI24735J21928_10115300 JGI24735J21928_101153002 75
56 3300002075 JGI24738J21930_10006068 JGI24738J21930_100060684 75
57 3300005293 Ga0065715_10311770 Ga0065715_103117702 75
58 3300005327 Ga0070658_10005858 Ga0070658_1000585811 75
59 3300005327 Ga0070658_10436619 Ga0070658_104366192 75
60 3300005328 Ga0070676_10133758 Ga0070676_101337583 75
61 3300005328 Ga0070676_10856087 Ga0070676_108560872 75
62 3300005329 Ga0070683_100002263 Ga0070683_1000022639 75
63 3300005331 Ga0070670_100043672 Ga0070670_1000436723 75
64 3300005331 Ga0070670_100468110 Ga0070670_1004681102 75
65 3300005334 Ga0068869_101435119 Ga0068869_1014351192 75
66 3300005335 Ga0070666_11275969 Ga0070666_112759692 75
67 3300005337 Ga0070682_100141821 Ga0070682_1001418212 75
68 3300005339 Ga0070660_100018067 Ga0070660_1000180672 75
69 3300005339 Ga0070660_100047401 Ga0070660_1000474012 75
70 3300005339 Ga0070660_100117522 Ga0070660_1001175222 75
71 3300005340 Ga0070689_100338807 Ga0070689_1003388072 75
72 3300005344 Ga0070661_100000079 Ga0070661_10000007977 75
73 3300005345 Ga0070692_10005986 Ga0070692_100059866 75
74 3300005347 Ga0070668_100094415 Ga0070668_1000944152 75
75 3300005347 Ga0070668_100115554 Ga0070668_1001155541 75
76 3300005356 Ga0070674_101526644 Ga0070674_1015266441 75
77 3300005366 Ga0070659_100000165 Ga0070659_10000016532 75
78 3300005366 Ga0070659_100009589 Ga0070659_1000095899 75
79 3300005366 Ga0070659_101995759 Ga0070659_1019957591 75
80 3300005367 Ga0070667_100048153 Ga0070667_1000481532 75
81 3300005367 Ga0070667_100622352 Ga0070667_1006223521 75
82 3300005435 Ga0070714_100016527 Ga0070714_1000165276 75
83 3300005444 Ga0070694_100021437 Ga0070694_1000214375 75
84 3300005455 Ga0070663_100039111 Ga0070663_1000391113 75
85 3300005455 Ga0070663_100338414 Ga0070663_1003384143 75
86 3300005456 Ga0070678_101509708 Ga0070678_1015097082 75
87 3300005457 Ga0070662_100000171 Ga0070662_10000017117 75
88 3300005457 Ga0070662_100035087 Ga0070662_1000350874 75
89 3300005530 Ga0070679_100557698 Ga0070679_1005576981 75
90 3300005535 Ga0070684_100078898 Ga0070684_1000788985 75
91 3300005539 Ga0068853_100001092 Ga0068853_1000010922 75
92 3300005539 Ga0068853_100244195 Ga0068853_1002441952 75
93 3300005543 Ga0070672_100131765 Ga0070672_1001317653 75
94 3300005545 Ga0070695_100854064 Ga0070695_1008540641 75
95 3300005547 Ga0070693_100025521 Ga0070693_1000255215 75
96 3300005548 Ga0070665_100051379 Ga0070665_1000513793 75
97 3300005548 Ga0070665_100802632 Ga0070665_1008026322 75
98 3300005563 Ga0068855_100000447 Ga0068855_10000044732 75
99 3300005563 Ga0068855_100033747 Ga0068855_1000337474 75
100 3300005563 Ga0068855_100400098 Ga0068855_1004000982 75
101 3300005563 Ga0068855_102379090 Ga0068855_1023790902 75
102 3300005564 Ga0070664_100000311 Ga0070664_10000031113 75
103 3300005564 Ga0070664_100028355 Ga0070664_1000283552 75
104 3300005577 Ga0068857_100102630 Ga0068857_1001026302 75
105 3300005578 Ga0068854_100087253 Ga0068854_1000872532 75
106 3300005578 Ga0068854_100112215 Ga0068854_1001122152 75
107 3300005614 Ga0068856_100000979 Ga0068856_10000097913 75
