F450067

General Info

Members Datasets Scaffolds Average Seq Length
468 200 936 195

Family's Representative Sequence

Representative Sequence 3300035112|Ga0373932_0134070|Ga0373932_0134070_117_776
Length 219
Sequence VLSSGKCDRCNSAGASNQGANTVIPRQLFIATGVLLLVAIGMSFYLWRLRSSEIQNQNTPVVTQHVAPPGGSVEQVTVWVAYDGSGTLRTQPVSIPISSGRQRRAVELLRGLVELYTAKNSPHPVKAAAEIHDVFLIDPGLAVIDVNSALVDGQVSGVLAEELTICSMVQTLAANIPGLTRVKILVDGKERETLAGHADLSGAYDVGQITELAKQLSSQ

Samples

Sample ID Description Type Environment
1 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
84 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
85 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
131 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
132 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
135 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 1.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 6.62
Rhizosphere 92.95
Stem 0
Stem Tuber 0
Unclassified 28.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373932_0134070 3300035112 Unclassified 837
2 LJNas_1000107 3300000546 Bacteria 12809
3 JGI24033J26618_1033819 3300002155 Unclassified 695
4 Ga0070658_10813534 3300005327 Unclassified 812
5 Ga0070683_100655011 3300005329 Unclassified 1005
6 Ga0068869_100277779 3300005334 Bacteria 1346
7 Ga0070680_100002164 3300005336 Bacteria 14497
8 Ga0070680_100204414 3300005336 Bacteria 1666
9 Ga0070680_100262180 3300005336 Bacteria 1462
10 Ga0070680_100359778 3300005336 Unclassified 1238
11 Ga0070680_100717751 3300005336 Unclassified 860
12 Ga0068868_100004966 3300005338 Bacteria 9339
13 Ga0068868_100379846 3300005338 Unclassified 1215
14 Ga0070660_100673660 3300005339 Bacteria 867
15 Ga0070671_100060513 3300005355 Bacteria 3153
16 Ga0070673_100634807 3300005364 Unclassified 976
17 Ga0070667_100094505 3300005367 Bacteria 2576
18 Ga0070703_10098042 3300005406 Bacteria 1028
19 Ga0070709_10109790 3300005434 Bacteria 1852
20 Ga0070709_10167702 3300005434 Unclassified 1532
21 Ga0070709_10301024 3300005434 Unclassified 1171
22 Ga0070709_10318512 3300005434 Unclassified 1141
23 Ga0070709_10370380 3300005434 Bacteria 1063
24 Ga0070709_10506363 3300005434 Unclassified 918
25 Ga0070709_10569805 3300005434 Unclassified 868
26 Ga0070709_10764597 3300005434 Unclassified 756
27 Ga0070714_100026434 3300005435 Bacteria 4797
28 Ga0070714_100027610 3300005435 Bacteria 4702
29 Ga0070714_100089595 3300005435 Bacteria 2693
30 Ga0070714_100266089 3300005435 Unclassified 1589
31 Ga0070714_100397925 3300005435 Unclassified 1301
32 Ga0070714_100493261 3300005435 Unclassified 1167
33 Ga0070714_101097585 3300005435 Bacteria 775
34 Ga0070713_100035219 3300005436 Unclassified 4028
35 Ga0070713_100053647 3300005436 Unclassified 3341
36 Ga0070713_100070519 3300005436 Bacteria 2950
37 Ga0070713_100075863 3300005436 Bacteria 2853
38 Ga0070713_100085511 3300005436 Unclassified 2702
39 Ga0070713_100234336 3300005436 Unclassified 1670
40 Ga0070713_100311848 3300005436 Bacteria 1451
41 Ga0070710_10012205 3300005437 Unclassified 4260
42 Ga0070710_10084381 3300005437 Bacteria 1861
43 Ga0070710_10309794 3300005437 Bacteria 1033
44 Ga0070711_100000865 3300005439 Bacteria 15917
45 Ga0070711_100011908 3300005439 Bacteria 5412
46 Ga0070711_100018107 3300005439 Unclassified 4494
47 Ga0070711_100044778 3300005439 Bacteria 3005
48 Ga0070711_100097316 3300005439 Bacteria 2134
49 Ga0070711_100140064 3300005439 Bacteria 1812
50 Ga0070711_100358504 3300005439 Bacteria 1174
51 Ga0070711_100493061 3300005439 Bacteria 1009
52 Ga0070705_100718867 3300005440 Bacteria 786
53 Ga0070694_100390461 3300005444 Bacteria 1087
54 Ga0070708_100010179 3300005445 Bacteria 7611
55 Ga0070708_100019277 3300005445 Bacteria 5730
56 Ga0070708_100364441 3300005445 Unclassified 1362
57 Ga0070662_101066300 3300005457 Unclassified 693
58 Ga0070681_10000872 3300005458 Bacteria 25419
59 Ga0070681_10003514 3300005458 Bacteria 14674
60 Ga0070681_10108088 3300005458 Bacteria 2722
61 Ga0070681_10196069 3300005458 Bacteria 1938
62 Ga0070681_10263522 3300005458 Bacteria 1635
63 Ga0070681_10629446 3300005458 Unclassified 988
64 Ga0070706_100001680 3300005467 Bacteria 23044
65 Ga0070706_100133205 3300005467 Bacteria 2320
66 Ga0070707_100010139 3300005468 Bacteria 8771
67 Ga0070707_100024626 3300005468 Bacteria 5702
68 Ga0070707_100230420 3300005468 Bacteria 1803
69 Ga0070698_100000993 3300005471 Bacteria 31246
70 Ga0070699_100016772 3300005518 Bacteria 6289
71 Ga0070699_100823816 3300005518 Unclassified 849
72 Ga0070679_100001701 3300005530 Bacteria 19818
73 Ga0070679_100064643 3300005530 Bacteria 3646
