F450064

General Info

Members Datasets Scaffolds Average Seq Length
468 231 445 174

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100096313|Ga0307415_1000963132
Length 181
Sequence MLKVTETEHIDFRPELLAEFGEIIKRYPEGKHKAAMLPILHLVQAEYGWLSPASMERVAGYLDLKPIEVYEVATFYTMFFLKPQGKYVLEVCRTGPCCLVGAEKIMQHLENKLGVKEGEVTADGKFSWRGVECLAACGMAPVLQIGPEYTFYENLTEASVDQLINDLNEKDQTIDINKLSN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2738541284 Pedobacter sp. YR016 Isolate Unclassified
6 2738541302 Pedobacter sp. CF074 Isolate Unclassified
7 2738543023 Pedobacter sp. OK628 Isolate Unclassified
8 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
9 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
10 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
11 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
12 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
13 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
14 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
15 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
16 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
17 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
18 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
19 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
20 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
21 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
22 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
23 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
24 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
25 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
26 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
27 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
28 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
29 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
30 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
31 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
32 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
33 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
34 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
100 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
103 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
164 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
165 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
172 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
173 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
174 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
177 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
180 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
181 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
182 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
196 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
197 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
198 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
199 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
200 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
201 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
202 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
203 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
204 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
214 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
215 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
220 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
221 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
222 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
223 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
224 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
225 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
226 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
229 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
230 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.66
Metatranscriptomes 0.43
Isolates 4.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.26
Nodule 0
Rhizoplane 0.43
Rhizosphere 85.47
Stem 0
Stem Tuber 0
Unclassified 6.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1257564 2162886007 Bacteria 5034
2 SwRhRL2b_contig_3184512 2162886007 Bacteria 1342
3 JGI24739J22299_10019994 3300001989 Bacteria 2394
4 JGI24737J22298_10000060 3300001990 Bacteria 32592
5 JGI24737J22298_10007402 3300001990 Bacteria 3706
6 JGI24743J22301_10127764 3300001991 Unclassified 560
7 JGI24735J21928_10000032 3300002067 Bacteria 72360
8 JGI24744J21845_10018174 3300002077 Bacteria 1395
9 JGI25162J39368_1000162 3300002737 Bacteria 74157
10 JGI25162J39368_1001606 3300002737 Bacteria 11358
11 JGI25164J39214_1002945 3300002772 Bacteria 2331
12 JGI25165J46597_1000742 3300003214 Bacteria 25223
13 rootH1_10173488 3300003316 Bacteria 1349
14 rootH2_10012714 3300003320 Bacteria 66260
15 rootH2_10130325 3300003320 Bacteria 1679
16 rootH2_10140278 3300003320 Bacteria 2213
17 rootH1_10012646 3300003323 Bacteria 62371
18 rootH1_10037602 3300003323 Bacteria 6763
19 Ga0065714_10003510 3300005288 Bacteria 9251
20 Ga0065714_10003515 3300005288 Bacteria 13628