108 3300005614 Ga0068856_101035692 Ga0068856_1010356922 75
109 3300005616 Ga0068852_100003556 Ga0068852_1000035565 75
110 3300005616 Ga0068852_100070138 Ga0068852_1000701384 75
111 3300005616 Ga0068852_100805057 Ga0068852_1008050572 75
112 3300005616 Ga0068852_101009712 Ga0068852_1010097122 75
113 3300005616 Ga0068852_101250219 Ga0068852_1012502192 75
114 3300005617 Ga0068859_100086475 Ga0068859_1000864755 75
115 3300005617 Ga0068859_100319174 Ga0068859_1003191742 75
116 3300005618 Ga0068864_100056884 Ga0068864_1000568842 75
117 3300005719 Ga0068861_102352209 Ga0068861_1023522092 75
118 3300005834 Ga0068851_10413462 Ga0068851_104134622 75
119 3300005834 Ga0068851_10526635 Ga0068851_105266352 75
120 3300005841 Ga0068863_100411942 Ga0068863_1004119422 75
121 3300005842 Ga0068858_100103557 Ga0068858_1001035572 75
122 3300005842 Ga0068858_100134540 Ga0068858_1001345404 75
123 3300005842 Ga0068858_101323856 Ga0068858_1013238562 75
124 3300005843 Ga0068860_100049833 Ga0068860_1000498335 75
125 3300005843 Ga0068860_100811544 Ga0068860_1008115442 75
126 3300005843 Ga0068860_100857480 Ga0068860_1008574802 75
127 3300005844 Ga0068862_100090518 Ga0068862_1000905182 75
128 3300005844 Ga0068862_100103021 Ga0068862_1001030213 75
129 3300005844 Ga0068862_101616454 Ga0068862_1016164542 75
130 3300005983 Ga0081540_1301444 Ga0081540_13014442 75
131 3300006237 Ga0097621_100081827 Ga0097621_1000818275 75
132 3300006871 Ga0075434_100402937 Ga0075434_1004029372 75
133 3300006881 Ga0068865_101133098 Ga0068865_1011330982 75
134 3300006931 Ga0097620_100086474 Ga0097620_1000864745 75
135 3300006931 Ga0097620_100319172 Ga0097620_1003191722 75
136 3300009098 Ga0105245_10066363 Ga0105245_100663632 75
137 3300009101 Ga0105247_10174779 Ga0105247_101747792 75
138 3300009148 Ga0105243_10102278 Ga0105243_101022783 75
139 3300009174 Ga0105241_11956675 Ga0105241_119566752 75
140 3300009177 Ga0105248_10000117 Ga0105248_1000011776 75
141 3300009177 Ga0105248_10808920 Ga0105248_108089202 75
142 3300009177 Ga0105248_13469399 Ga0105248_134693992 75
143 3300009551 Ga0105238_10461603 Ga0105238_104616032 75
144 3300009553 Ga0105249_10115630 Ga0105249_101156301 75
145 3300009553 Ga0105249_10317648 Ga0105249_103176483 75
146 3300010375 Ga0105239_10249089 Ga0105239_102490892 75
147 3300013100 Ga0157373_10050008 Ga0157373_100500082 75
148 3300013102 Ga0157371_10007113 Ga0157371_100071139 75
149 3300013102 Ga0157371_10085985 Ga0157371_100859854 75
150 3300013104 Ga0157370_10005854 Ga0157370_1000585414 75
151 3300013105 Ga0157369_10132324 Ga0157369_101323244 75
152 3300013296 Ga0157374_10160267 Ga0157374_101602673 75
153 3300013306 Ga0163162_10219424 Ga0163162_102194242 75
154 3300013306 Ga0163162_12397024 Ga0163162_123970242 75
155 3300013307 Ga0157372_12893046 Ga0157372_128930462 75
156 3300014325 Ga0163163_10000380 Ga0163163_1000038022 75
157 3300014326 Ga0157380_11246825 Ga0157380_112468252 75
158 3300014968 Ga0157379_10018659 Ga0157379_100186597 75
159 3300014968 Ga0157379_10601696 Ga0157379_106016962 75
160 3300014969 Ga0157376_11035965 Ga0157376_110359652 75