74 Ga0070679_100140753 3300005530 Bacteria 2392
75 Ga0070679_100258549 3300005530 Bacteria 1696
76 Ga0070679_100418102 3300005530 Bacteria 1286
77 Ga0070684_100042060 3300005535 Unclassified 3943
78 Ga0070684_100043552 3300005535 Bacteria 3877
79 Ga0070684_100136420 3300005535 Bacteria 2217
80 Ga0070697_100001106 3300005536 Bacteria 20389
81 Ga0070697_100002259 3300005536 Bacteria 14778
82 Ga0070697_100004264 3300005536 Bacteria 10961
83 Ga0070697_100038949 3300005536 Bacteria 3842
84 Ga0070697_100313681 3300005536 Unclassified 1350
85 Ga0070697_100791686 3300005536 Unclassified 839
86 Ga0068853_100018566 3300005539 Bacteria 5757
87 Ga0068853_100959355 3300005539 Bacteria 822
88 Ga0070695_100037776 3300005545 Bacteria 3045
89 Ga0070695_100368329 3300005545 Unclassified 1081
90 Ga0070696_100240887 3300005546 Bacteria 1364
91 Ga0070696_100485497 3300005546 Bacteria 980
92 Ga0070693_100011235 3300005547 Bacteria 4507
93 Ga0068855_100014967 3300005563 Bacteria 9344
94 Ga0068855_100082389 3300005563 Bacteria 3729
95 Ga0068855_100243754 3300005563 Bacteria 2007
96 Ga0068855_100549197 3300005563 Bacteria 1251
97 Ga0070664_100150817 3300005564 Bacteria 2052
98 Ga0068857_100056400 3300005577 Bacteria 3486
99 Ga0068857_100927635 3300005577 Unclassified 836
100 Ga0068854_100173056 3300005578 Bacteria 1681
101 Ga0068854_100765947 3300005578 Unclassified 838
102 Ga0068856_100012794 3300005614 Bacteria 8123
103 Ga0068856_100030801 3300005614 Bacteria 5246
104 Ga0068856_100627813 3300005614 Unclassified 1095
105 Ga0068852_100111531 3300005616 Bacteria 2487
106 Ga0068852_100205553 3300005616 Bacteria 1865
107 Ga0068864_100102791 3300005618 Bacteria 2536
108 Ga0068863_100011805 3300005841 Bacteria 8444
109 Ga0068863_100093048 3300005841 Bacteria 2861
110 Ga0068858_100334460 3300005842 Bacteria 1449
111 Ga0068858_101308308 3300005842 Unclassified 713
112 Ga0068860_100057069 3300005843 Bacteria 3711
113 Ga0068860_100472286 3300005843 Bacteria 1249
114 Ga0068860_100545679 3300005843 Bacteria 1161
115 Ga0068860_100729956 3300005843 Bacteria 1001
116 Ga0068862_100155597 3300005844 Unclassified 2037
117 Ga0081540_1032733 3300005983 Bacteria 2834
118 Ga0070717_10004553 3300006028 Bacteria 10029
119 Ga0070717_10012020 3300006028 Bacteria 6593
120 Ga0070717_10014810 3300006028 Bacteria 6000
121 Ga0070717_10078002 3300006028 Bacteria 2775
122 Ga0070717_10090222 3300006028 Bacteria 2586
123 Ga0070717_10261671 3300006028 Bacteria 1531
124 Ga0070717_10388138 3300006028 Bacteria 1253
125 Ga0070717_10567170 3300006028 Unclassified 1029
126 Ga0070717_11254908 3300006028 Unclassified 674
127 Ga0070715_10089617 3300006163 Bacteria 1412
128 Ga0070716_100035016 3300006173 Bacteria 2757
129 Ga0070716_100096616 3300006173 Bacteria 1801
130 Ga0070716_100129904 3300006173 Bacteria 1591
131 Ga0070716_100248362 3300006173 Bacteria 1211
132 Ga0070712_100000735 3300006175 Bacteria 19334
133 Ga0070712_100005609 3300006175 Bacteria 7768
134 Ga0070712_100080272 3300006175 Unclassified 2361
135 Ga0070712_100110457 3300006175 Unclassified 2051
136 Ga0070712_100115885 3300006175 Bacteria 2008
137 Ga0097621_100001078 3300006237 Bacteria 19086
138 Ga0097621_100058306 3300006237 Bacteria 3159
139 Ga0068871_100062516 3300006358 Bacteria 3043
140 Ga0068871_100177277 3300006358 Unclassified 1830
141 Ga0075434_100000080 3300006871 Bacteria 52022
142 Ga0075434_100001375 3300006871 Bacteria 20407
143 Ga0075434_100240275 3300006871 Bacteria 1831
144 Ga0075434_100432496 3300006871 Bacteria 1337
145 Ga0075434_100652272 3300006871 Bacteria 1071
146 Ga0068865_100186342 3300006881 Bacteria 1601
147 Ga0075436_100003160 3300006914 Bacteria 11294
148 Ga0075436_100020685 3300006914 Unclassified 4516
149 Ga0075436_100065643 3300006914 Bacteria 2508
150 Ga0075436_100542276 3300006914 Unclassified 853
151 Ga0075435_100000142 3300007076 Bacteria 40637
152 Ga0075435_100158791 3300007076 Bacteria 1904
153 Ga0075435_100167846 3300007076 Bacteria 1851
154 Ga0075435_100410660 3300007076 Unclassified 1165
155 Ga0075435_100447231 3300007076 Unclassified 1114
156 Ga0099794_10079571 3300007265 Bacteria 1615
157 Ga0099795_10136847 3300007788 Bacteria 993
158 Ga0105250_10097833 3300009092 Unclassified 1197
159 Ga0105240_10301300 3300009093 Unclassified 1834
160 Ga0111539_10834997 3300009094 Bacteria 1072
161 Ga0105245_10005705 3300009098 Bacteria 10934
162 Ga0105245_10008072 3300009098 Bacteria 9203
163 Ga0105245_10355221 3300009098 Bacteria 1453
164 Ga0105245_10675131 3300009098 Bacteria 1065
165 Ga0105245_10711175 3300009098 Unclassified 1038
166 Ga0114129_10022576 3300009147 Bacteria 8926
167 Ga0105241_10000878 3300009174 Bacteria 22713
168 Ga0105241_10028256 3300009174 Bacteria 4179
169 Ga0105241_10050645 3300009174 Bacteria 3166
170 Ga0105241_10898464 3300009174 Unclassified 822
171 Ga0105242_10008494 3300009176 Bacteria 7887
172 Ga0105242_10523796 3300009176 Bacteria 1131
173 Ga0105248_10059552 3300009177 Bacteria 4290
174 Ga0105248_10481871 3300009177 Bacteria 1398
175 Ga0105248_11325820 3300009177 Bacteria 814
176 Ga0105237_10094212 3300009545 Unclassified 2984
177 Ga0105237_10177639 3300009545 Bacteria 2129
178 Ga0105238_10093601 3300009551 Bacteria 2993
179 Ga0105238_10404596 3300009551 Bacteria 1358
180 Ga0099796_10165292 3300010159 Bacteria 880
181 Ga0105239_10334455 3300010375 Bacteria 1709
182 Ga0105239_10648091 3300010375 Unclassified 1206
183 Ga0157373_10001093 3300013100 Bacteria 20865
184 Ga0157370_10033860 3300013104 Bacteria 4979
185 Ga0157370_10056814 3300013104 Bacteria 3724
186 Ga0157370_10288686 3300013104 Bacteria 1515
187 Ga0157369_10022586 3300013105 Bacteria 7018
188 Ga0157369_10113278 3300013105 Bacteria 2881
189 Ga0157369_10196729 3300013105 Bacteria 2117
190 Ga0157369_10609604 3300013105 Bacteria 1127
191 Ga0157369_11200757 3300013105 Bacteria 774
192 Ga0157374_10062475 3300013296 Bacteria 3491
193 Ga0157378_10011887 3300013297 Bacteria 7623
194 Ga0157378_10056483 3300013297 Bacteria 3498
195 Ga0163162_10028366 3300013306 Bacteria 5538
196 Ga0163162_10289687 3300013306 Bacteria 1769
197 Ga0163162_10664194 3300013306 Bacteria 1165
198 Ga0157372_10003183 3300013307 Bacteria 17706
199 Ga0157372_10029523 3300013307 Bacteria 5989
200 Ga0157372_10315381 3300013307 Unclassified 1820
201 Ga0157372_10396951 3300013307 Unclassified 1607
202 Ga0157372_10608079 3300013307 Bacteria 1274
203 Ga0163163_10221036 3300014325 Bacteria 1943
204 Ga0163163_10386674 3300014325 Bacteria 1457
205 Ga0163163_11355644 3300014325 Bacteria 773
206 Ga0182008_10050018 3300014497 Unclassified 2074
207 Ga0157379_10002488 3300014968 Bacteria 15428
208 Ga0157379_10133304 3300014968 Bacteria 2237
209 Ga0157376_10082577 3300014969 Bacteria 2761
210 Ga0182007_10046969 3300015262 Unclassified 1429
211 Ga0224569_100207 3300022732 Bacteria 4862
212 Ga0224571_101101 3300022734 Bacteria 1654
213 Ga0228598_1001047 3300024227 Bacteria 6085
214 Ga0207656_10257837 3300025321 Unclassified 856
215 Ga0207692_10003804 3300025898 Bacteria 5931
216 Ga0207692_10100402 3300025898 Bacteria 1587
217 Ga0207692_10134404 3300025898 Bacteria 1400
218 Ga0207692_10214632 3300025898 Bacteria 1138
219 Ga0207699_10100382 3300025906 Bacteria 1835
220 Ga0207699_10100741 3300025906 Bacteria 1832
221 Ga0207699_10109587 3300025906 Bacteria 1767
222 Ga0207699_10187748 3300025906 Bacteria 1393
223 Ga0207699_10245267 3300025906 Unclassified 1232
224 Ga0207684_10008288 3300025910 Bacteria 9251
225 Ga0207654_10003428 3300025911 Bacteria 8016
226 Ga0207654_10060019 3300025911 Bacteria 2220
227 Ga0207707_10003244 3300025912 Bacteria 14439
228 Ga0207707_10081383 3300025912 Bacteria 2827
229 Ga0207707_10107714 3300025912 Unclassified 2436
230 Ga0207707_10135912 3300025912 Bacteria 2150
231 Ga0207707_10156487 3300025912 Bacteria 1993
232 Ga0207671_10685935 3300025914 Unclassified 815
233 Ga0207693_10003474 3300025915 Bacteria 13445
234 Ga0207693_10019597 3300025915 Bacteria 5379
235 Ga0207693_10055015 3300025915 Bacteria 3122
236 Ga0207663_10010287 3300025916 Bacteria 4973
237 Ga0207663_10012538 3300025916 Bacteria 4585
238 Ga0207663_10014753 3300025916 Unclassified 4290
239 Ga0207663_10095554 3300025916 Bacteria 1983
240 Ga0207663_10123024 3300025916 Bacteria 1780
241 Ga0207660_10000618 3300025917 Bacteria 23981
242 Ga0207660_10602291 3300025917 Bacteria 895
243 Ga0207649_10001699 3300025920 Bacteria 12690
244 Ga0207649_10535397 3300025920 Unclassified 894
245 Ga0207652_10003873 3300025921 Bacteria 12255
246 Ga0207652_10009165 3300025921 Bacteria 7965
247 Ga0207652_10282940 3300025921 Unclassified 1496
248 Ga0207652_10704343 3300025921 Unclassified 901
249 Ga0207646_10025412 3300025922 Bacteria 5417
250 Ga0207646_10493264 3300025922 Bacteria 1104
251 Ga0207694_10064109 3300025924 Bacteria 2863
252 Ga0207694_10074272 3300025924 Bacteria 2661
253 Ga0207687_10004365 3300025927 Bacteria 9436
254 Ga0207687_10006911 3300025927 Bacteria 7476
255 Ga0207687_10136990 3300025927 Bacteria 1852
256 Ga0207687_10376701 3300025927 Unclassified 1162
257 Ga0207700_10088011 3300025928 Bacteria 2444
258 Ga0207700_10239109 3300025928 Bacteria 1547