161 3300020081 Ga0206354_11010786 Ga0206354_110107862 75
162 3300025321 Ga0207656_10175714 Ga0207656_101757142 75
163 3300025901 Ga0207688_10341880 Ga0207688_103418802 75
164 3300025903 Ga0207680_10383235 Ga0207680_103832352 75
165 3300025904 Ga0207647_10000181 Ga0207647_1000018124 75
166 3300025904 Ga0207647_10045581 Ga0207647_100455812 75
167 3300025907 Ga0207645_10140419 Ga0207645_101404193 75
168 3300025907 Ga0207645_10430539 Ga0207645_104305392 75
169 3300025909 Ga0207705_10000222 Ga0207705_1000022229 75
170 3300025919 Ga0207657_10000378 Ga0207657_1000037822 75
171 3300025919 Ga0207657_10033167 Ga0207657_100331675 75
172 3300025919 Ga0207657_10067669 Ga0207657_100676692 75
173 3300025919 Ga0207657_10288906 Ga0207657_102889062 75
174 3300025920 Ga0207649_10000135 Ga0207649_100001358 75
175 3300025923 Ga0207681_11152625 Ga0207681_111526252 75
176 3300025924 Ga0207694_10390810 Ga0207694_103908102 75
177 3300025925 Ga0207650_10327292 Ga0207650_103272921 75
178 3300025925 Ga0207650_10451380 Ga0207650_104513802 75
179 3300025927 Ga0207687_10119611 Ga0207687_101196113 75
180 3300025927 Ga0207687_10136559 Ga0207687_101365594 75
181 3300025929 Ga0207664_10015281 Ga0207664_100152813 75
182 3300025932 Ga0207690_10000509 Ga0207690_100005092 75
183 3300025932 Ga0207690_10064682 Ga0207690_100646822 75
184 3300025932 Ga0207690_11776569 Ga0207690_117765691 75
185 3300025933 Ga0207706_10000513 Ga0207706_1000051326 75
186 3300025933 Ga0207706_10003711 Ga0207706_100037112 75
187 3300025933 Ga0207706_10689993 Ga0207706_106899932 75
188 3300025935 Ga0207709_10173550 Ga0207709_101735503 75
189 3300025936 Ga0207670_10224779 Ga0207670_102247792 75
190 3300025940 Ga0207691_10114518 Ga0207691_101145182 75
191 3300025941 Ga0207711_10000558 Ga0207711_1000055818 75
192 3300025941 Ga0207711_10019840 Ga0207711_100198409 75
193 3300025942 Ga0207689_10019298 Ga0207689_100192988 75
194 3300025944 Ga0207661_10014630 Ga0207661_100146304 75
195 3300025945 Ga0207679_10000460 Ga0207679_1000046024 75
196 3300025945 Ga0207679_10001962 Ga0207679_100019629 75
197 3300025949 Ga0207667_10001204 Ga0207667_100012048 75
198 3300025949 Ga0207667_10016616 Ga0207667_100166164 75
199 3300025949 Ga0207667_10814284 Ga0207667_108142842 75
200 3300025949 Ga0207667_12185851 Ga0207667_121858512 75
201 3300025961 Ga0207712_10030569 Ga0207712_100305692 75
202 3300025961 Ga0207712_10089088 Ga0207712_100890882 75
203 3300025972 Ga0207668_10066451 Ga0207668_100664513 75
204 3300025972 Ga0207668_10082200 Ga0207668_100822004 75
205 3300025981 Ga0207640_10066880 Ga0207640_100668801 75
206 3300025981 Ga0207640_10227387 Ga0207640_102273873 75
207 3300025986 Ga0207658_10089384 Ga0207658_100893842 75
208 3300025986 Ga0207658_11542865 Ga0207658_115428652 75
209 3300026023 Ga0207677_10780757 Ga0207677_107807571 75
210 3300026035 Ga0207703_10118506 Ga0207703_101185061 75
211 3300026035 Ga0207703_10350678 Ga0207703_103506782 75
212 3300026035 Ga0207703_11809556 Ga0207703_118095562 75
213 3300026041 Ga0207639_10034273 Ga0207639_100342734 75