259 Ga0207700_10275044 3300025928 Bacteria 1446
260 Ga0207700_10277056 3300025928 Unclassified 1441
261 Ga0207700_10379072 3300025928 Bacteria 1236
262 Ga0207700_10622763 3300025928 Unclassified 961
263 Ga0207700_10721800 3300025928 Unclassified 890
264 Ga0207700_10883021 3300025928 Unclassified 800
265 Ga0207664_10041155 3300025929 Unclassified 3599
266 Ga0207664_10061278 3300025929 Bacteria 3001
267 Ga0207664_10166133 3300025929 Unclassified 1885
268 Ga0207664_10441525 3300025929 Unclassified 1161
269 Ga0207664_10558891 3300025929 Unclassified 1027
270 Ga0207664_10765649 3300025929 Unclassified 868
271 Ga0207664_10997990 3300025929 Unclassified 750
272 Ga0207644_10166902 3300025931 Bacteria 1716
273 Ga0207704_10211204 3300025938 Bacteria 1429
274 Ga0207665_10000217 3300025939 Bacteria 38774
275 Ga0207665_10201358 3300025939 Bacteria 1451
276 Ga0207665_10245611 3300025939 Bacteria 1321
277 Ga0207665_10412317 3300025939 Bacteria 1030
278 Ga0207665_10537676 3300025939 Bacteria 907
279 Ga0207711_10842078 3300025941 Unclassified 854
280 Ga0207661_10012504 3300025944 Bacteria 6169
281 Ga0207661_10080401 3300025944 Bacteria 2689
282 Ga0207667_10024979 3300025949 Bacteria 6551
283 Ga0207667_10105930 3300025949 Bacteria 2901
284 Ga0207667_10110070 3300025949 Unclassified 2841
285 Ga0207667_10963342 3300025949 Unclassified 842
286 Ga0207640_10174708 3300025981 Bacteria 1605
287 Ga0207640_10182928 3300025981 Bacteria 1573
288 Ga0207640_10348930 3300025981 Bacteria 1188
289 Ga0207658_10073897 3300025986 Bacteria 2589
290 Ga0207677_10028661 3300026023 Bacteria 3526
291 Ga0207677_10052073 3300026023 Bacteria 2779
292 Ga0207703_11419093 3300026035 Unclassified 668
293 Ga0207639_10001492 3300026041 Bacteria 15748
294 Ga0207702_10039423 3300026078 Bacteria 3957
295 Ga0207702_10150522 3300026078 Bacteria 2116
296 Ga0207702_10230596 3300026078 Unclassified 1730
297 Ga0207702_10491219 3300026078 Unclassified 1196
298 Ga0207702_10886551 3300026078 Bacteria 884
299 Ga0207641_10051206 3300026088 Unclassified 3497
300 Ga0207641_10247143 3300026088 Bacteria 1665
301 Ga0207674_10051906 3300026116 Bacteria 4183
302 Ga0207698_10059570 3300026142 Bacteria 2965
303 Ga0265356_1007887 3300028017 Bacteria 1219
304 Ga0268264_10185207 3300028381 Bacteria 1894
305 Ga0268264_10426512 3300028381 Bacteria 1280
306 Ga0268264_10807228 3300028381 Unclassified 938
307 Ga0265762_1001349 3300030760 Bacteria 4470
308 Ga0265762_1006092 3300030760 Unclassified 2162
309 Ga0265760_10002400 3300031090 Bacteria 5474
310 Ga0265760_10018351 3300031090 Bacteria 2014
311 Ga0265760_10028163 3300031090 Bacteria 1648
312 Ga0307413_10104913 3300031824 Bacteria 1878
313 Ga0307410_10362436 3300031852 Unclassified 1161
314 Ga0307410_10648906 3300031852 Unclassified 885
315 Ga0307406_10128041 3300031901 Bacteria 1777
316 Ga0307412_10589125 3300031911 Unclassified 940
317 Ga0307409_100012415 3300031995 Bacteria 5428
318 Ga0307409_100153843 3300031995 Unclassified 2001
319 Ga0307416_100088742 3300032002 Bacteria 2645
320 Ga0307411_10022296 3300032005 Bacteria 3725
321 Ga0307411_10912326 3300032005 Unclassified 781
322 Ga0307415_100044694 3300032126 Bacteria 2963
323 Ga0307415_100434863 3300032126 Unclassified 1130
324 Ga0307415_101069493 3300032126 Unclassified 754
325 Ga0373926_0102001 3300035083 Unclassified 1073
326 Ga0373944_0027089 3300035089 Bacteria 1697
327 Ga0373945_0026857 3300035116 Bacteria 2007
328 Ga0373956_0105181 3300035119 Unclassified 1311
329 Ga0373956_0175425 3300035119 Unclassified 1012
330 Ga0373957_0062086 3300035120 Bacteria 1449
331 Ga0373960_0033754 3300035121 Bacteria 1444
332 Ga0373943_0039516 3300035170 Unclassified 2273
333 Ga0373943_0111692 3300035170 Unclassified 1442
334 Ga0373946_0016427 3300035171 Bacteria 2820
335 Ga0373955_0143937 3300035172 Unclassified 1399
336 Ga0373955_0702436 3300035172 Unclassified 621
337 Ga0373924_0000246 3300035410 Bacteria 16565
338 Ga0373931_0168640 3300035691 Bacteria 1288
339 Ga0373935_0147127 3300035692 Bacteria 1596
340 Ga0373927_0027093 3300035695 Bacteria 3745
341 Ga0373927_0204700 3300035695 Bacteria 1296
342 Ga0373927_0363598 3300035695 Unclassified 954
343 Ga0373933_0246033 3300035724 Bacteria 1151
344 Ga0373933_0407024 3300035724 Unclassified 888
345 Ga0373933_0635710 3300035724 Unclassified 701
346 Ga0373933_0851623 3300035724 Unclassified 600
347 Ga0373947_0033733 3300035725 Unclassified 3024
348 Ga0373947_0077496 3300035725 Bacteria 2050
349 Ga0373947_0125321 3300035725 Unclassified 1635
350 Ga0373947_0657263 3300035725 Unclassified 715
351 Ga0373937_0000046 3300036401 Bacteria 107501