214 3300026041 Ga0207639_10364832 Ga0207639_103648323 75
215 3300026067 Ga0207678_10013189 Ga0207678_100131898 75
216 3300026067 Ga0207678_10373036 Ga0207678_103730362 75
217 3300026078 Ga0207702_10001066 Ga0207702_1000106633 75
218 3300026078 Ga0207702_11060757 Ga0207702_110607572 75
219 3300026088 Ga0207641_10412507 Ga0207641_104125072 75
220 3300026095 Ga0207676_10125046 Ga0207676_101250463 75
221 3300026116 Ga0207674_10311866 Ga0207674_103118662 75
222 3300026142 Ga0207698_10000675 Ga0207698_100006755 75
223 3300026142 Ga0207698_10068739 Ga0207698_100687394 75
224 3300026142 Ga0207698_10268060 Ga0207698_102680601 75
225 3300026142 Ga0207698_10449694 Ga0207698_104496942 75
226 3300028379 Ga0268266_10010722 Ga0268266_100107225 75
227 3300028379 Ga0268266_11110496 Ga0268266_111104962 75
228 3300028380 Ga0268265_10012968 Ga0268265_100129684 75
229 3300028380 Ga0268265_10064990 Ga0268265_100649902 75
230 3300028380 Ga0268265_11295721 Ga0268265_112957212 75
231 3300028381 Ga0268264_10003847 Ga0268264_1000384710 75
232 3300028381 Ga0268264_10829830 Ga0268264_108298302 75
233 3300031548 Ga0307408_100482126 Ga0307408_1004821262 75
234 3300031731 Ga0307405_10013485 Ga0307405_100134854 75
235 3300031824 Ga0307413_10013600 Ga0307413_100136004 75
236 3300031824 Ga0307413_11233279 Ga0307413_112332791 75
237 3300031852 Ga0307410_10002679 Ga0307410_100026794 75
238 3300031852 Ga0307410_11178017 Ga0307410_111780172 75
239 3300031901 Ga0307406_10037962 Ga0307406_100379624 75
240 3300031903 Ga0307407_10019722 Ga0307407_100197222 75
241 3300031995 Ga0307409_100026845 Ga0307409_1000268454 75
242 3300031995 Ga0307409_101099931 Ga0307409_1010999312 75
243 3300031995 Ga0307409_102028576 Ga0307409_1020285762 75
244 3300032002 Ga0307416_100003493 Ga0307416_10000349310 75
245 3300032004 Ga0307414_10102556 Ga0307414_101025562 75
246 3300032004 Ga0307414_10602318 Ga0307414_106023182 75
247 3300032004 Ga0307414_10684182 Ga0307414_106841822 75
248 3300032005 Ga0307411_10191078 Ga0307411_101910782 75
249 3300032126 Ga0307415_100008828 Ga0307415_1000088284 75
250 3300034819 Ga0373958_0043241 Ga0373958_0043241_343_570 75
251 3300034820 Ga0373959_0040663 Ga0373959_0040663_80_307 75
252 3300035085 Ga0373929_0005703 Ga0373929_0005703_533_763 75
253 3300037312 Ga0395899_0109034 Ga0395899_0109034_477_707 75
254 3300037312 Ga0395899_0161842 Ga0395899_0161842_440_667 75
255 3300037312 Ga0395899_0250509 Ga0395899_0250509_661_888 75
256 3300037312 Ga0395899_0323421 Ga0395899_0323421_483_713 75
257 3300037418 Ga0395900_0019881 Ga0395900_0019881_3662_3892 75
258 3300037418 Ga0395900_0033961 Ga0395900_0033961_1927_2157 75
259 3300037418 Ga0395900_0084972 Ga0395900_0084972_1934_2161 75
260 3300037418 Ga0395900_0383205 Ga0395900_0383205_903_1130 75
261 3300037418 Ga0395900_0583623 Ga0395900_0583623_180_407 75
262 3300037418 Ga0395900_0738167 Ga0395900_0738167_119_352 75
263 3300037418 Ga0395900_1842547 Ga0395900_1842547_23_250 75
264 3300037466 Ga0395898_0315510 Ga0395898_0315510_222_449 75
265 3300037471 Ga0395905_0007664 Ga0395905_0007664_5364_5594 75
266 3300037471 Ga0395905_0106888 Ga0395905_0106888_1348_1605 75
267 3300037471 Ga0395905_0112556 Ga0395905_0112556_1180_1407 75
268 3300037471 Ga0395905_0233776 Ga0395905_0233776_790_1017 75
269 3300037471 Ga0395905_0350311 Ga0395905_0350311_32_259 75
270 3300037471 Ga0395905_0446148 Ga0395905_0446148_940_1167 75
271 3300037471 Ga0395905_0507302 Ga0395905_0507302_20_247 75
272 3300037471 Ga0395905_0709073 Ga0395905_0709073_97_324 75
273 3300038443 Ga0395901_0143740 Ga0395901_0143740_790_1020 75
274 3300038443 Ga0395901_0304591 Ga0395901_0304591_1092_1319 75
275 3300038443 Ga0395901_0594478 Ga0395901_0594478_685_912 75
276 3300038443 Ga0395901_0674102 Ga0395901_0674102_409_636 75
277 3300038443 Ga0395901_0732568 Ga0395901_0732568_258_488 75
278 3300038443 Ga0395901_0759827 Ga0395901_0759827_589_846 75
279 3300044694 Ga0466963_0073336 Ga0466963_0073336_846_1082 75
280 3300045049 Ga0466959_0629057 Ga0466959_0629057_191_421 75
281 3300045976 Ga0466967_0100563 Ga0466967_0100563_1856_2083 75
282 3300045976 Ga0466967_1065016 Ga0466967_1065016_483_713 75
283 3300048904 Ga0496101_0177776 Ga0496101_0177776_1166_1393 75
284 3300048909 Ga0496106_1380920 Ga0496106_1380920_268_495 75
285 3300048910 Ga0496107_0170686 Ga0496107_0170686_720_947 75
286 3300048910 Ga0496107_0559367 Ga0496107_0559367_521_757 75
287 3300048911 Ga0496108_0000229 Ga0496108_0000229_7378_7605 75
288 3300048911 Ga0496108_0227384 Ga0496108_0227384_919_1146 75
289 3300048912 Ga0496109_0612406 Ga0496109_0612406_39_266 75
290 3300048915 Ga0496112_0679861 Ga0496112_0679861_322_549 75
291 3300050512 nmdc:mga0n895_625483_c1 nmdc:mga0n895_625483_c1_323_550 75
292 3300001915 JGI24741J21665_1046959 JGI24741J21665_10469591 76
293 3300001979 JGI24740J21852_10000347 JGI24740J21852_1000034724 76
294 3300001979 JGI24740J21852_10085495 JGI24740J21852_100854952 76
295 3300001989 JGI24739J22299_10102976 JGI24739J22299_101029762 76
296 3300001990 JGI24737J22298_10210776 JGI24737J22298_102107762 76
297 3300002067 JGI24735J21928_10071544 JGI24735J21928_100715442 76
298 3300005327 Ga0070658_10023792 Ga0070658_100237926 76
299 3300005327 Ga0070658_10094540 Ga0070658_100945403 76
300 3300005327 Ga0070658_10245800 Ga0070658_102458003 76
301 3300005327 Ga0070658_10360807 Ga0070658_103608073 76
302 3300005327 Ga0070658_10453989 Ga0070658_104539893 76
303 3300005329 Ga0070683_100163502 Ga0070683_1001635023 76
304 3300005329 Ga0070683_100274516 Ga0070683_1002745162 76
305 3300005329 Ga0070683_102260946 Ga0070683_1022609462 76
306 3300005336 Ga0070680_100725275 Ga0070680_1007252752 76
307 3300005337 Ga0070682_100044377 Ga0070682_1000443774 76
308 3300005339 Ga0070660_100201613 Ga0070660_1002016131 76
309 3300005341 Ga0070691_10370465 Ga0070691_103704652 76
310 3300005344 Ga0070661_100465512 Ga0070661_1004655121 76
311 3300005344 Ga0070661_100746323 Ga0070661_1007463232 76
312 3300005345 Ga0070692_10259732 Ga0070692_102597322 76
313 3300005345 Ga0070692_11015380 Ga0070692_110153802 76
314 3300005355 Ga0070671_100000469 Ga0070671_10000046920 76
315 3300005364 Ga0070673_100011976 Ga0070673_1000119765 76