352 Ga0373937_0026704 3300036401 Bacteria 5217
353 Ga0373937_0105568 3300036401 Bacteria 2618
354 Ga0373937_0228036 3300036401 Unclassified 1754
355 Ga0373925_0008954 3300037068 Bacteria 7293
356 Ga0373925_0016482 3300037068 Bacteria 5354
357 Ga0373925_0047490 3300037068 Bacteria 3195
358 Ga0373925_0160781 3300037068 Bacteria 1769
359 Ga0373925_0163648 3300037068 Bacteria 1753
360 Ga0373925_0508476 3300037068 Unclassified 989
361 Ga0373925_0697772 3300037068 Unclassified 837
362 Ga0436365_1158057 3300039437 Unclassified 680
363 Ga0451577_0000926 3300042876 Bacteria 43102
364 Ga0451577_0625688 3300042876 Bacteria 976
365 Ga0453683_0057907 3300044673 Bacteria 2424
366 Ga0453683_0189715 3300044673 Bacteria 1304
367 Ga0466963_0116377 3300044694 Unclassified 1837
368 Ga0466963_0395229 3300044694 Bacteria 975
369 Ga0466964_0162097 3300044706 Bacteria 1046
370 Ga0453684_0000545 3300044712 Bacteria 142482
371 Ga0453684_0361186 3300044712 Bacteria 1635
372 Ga0466957_0000149 3300044842 Bacteria 30203
373 Ga0466957_0029762 3300044842 Bacteria 3258
374 Ga0466957_0223602 3300044842 Unclassified 1244
375 Ga0466959_0003930 3300045049 Bacteria 9868
376 Ga0466959_0135258 3300045049 Bacteria 1745
377 Ga0451576_0008083 3300045051 Bacteria 12402
378 Ga0451576_0108100 3300045051 Bacteria 2894
379 Ga0451576_0203665 3300045051 Bacteria 2067
380 Ga0451576_0409210 3300045051 Bacteria 1423
381 Ga0466967_0000748 3300045976 Bacteria 16718
382 Ga0466967_0029591 3300045976 Bacteria 4585
383 Ga0466967_0076907 3300045976 Bacteria 3003
384 Ga0466967_0103542 3300045976 Bacteria 2605
385 Ga0466967_0388224 3300045976 Bacteria 1357
386 Ga0466967_0432701 3300045976 Bacteria 1284
387 Ga0495603_0060345 3300046455 Bacteria 2241
388 Ga0495580_0000255 3300046472 Bacteria 42406
389 Ga0495580_0005261 3300046472 Bacteria 10750
390 Ga0495580_0006690 3300046472 Bacteria 9357
391 Ga0495580_0027063 3300046472 Bacteria 4176
392 Ga0495580_0057812 3300046472 Bacteria 2729
393 Ga0495580_0092871 3300046472 Bacteria 2100
394 Ga0495580_0099321 3300046472 Bacteria 2025
395 Ga0495580_0350422 3300046472 Unclassified 1000
396 Ga0495580_0390819 3300046472 Unclassified 939
397 Ga0495580_0608969 3300046472 Bacteria 721
398 Ga0495582_0289417 3300046473 Unclassified 941
399 Ga0495639_0031012 3300046475 Unclassified 2378
400 Ga0495664_0446373 3300046477 Bacteria 775
401 Ga0495584_0299687 3300046491 Bacteria 816
402 Ga0495628_0180131 3300046516 Bacteria 1599
403 Ga0495628_0220378 3300046516 Bacteria 1425
404 Ga0495630_0071201 3300046517 Bacteria 2616
405 Ga0495666_0030602 3300046526 Bacteria 2640
406 Ga0495666_0342173 3300046526 Bacteria 674
407 Ga0495665_0010599 3300046531 Bacteria 4991
408 Ga0495665_0154884 3300046531 Bacteria 1195
409 Ga0495586_0466476 3300046535 Unclassified 728
410 Ga0495667_0306402 3300046559 Unclassified 1006
411 Ga0495623_0031815 3300046679 Bacteria 3392
412 Ga0495658_0187612 3300046683 Unclassified 1284
413 Ga0495658_0243215 3300046683 Unclassified 1130
414 Ga0495669_0006649 3300046684 Bacteria 4836
415 Ga0495669_0274151 3300046684 Unclassified 811
416 Ga0495624_0105183 3300046690 Bacteria 1737
417 Ga0495600_0414959 3300046809 Unclassified 836
418 Ga0495581_0004242 3300047315 Bacteria 8266
419 Ga0495581_0063736 3300047315 Bacteria 2129
420 Ga0495675_0476365 3300047444 Unclassified 719
421 Ga0495684_0048515 3300047471 Unclassified 3247
422 Ga0495593_0031026 3300047673 Bacteria 2922
423 Ga0495593_0270613 3300047673 Unclassified 850
424 Ga0495602_0226316 3300048088 Unclassified 1408
425 Ga0496100_0560881 3300048903 Unclassified 884
426 Ga0496100_0561365 3300048903 Bacteria 884
427 Ga0496101_0959396 3300048904 Unclassified 673
428 Ga0496102_0000523 3300048905 Bacteria 41802
429 Ga0496102_0113759 3300048905 Bacteria 2525
430 Ga0496103_0000935 3300048906 Bacteria 20954
431 Ga0496104_0008553 3300048907 Bacteria 9100
432 Ga0496104_0050266 3300048907 Bacteria 3934
433 Ga0496104_0232295 3300048907 Bacteria 1756
434 Ga0496104_0282690 3300048907 Bacteria 1572
435 Ga0496104_0357265 3300048907 Bacteria 1373
436 Ga0496105_0002844 3300048908 Bacteria 12668
437 Ga0496105_0153185 3300048908 Unclassified 1894
438 Ga0496105_0412589 3300048908 Unclassified 1070
439 Ga0496106_0020123 3300048909 Bacteria 4951
440 Ga0496106_0414459 3300048909 Bacteria 1083
441 Ga0496107_0011426 3300048910 Bacteria 6185
442 Ga0496107_0191718 3300048910 Bacteria 1519
443 Ga0496109_0014355 3300048912 Bacteria 6893
444 Ga0496110_0077097 3300048913 Bacteria 2965
445 Ga0496111_0029729 3300048914 Bacteria 3881
446 Ga0496111_0088808 3300048914 Bacteria 2264
447 Ga0496112_0004404 3300048915 Bacteria 11914
448 Ga0496112_0005543 3300048915 Bacteria 10938
449 Ga0496112_0025676 3300048915 Bacteria 5659
450 Ga0496113_0000923 3300048916 Bacteria 15562
451 Ga0496113_0014230 3300048916 Bacteria 5422
452 Ga0496113_0251547 3300048916 Unclassified 1411
453 Ga0496113_1126459 3300048916 Unclassified 615
454 Ga0496115_0221572 3300048918 Unclassified 1561
455 Ga0496115_0556561 3300048918 Unclassified 916
456 nmdc:mga05p37_114162_c2 3300050507 Bacteria 1224
457 nmdc:mga0n895_11590_c1 3300050512 Bacteria 7877
458 nmdc:mga0n895_125_c1 3300050512 Bacteria 45661
459 nmdc:mga0rr50_1357_c1 3300050513 Bacteria 13378
460 nmdc:mga0rr50_75838_c1 3300050513 Bacteria 2579
461 nmdc:mga08x19_130339_c1 3300050514 Bacteria 1691
462 nmdc:mga08x19_3224_c1 3300050514 Bacteria 9782
463 nmdc:mga08x19_5070_c1 3300050514 Bacteria 7792
464 nmdc:mga0a205_45726_c1 3300050515 Bacteria 4222
465 nmdc:mga0a205_8232_c1 3300050515 Bacteria 9478
466 Ga0495601_0002003 3300053077 Bacteria 11428
467 Ga0495619_0342148 3300053085 Unclassified 1035
468 Ga0500590_061741 3300053148 Bacteria 1881
469 Ga0373932_0134070
470 LJNas_1000107
471 JGI24033J26618_1033819
472 Ga0070658_10813534
473 Ga0070683_100655011
474 Ga0068869_100277779
475 Ga0070680_100002164
476 Ga0070680_100204414
477 Ga0070680_100262180
478 Ga0070680_100359778
479 Ga0070680_100717751
480 Ga0068868_100004966
481 Ga0068868_100379846
482 Ga0070660_100673660
483 Ga0070671_100060513
484 Ga0070673_100634807
485 Ga0070667_100094505
486 Ga0070703_10098042
487 Ga0070709_10109790
488 Ga0070709_10167702
489 Ga0070709_10301024
490 Ga0070709_10318512
491 Ga0070709_10370380
492 Ga0070709_10506363
493 Ga0070709_10569805
494 Ga0070709_10764597
495 Ga0070714_100026434
496 Ga0070714_100027610
497 Ga0070714_100089595
498 Ga0070714_100266089
499 Ga0070714_100397925
500 Ga0070714_100493261
501 Ga0070714_101097585
502 Ga0070713_100035219
503 Ga0070713_100053647
504 Ga0070713_100070519
505 Ga0070713_100075863
506 Ga0070713_100085511
507 Ga0070713_100234336
508 Ga0070713_100311848
509 Ga0070710_10012205
510 Ga0070710_10084381
511 Ga0070710_10309794
512 Ga0070711_100000865
513 Ga0070711_100011908
514 Ga0070711_100018107
515 Ga0070711_100044778
516 Ga0070711_100097316
517 Ga0070711_100140064
518 Ga0070711_100358504
519 Ga0070711_100493061
520 Ga0070705_100718867
521 Ga0070694_100390461
522 Ga0070708_100010179
523 Ga0070708_100019277
524 Ga0070708_100364441
525 Ga0070662_101066300
526 Ga0070681_10000872
527 Ga0070681_10003514
528 Ga0070681_10108088
529 Ga0070681_10196069
530 Ga0070681_10263522
531 Ga0070681_10629446
532 Ga0070706_100001680
533 Ga0070706_100133205
534 Ga0070707_100010139
535 Ga0070707_100024626
536 Ga0070707_100230420
537 Ga0070698_100000993
538 Ga0070699_100016772
539 Ga0070699_100823816
540 Ga0070679_100001701
541 Ga0070679_100064643
542 Ga0070679_100140753
543 Ga0070679_100258549
544 Ga0070679_100418102
545 Ga0070684_100042060
546 Ga0070684_100043552
547 Ga0070684_100136420
548 Ga0070697_100001106
549 Ga0070697_100002259
550 Ga0070697_100004264
551 Ga0070697_100038949
552 Ga0070697_100313681
553 Ga0070697_100791686
554 Ga0068853_100018566
555 Ga0068853_100959355
556 Ga0070695_100037776
557 Ga0070695_100368329
558 Ga0070696_100240887
559 Ga0070696_100485497
560 Ga0070693_100011235
561 Ga0068855_100014967
562 Ga0068855_100082389
563 Ga0068855_100243754
564 Ga0068855_100549197
565 Ga0070664_100150817
566 Ga0068857_100056400
567 Ga0068857_100927635
568 Ga0068854_100173056
569 Ga0068854_100765947
570 Ga0068856_100012794
571 Ga0068856_100030801
572 Ga0068856_100627813
573 Ga0068852_100111531
574 Ga0068852_100205553
575 Ga0068864_100102791
576 Ga0068863_100011805
577 Ga0068863_100093048
578 Ga0068858_100334460
579 Ga0068858_101308308
580 Ga0068860_100057069
581 Ga0068860_100472286
582 Ga0068860_100545679
583 Ga0068860_100729956
584 Ga0068862_100155597
585 Ga0081540_1032733
586 Ga0070717_10004553
587 Ga0070717_10012020
588 Ga0070717_10014810
589 Ga0070717_10078002
590 Ga0070717_10090222
591 Ga0070717_10261671
592 Ga0070717_10388138
593 Ga0070717_10567170
594 Ga0070717_11254908
595 Ga0070715_10089617
596 Ga0070716_100035016
597 Ga0070716_100096616
598 Ga0070716_100129904
599 Ga0070716_100248362
600 Ga0070712_100000735
601 Ga0070712_100005609
602 Ga0070712_100080272
603 Ga0070712_100110457
604 Ga0070712_100115885
605 Ga0097621_100001078
606 Ga0097621_100058306
607 Ga0068871_100062516
608 Ga0068871_100177277
609 Ga0075434_100000080
610 Ga0075434_100001375
611 Ga0075434_100240275
612 Ga0075434_100432496
613 Ga0075434_100652272