316 3300005366 Ga0070659_100116178 Ga0070659_1001161782 76
317 3300005366 Ga0070659_100466524 Ga0070659_1004665242 76
318 3300005366 Ga0070659_101035345 Ga0070659_1010353452 76
319 3300005435 Ga0070714_100170013 Ga0070714_1001700132 76
320 3300005439 Ga0070711_101254363 Ga0070711_1012543632 76
321 3300005455 Ga0070663_100046594 Ga0070663_1000465943 76
322 3300005457 Ga0070662_100847759 Ga0070662_1008477591 76
323 3300005458 Ga0070681_10266803 Ga0070681_102668032 76
324 3300005458 Ga0070681_10595238 Ga0070681_105952382 76
325 3300005530 Ga0070679_100819771 Ga0070679_1008197712 76
326 3300005530 Ga0070679_101180509 Ga0070679_1011805091 76
327 3300005535 Ga0070684_100047459 Ga0070684_1000474596 76
328 3300005535 Ga0070684_101259097 Ga0070684_1012590972 76
329 3300005539 Ga0068853_100226159 Ga0068853_1002261593 76
330 3300005543 Ga0070672_100072263 Ga0070672_1000722631 76
331 3300005547 Ga0070693_100618726 Ga0070693_1006187262 76
332 3300005563 Ga0068855_100303136 Ga0068855_1003031362 76
333 3300005563 Ga0068855_100342434 Ga0068855_1003424343 76
334 3300005563 Ga0068855_100843430 Ga0068855_1008434302 76
335 3300005564 Ga0070664_100065894 Ga0070664_1000658944 76
336 3300005564 Ga0070664_100213687 Ga0070664_1002136873 76
337 3300005564 Ga0070664_101265454 Ga0070664_1012654542 76
338 3300005577 Ga0068857_100519082 Ga0068857_1005190822 76
339 3300005578 Ga0068854_100129837 Ga0068854_1001298372 76
340 3300005578 Ga0068854_101356755 Ga0068854_1013567552 76
341 3300005614 Ga0068856_100464532 Ga0068856_1004645322 76
342 3300005614 Ga0068856_100483881 Ga0068856_1004838813 76
343 3300005616 Ga0068852_100488257 Ga0068852_1004882572 76
344 3300005616 Ga0068852_100579464 Ga0068852_1005794641 76
345 3300005616 Ga0068852_100627385 Ga0068852_1006273852 76
346 3300005617 Ga0068859_102954601 Ga0068859_1029546012 76
347 3300005618 Ga0068864_100014358 Ga0068864_1000143588 76
348 3300005834 Ga0068851_10385298 Ga0068851_103852981 76
349 3300005841 Ga0068863_100181544 Ga0068863_1001815443 76
350 3300006931 Ga0097620_102954580 Ga0097620_1029545802 76
351 3300009098 Ga0105245_10010041 Ga0105245_100100416 76
352 3300009177 Ga0105248_10000928 Ga0105248_1000092825 76
353 3300009551 Ga0105238_11657522 Ga0105238_116575222 76
354 3300013100 Ga0157373_10129775 Ga0157373_101297754 76
355 3300013100 Ga0157373_10159823 Ga0157373_101598232 76
356 3300013100 Ga0157373_10220017 Ga0157373_102200172 76
357 3300013100 Ga0157373_10257038 Ga0157373_102570382 76
358 3300013102 Ga0157371_10045436 Ga0157371_100454364 76
359 3300013102 Ga0157371_10135757 Ga0157371_101357572 76
360 3300013102 Ga0157371_10224221 Ga0157371_102242213 76
361 3300013102 Ga0157371_10246233 Ga0157371_102462332 76
362 3300013102 Ga0157371_11311736 Ga0157371_113117361 76
363 3300013105 Ga0157369_10191511 Ga0157369_101915113 76
364 3300013105 Ga0157369_10452744 Ga0157369_104527443 76
365 3300013307 Ga0157372_10056479 Ga0157372_100564792 76
366 3300013307 Ga0157372_10675845 Ga0157372_106758452 76
367 3300013307 Ga0157372_10933962 Ga0157372_109339622 76
368 3300020081 Ga0206354_11689322 Ga0206354_116893221 76
369 3300020082 Ga0206353_10036903 Ga0206353_100369033 76
370 3300020082 Ga0206353_10395856 Ga0206353_103958562 76
371 3300020082 Ga0206353_10651727 Ga0206353_106517272 76
372 3300025909 Ga0207705_10021882 Ga0207705_100218823 76
373 3300025909 Ga0207705_10027115 Ga0207705_100271156 76
374 3300025909 Ga0207705_10063711 Ga0207705_100637113 76
375 3300025909 Ga0207705_10087387 Ga0207705_100873873 76
376 3300025909 Ga0207705_10827435 Ga0207705_108274352 76
377 3300025912 Ga0207707_11086963 Ga0207707_110869632 76
378 3300025917 Ga0207660_10806249 Ga0207660_108062492 76
379 3300025917 Ga0207660_11570031 Ga0207660_115700312 76
380 3300025919 Ga0207657_10032225 Ga0207657_100322256 76
381 3300025919 Ga0207657_10183324 Ga0207657_101833243 76
382 3300025919 Ga0207657_10184034 Ga0207657_101840342 76
383 3300025920 Ga0207649_10627939 Ga0207649_106279392 76
384 3300025920 Ga0207649_10984839 Ga0207649_109848392 76
385 3300025921 Ga0207652_10254521 Ga0207652_102545212 76
386 3300025921 Ga0207652_10716299 Ga0207652_107162992 76
387 3300025921 Ga0207652_11054165 Ga0207652_110541652 76
388 3300025921 Ga0207652_11057012 Ga0207652_110570122 76
389 3300025929 Ga0207664_11053135 Ga0207664_110531352 76
390 3300025931 Ga0207644_10000514 Ga0207644_1000051415 76
391 3300025932 Ga0207690_10093676 Ga0207690_100936763 76
392 3300025932 Ga0207690_10172477 Ga0207690_101724773 76
393 3300025932 Ga0207690_10308885 Ga0207690_103088852 76
394 3300025933 Ga0207706_10041755 Ga0207706_100417552 76
395 3300025933 Ga0207706_11724490 Ga0207706_117244902 76
396 3300025941 Ga0207711_10000243 Ga0207711_1000024329 76
397 3300025944 Ga0207661_11021612 Ga0207661_110216122 76
398 3300025945 Ga0207679_10083792 Ga0207679_100837924 76
399 3300025945 Ga0207679_10549011 Ga0207679_105490112 76
400 3300025945 Ga0207679_10811697 Ga0207679_108116972 76
401 3300025949 Ga0207667_10073272 Ga0207667_100732724 76
402 3300025949 Ga0207667_10161775 Ga0207667_101617752 76
403 3300025949 Ga0207667_10407694 Ga0207667_104076942 76
404 3300025960 Ga0207651_10009419 Ga0207651_100094196 76
405 3300025981 Ga0207640_10111282 Ga0207640_101112823 76
406 3300026067 Ga0207678_10159123 Ga0207678_101591233 76
407 3300026067 Ga0207678_11328863 Ga0207678_113288632 76
408 3300026078 Ga0207702_10145868 Ga0207702_101458682 76
409 3300026095 Ga0207676_10004790 Ga0207676_1000479010 76
410 3300026116 Ga0207674_10017715 Ga0207674_100177152 76
411 3300026116 Ga0207674_10654524 Ga0207674_106545242 76
412 3300026142 Ga0207698_10630541 Ga0207698_106305412 76
413 3300026142 Ga0207698_11686466 Ga0207698_116864662 76
414 3300037312 Ga0395899_0013200 Ga0395899_0013200_5494_5724 76
415 3300037312 Ga0395899_0221623 Ga0395899_0221623_270_503 76
416 3300037312 Ga0395899_0246494 Ga0395899_0246494_532_768 76
417 3300037312 Ga0395899_0268964 Ga0395899_0268964_295_525 76
418 3300037312 Ga0395899_0425261 Ga0395899_0425261_439_672 76
419 3300037312 Ga0395899_0451564 Ga0395899_0451564_583_819 76
420 3300037418 Ga0395900_0062881 Ga0395900_0062881_2862_3092 76
421 3300037418 Ga0395900_0207662 Ga0395900_0207662_1506_1742 76