614 Ga0068865_100186342
615 Ga0075436_100003160
616 Ga0075436_100020685
617 Ga0075436_100065643
618 Ga0075436_100542276
619 Ga0075435_100000142
620 Ga0075435_100158791
621 Ga0075435_100167846
622 Ga0075435_100410660
623 Ga0075435_100447231
624 Ga0099794_10079571
625 Ga0099795_10136847
626 Ga0105250_10097833
627 Ga0105240_10301300
628 Ga0111539_10834997
629 Ga0105245_10005705
630 Ga0105245_10008072
631 Ga0105245_10355221
632 Ga0105245_10675131
633 Ga0105245_10711175
634 Ga0114129_10022576
635 Ga0105241_10000878
636 Ga0105241_10028256
637 Ga0105241_10050645
638 Ga0105241_10898464
639 Ga0105242_10008494
640 Ga0105242_10523796
641 Ga0105248_10059552
642 Ga0105248_10481871
643 Ga0105248_11325820
644 Ga0105237_10094212
645 Ga0105237_10177639
646 Ga0105238_10093601
647 Ga0105238_10404596
648 Ga0099796_10165292
649 Ga0105239_10334455
650 Ga0105239_10648091
651 Ga0157373_10001093
652 Ga0157370_10033860
653 Ga0157370_10056814
654 Ga0157370_10288686
655 Ga0157369_10022586
656 Ga0157369_10113278
657 Ga0157369_10196729
658 Ga0157369_10609604
659 Ga0157369_11200757
660 Ga0157374_10062475
661 Ga0157378_10011887
662 Ga0157378_10056483
663 Ga0163162_10028366
664 Ga0163162_10289687
665 Ga0163162_10664194
666 Ga0157372_10003183
667 Ga0157372_10029523
668 Ga0157372_10315381
669 Ga0157372_10396951
670 Ga0157372_10608079
671 Ga0163163_10221036
672 Ga0163163_10386674
673 Ga0163163_11355644
674 Ga0182008_10050018
675 Ga0157379_10002488
676 Ga0157379_10133304
677 Ga0157376_10082577
678 Ga0182007_10046969
679 Ga0224569_100207
680 Ga0224571_101101
681 Ga0228598_1001047
682 Ga0207656_10257837
683 Ga0207692_10003804
684 Ga0207692_10100402
685 Ga0207692_10134404
686 Ga0207692_10214632
687 Ga0207699_10100382
688 Ga0207699_10100741
689 Ga0207699_10109587
690 Ga0207699_10187748
691 Ga0207699_10245267
692 Ga0207684_10008288
693 Ga0207654_10003428
694 Ga0207654_10060019
695 Ga0207707_10003244
696 Ga0207707_10081383
697 Ga0207707_10107714
698 Ga0207707_10135912
699 Ga0207707_10156487
700 Ga0207671_10685935
701 Ga0207693_10003474
702 Ga0207693_10019597
703 Ga0207693_10055015
704 Ga0207663_10010287
705 Ga0207663_10012538
706 Ga0207663_10014753
707 Ga0207663_10095554
708 Ga0207663_10123024
709 Ga0207660_10000618
710 Ga0207660_10602291
711 Ga0207649_10001699
712 Ga0207649_10535397
713 Ga0207652_10003873
714 Ga0207652_10009165
715 Ga0207652_10282940
716 Ga0207652_10704343
717 Ga0207646_10025412
718 Ga0207646_10493264
719 Ga0207694_10064109
720 Ga0207694_10074272
721 Ga0207687_10004365
722 Ga0207687_10006911
723 Ga0207687_10136990
724 Ga0207687_10376701
725 Ga0207700_10088011
726 Ga0207700_10239109
727 Ga0207700_10275044
728 Ga0207700_10277056
729 Ga0207700_10379072
730 Ga0207700_10622763
731 Ga0207700_10721800
732 Ga0207700_10883021
733 Ga0207664_10041155
734 Ga0207664_10061278
735 Ga0207664_10166133
736 Ga0207664_10441525
737 Ga0207664_10558891
738 Ga0207664_10765649
739 Ga0207664_10997990
740 Ga0207644_10166902
741 Ga0207704_10211204
742 Ga0207665_10000217
743 Ga0207665_10201358
744 Ga0207665_10245611
745 Ga0207665_10412317
746 Ga0207665_10537676
747 Ga0207711_10842078
748 Ga0207661_10012504
749 Ga0207661_10080401
750 Ga0207667_10024979
751 Ga0207667_10105930
752 Ga0207667_10110070
753 Ga0207667_10963342
754 Ga0207640_10174708
755 Ga0207640_10182928
756 Ga0207640_10348930
757 Ga0207658_10073897
758 Ga0207677_10028661
759 Ga0207677_10052073
760 Ga0207703_11419093
761 Ga0207639_10001492
762 Ga0207702_10039423
763 Ga0207702_10150522
764 Ga0207702_10230596
765 Ga0207702_10491219
766 Ga0207702_10886551
767 Ga0207641_10051206
768 Ga0207641_10247143
769 Ga0207674_10051906
770 Ga0207698_10059570
771 Ga0265356_1007887
772 Ga0268264_10185207
773 Ga0268264_10426512
774 Ga0268264_10807228
775 Ga0265762_1001349
776 Ga0265762_1006092
777 Ga0265760_10002400
778 Ga0265760_10018351
779 Ga0265760_10028163
780 Ga0307413_10104913
781 Ga0307410_10362436
782 Ga0307410_10648906
783 Ga0307406_10128041
784 Ga0307412_10589125
785 Ga0307409_100012415
786 Ga0307409_100153843
787 Ga0307416_100088742
788 Ga0307411_10022296
789 Ga0307411_10912326
790 Ga0307415_100044694
791 Ga0307415_100434863
792 Ga0307415_101069493
793 Ga0373926_0102001
794 Ga0373944_0027089
795 Ga0373945_0026857
796 Ga0373956_0105181
797 Ga0373956_0175425
798 Ga0373957_0062086
799 Ga0373960_0033754
800 Ga0373943_0039516
801 Ga0373943_0111692
802 Ga0373946_0016427
803 Ga0373955_0143937
804 Ga0373955_0702436
805 Ga0373924_0000246
806 Ga0373931_0168640
807 Ga0373935_0147127
808 Ga0373927_0027093
809 Ga0373927_0204700
810 Ga0373927_0363598
811 Ga0373933_0246033
812 Ga0373933_0407024
813 Ga0373933_0635710
814 Ga0373933_0851623
815 Ga0373947_0033733
816 Ga0373947_0077496
817 Ga0373947_0125321
818 Ga0373947_0657263
819 Ga0373937_0000046
820 Ga0373937_0026704
821 Ga0373937_0105568
822 Ga0373937_0228036
823 Ga0373925_0008954
824 Ga0373925_0016482
825 Ga0373925_0047490
826 Ga0373925_0160781
827 Ga0373925_0163648
828 Ga0373925_0508476
829 Ga0373925_0697772
830 Ga0436365_1158057
831 Ga0451577_0000926
832 Ga0451577_0625688
833 Ga0453683_0057907
834 Ga0453683_0189715
835 Ga0466963_0116377
836 Ga0466963_0395229
837 Ga0466964_0162097
838 Ga0453684_0000545
839 Ga0453684_0361186
840 Ga0466957_0000149
841 Ga0466957_0029762
842 Ga0466957_0223602
843 Ga0466959_0003930
844 Ga0466959_0135258
845 Ga0451576_0008083
846 Ga0451576_0108100
847 Ga0451576_0203665
848 Ga0451576_0409210
849 Ga0466967_0000748
850 Ga0466967_0029591
851 Ga0466967_0076907
852 Ga0466967_0103542
853 Ga0466967_0388224
854 Ga0466967_0432701
855 Ga0495603_0060345
856 Ga0495580_0000255
857 Ga0495580_0005261
858 Ga0495580_0006690
859 Ga0495580_0027063
860 Ga0495580_0057812
861 Ga0495580_0092871
862 Ga0495580_0099321
863 Ga0495580_0350422
864 Ga0495580_0390819
865 Ga0495580_0608969
866 Ga0495582_0289417
867 Ga0495639_0031012
868 Ga0495664_0446373
869 Ga0495584_0299687
870 Ga0495628_0180131
871 Ga0495628_0220378
872 Ga0495630_0071201
873 Ga0495666_0030602
874 Ga0495666_0342173
875 Ga0495665_0010599
876 Ga0495665_0154884
877 Ga0495586_0466476
878 Ga0495667_0306402
879 Ga0495623_0031815
880 Ga0495658_0187612
881 Ga0495658_0243215
882 Ga0495669_0006649
883 Ga0495669_0274151
884 Ga0495624_0105183
885 Ga0495600_0414959
886 Ga0495581_0004242
887 Ga0495581_0063736
888 Ga0495675_0476365
889 Ga0495684_0048515
890 Ga0495593_0031026
891 Ga0495593_0270613
892 Ga0495602_0226316
893 Ga0496100_0560881
894 Ga0496100_0561365
895 Ga0496101_0959396
896 Ga0496102_0000523
897 Ga0496102_0113759
898 Ga0496103_0000935
899 Ga0496104_0008553
900 Ga0496104_0050266
901 Ga0496104_0232295
902 Ga0496104_0282690
903 Ga0496104_0357265
904 Ga0496105_0002844
905 Ga0496105_0153185
906 Ga0496105_0412589
907 Ga0496106_0020123
908 Ga0496106_0414459
909 Ga0496107_0011426
910 Ga0496107_0191718
911 Ga0496109_0014355
912 Ga0496110_0077097
913 Ga0496111_0029729
914 Ga0496111_0088808
915 Ga0496112_0004404
916 Ga0496112_0005543
917 Ga0496112_0025676
918 Ga0496113_0000923
919 Ga0496113_0014230
920 Ga0496113_0251547
921 Ga0496113_1126459
922 Ga0496115_0221572
923 Ga0496115_0556561
924 nmdc:mga05p37_114162_c2
925 nmdc:mga0n895_11590_c1
926 nmdc:mga0n895_125_c1
927 nmdc:mga0rr50_1357_c1
928 nmdc:mga0rr50_75838_c1
929 nmdc:mga08x19_130339_c1
930 nmdc:mga08x19_3224_c1
931 nmdc:mga08x19_5070_c1
932 nmdc:mga0a205_45726_c1
933 nmdc:mga0a205_8232_c1
934 Ga0495601_0002003
935 Ga0495619_0342148
936 Ga0500590_061741

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10646

Germane

Sporulation and spore germination

73

192

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gzb-assembly4.cif.gz_D tandem germn domains of the sporulation protein germ from bacillus subtilis 0.711 57 188
6gzb-assembly2.cif.gz_B tandem germn domains of the sporulation protein germ from bacillus subtilis 0.6968 56 188
5j7r-assembly3.cif.gz_B 2.5 angstrom crystal structure of putative lipoprotein from clostridium perfringens 0.6744 55 188
6gz8-assembly1.cif.gz_A first germn domain of the sporulation protein germ from bacillus subtilis 0.6679 56 188
6gz8-assembly1.cif.gz_A first germn domain of the sporulation protein germ from bacillus subtilis 0.6511 56 188
ID Description Score Start End Superfamily
af_E1JHS1_22_85_4.10.410.10 Few Secondary Structures;Irregular;Factor Xa Inhibitor;Pancreatic trypsin inhibitor Kunitz domain 0.7868 56 78 4.10.410.10
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.7345 114 169 3.30.300.130
af_Q9UUE3_131_325_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.6983 125 165 3.40.630.30
af_E1JHS4_14_86_4.10.410.10 Few Secondary Structures;Irregular;Factor Xa Inhibitor;Pancreatic trypsin inhibitor Kunitz domain 0.6876 56 75 4.10.410.10
af_P9WGF5_239_328_3.30.70.1350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain 0.681 80 169 3.30.70.1350
ID Description Score Start End GO Terms
AF-A0A2V9YRA5-F1-model_v4 GerMN domain-containing protein 1 90 202
AF-A0A1Q7YSG7-F1-model_v4 GerMN domain-containing protein 0.9979 50 202
AF-A0A2V9PDI8-F1-model_v4 Uncharacterized protein 0.9808 126 200
AF-A0A2V9YRA5-F1-model_v4 GerMN domain-containing protein 0.9743 90 202
AF-A0A523QL84-F1-model_v4 GerMN domain-containing protein 0.951 108 188

Map