422 3300037418 Ga0395900_0542502 Ga0395900_0542502_594_827 76
423 3300037418 Ga0395900_1091394 Ga0395900_1091394_439_675 76
424 3300037418 Ga0395900_1432795 Ga0395900_1432795_237_473 76
425 3300037418 Ga0395900_1901914 Ga0395900_1901914_112_345 76
426 3300037466 Ga0395898_0115205 Ga0395898_0115205_447_683 76
427 3300037466 Ga0395898_0140346 Ga0395898_0140346_1083_1316 76
428 3300037466 Ga0395898_0321213 Ga0395898_0321213_1118_1348 76
429 3300037466 Ga0395898_0478049 Ga0395898_0478049_172_408 76
430 3300037466 Ga0395898_0629883 Ga0395898_0629883_324_557 76
431 3300037471 Ga0395905_0063946 Ga0395905_0063946_1506_1742 76
432 3300037471 Ga0395905_0128376 Ga0395905_0128376_448_684 76
433 3300037471 Ga0395905_0216251 Ga0395905_0216251_1481_1711 76
434 3300037471 Ga0395905_0233270 Ga0395905_0233270_1072_1305 76
435 3300037471 Ga0395905_0531359 Ga0395905_0531359_768_1001 76
436 3300037471 Ga0395905_1779419 Ga0395905_1779419_15_248 76
437 3300038443 Ga0395901_0049408 Ga0395901_0049408_438_668 76
438 3300038443 Ga0395901_0074241 Ga0395901_0074241_3215_3445 76
439 3300038443 Ga0395901_0290579 Ga0395901_0290579_724_957 76
440 3300038443 Ga0395901_0449193 Ga0395901_0449193_806_1042 76
441 3300038443 Ga0395901_0499494 Ga0395901_0499494_197_433 76
442 3300038443 Ga0395901_0758783 Ga0395901_0758783_450_686 76
443 3300044684 Ga0466966_0846612 Ga0466966_0846612_35_271 76
444 3300044694 Ga0466963_0084381 Ga0466963_0084381_1885_2118 76
445 3300044719 Ga0466971_0058365 Ga0466971_0058365_620_856 76
446 3300044842 Ga0466957_0328617 Ga0466957_0328617_683_919 76
447 3300045976 Ga0466967_0028602 Ga0466967_0028602_1170_1409 76
448 3300045976 Ga0466967_0724331 Ga0466967_0724331_665_901 76
449 3300045976 Ga0466967_1978653 Ga0466967_1978653_123_362 76
450 3300046475 Ga0495639_0497820 Ga0495639_0497820_10_246 76
451 3300046674 Ga0495588_0730575 Ga0495588_0730575_176_412 76
452 3300046684 Ga0495669_0020108 Ga0495669_0020108_2325_2555 76
453 3300048903 Ga0496100_0014427 Ga0496100_0014427_2381_2611 76
454 3300048904 Ga0496101_0004188 Ga0496101_0004188_1851_2081 76
455 3300048905 Ga0496102_0696555 Ga0496102_0696555_632_865 76
456 3300048909 Ga0496106_0000666 Ga0496106_0000666_5518_5748 76
457 3300048910 Ga0496107_0000181 Ga0496107_0000181_18655_18885 76
458 3300048911 Ga0496108_0101492 Ga0496108_0101492_1468_1698 76
459 3300048912 Ga0496109_0000774 Ga0496109_0000774_7740_7970 76
460 3300048913 Ga0496110_0000647 Ga0496110_0000647_7860_8090 76
461 3300048914 Ga0496111_0010055 Ga0496111_0010055_3268_3498 76
462 3300048915 Ga0496112_0000354 Ga0496112_0000354_10679_10909 76
463 3300048916 Ga0496113_0012911 Ga0496113_0012911_3277_3507 76
464 3300049586 Ga0501070_0018388 Ga0501070_0018388_658_894 76
465 3300049587 Ga0501071_0667052 Ga0501071_0667052_154_390 76
466 3300049590 Ga0501074_0675150 Ga0501074_0675150_337_573 76
467 3300049742 Ga0501080_0238337 Ga0501080_0238337_275_511 76
468 3300061719 Ga0466962_0054774 Ga0466962_0054774_469_705 76

Feature Viewer

pLDDT pTM Quality
76.04 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map