21 Ga0065714_10004799 3300005288 Bacteria 5112
22 Ga0065714_10005806 3300005288 Bacteria 5425
23 Ga0065714_10047374 3300005288 Bacteria 678
24 Ga0065714_10065068 3300005288 Bacteria 13285
25 Ga0065714_10083365 3300005288 Bacteria 2254
26 Ga0065714_10129615 3300005288 Bacteria 1246
27 Ga0065714_10344721 3300005288 Bacteria 641
28 Ga0065714_10349898 3300005288 Bacteria 636
29 Ga0065704_10000273 3300005289 Bacteria 42739
30 Ga0065704_10004114 3300005289 Bacteria 5658
31 Ga0065704_10088760 3300005289 Bacteria 2906
32 Ga0065704_10540532 3300005289 Bacteria 641
33 Ga0070658_10000008 3300005327 Bacteria 319912
34 Ga0070676_10000113 3300005328 Bacteria 29666
35 Ga0070683_100020627 3300005329 Bacteria 5866
36 Ga0068868_100146062 3300005338 Bacteria 1945
37 Ga0070660_100004582 3300005339 Bacteria 9553
38 Ga0070660_100008013 3300005339 Bacteria 7382
39 Ga0070691_10253731 3300005341 Bacteria 944
40 Ga0070671_100040709 3300005355 Bacteria 3861
41 Ga0070674_100366486 3300005356 Bacteria 1168
42 Ga0070673_100024565 3300005364 Bacteria 4422
43 Ga0070659_100001588 3300005366 Bacteria 16376
44 Ga0070659_100001887 3300005366 Bacteria 14999
45 Ga0070678_100215336 3300005456 Bacteria 1594
46 Ga0070662_100000090 3300005457 Bacteria 49884
47 Ga0068867_100003787 3300005459 Bacteria 10644
48 Ga0070706_100000377 3300005467 Bacteria 53406
49 Ga0070707_100087985 3300005468 Bacteria 3005
50 Ga0070698_100156464 3300005471 Bacteria 2225
51 Ga0070699_100210132 3300005518 Bacteria 1732
52 Ga0070679_100019798 3300005530 Bacteria 6552
53 Ga0070679_100679440 3300005530 Bacteria 972
54 Ga0070684_100105289 3300005535 Bacteria 2524
55 Ga0070684_100895597 3300005535 Bacteria 831
56 Ga0070672_100210793 3300005543 Bacteria 1627
57 Ga0070665_100000118 3300005548 Bacteria 149830
58 Ga0068855_100000155 3300005563 Bacteria 86903
59 Ga0068855_100032317 3300005563 Bacteria 6250
60 Ga0068855_100042488 3300005563 Bacteria 5386
61 Ga0068855_100278639 3300005563 Bacteria 1858
62 Ga0068855_100681327 3300005563 Bacteria 1102
63 Ga0068855_100961905 3300005563 Bacteria 899
64 Ga0068857_100032063 3300005577 Bacteria 4645
65 Ga0068857_101033557 3300005577 Bacteria 792
66 Ga0068856_100001430 3300005614 Bacteria 25032
67 Ga0068856_100007533 3300005614 Bacteria 10623
68 Ga0068856_100015836 3300005614 Bacteria 7292
69 Ga0068856_100202192 3300005614 Bacteria 2001
70 Ga0068852_100020168 3300005616 Bacteria 5296
71 Ga0068852_101910524 3300005616 Bacteria 616
72 Ga0068851_10715953 3300005834 Bacteria 617
73 Ga0068870_10091520 3300005840 Bacteria 1701
74 Ga0068858_100433684 3300005842 Bacteria 1265
75 Ga0075366_10000135 3300006195 Bacteria 30916
76 Ga0075366_10000556 3300006195 Bacteria 17427
77 Ga0075366_10017062 3300006195 Bacteria 4175
78 Ga0075366_10159654 3300006195 Bacteria 1366
79 Ga0097621_100000015 3300006237 Bacteria 92182
80 Ga0075370_10070928 3300006353 Bacteria 1993
81 Ga0068871_100000051 3300006358 Bacteria 64844
82 Ga0075428_100263616 3300006844 Bacteria 1855
83 Ga0068865_100002736 3300006881 Bacteria 10472
84 Ga0068865_100248450 3300006881 Bacteria 1403
85 Ga0105240_10002021 3300009093 Bacteria 33455
86 Ga0105240_10010451 3300009093 Bacteria 13043
87 Ga0105240_10054425 3300009093 Bacteria 5015
88 Ga0105240_10158015 3300009093 Bacteria 2695
89 Ga0105240_10193942 3300009093 Bacteria 2387
90 Ga0105240_10313131 3300009093 Bacteria 1792
91 Ga0105240_10474424 3300009093 Bacteria 1396
92 Ga0105240_10515225 3300009093 Bacteria 1328
93 Ga0105240_10593725 3300009093 Bacteria 1220
94 Ga0105240_11462965 3300009093 Bacteria 717
95 Ga0105240_11511337 3300009093 Bacteria 704
96 Ga0105245_10072888 3300009098 Bacteria 3121
97 Ga0105243_10000003 3300009148 Bacteria 712931
98 Ga0105243_10449275 3300009148 Bacteria 1209
99 Ga0105241_10000804 3300009174 Bacteria 23826
100 Ga0105241_10100544 3300009174 Bacteria 2298
101 Ga0105241_10154448 3300009174 Bacteria 1881
102 Ga0105241_10210356 3300009174 Bacteria 1629
103 Ga0105241_10826512 3300009174 Bacteria 855
104 Ga0105241_10938811 3300009174 Bacteria 806
105 Ga0105241_11621924 3300009174 Bacteria 626
106 Ga0105242_10886941 3300009176 Bacteria 891
107 Ga0105237_10000394 3300009545 Bacteria 62227
108 Ga0105237_10001504 3300009545 Bacteria 30678
109 Ga0105237_10001895 3300009545 Bacteria 26705
110 Ga0105237_10003766 3300009545 Bacteria 17851
111 Ga0105237_10010052 3300009545 Bacteria 10092
112 Ga0105237_10050797 3300009545 Bacteria 4166
113 Ga0105237_10094947 3300009545 Bacteria 2971
114 Ga0105237_10153344 3300009545 Bacteria 2300
115 Ga0105237_10161497 3300009545 Bacteria 2239
116 Ga0105237_10680387 3300009545 Bacteria 1036
117 Ga0105237_11225072 3300009545 Bacteria 757
118 Ga0105238_10014065 3300009551 Bacteria 8091
119 Ga0105238_10040227 3300009551 Bacteria 4738
120 Ga0105238_10130807 3300009551 Bacteria 2488
121 Ga0105238_10237015 3300009551 Bacteria 1802
122 Ga0105249_10964796 3300009553 Bacteria 921
123 Ga0105239_10000049 3300010375 Bacteria 177578
124 Ga0105239_10000166 3300010375 Bacteria 94743
125 Ga0105239_10086451 3300010375 Bacteria 3456
126 Ga0105239_10122644 3300010375 Bacteria 2887
127 Ga0105239_10814685 3300010375 Bacteria 1070
128 Ga0105239_10900960 3300010375 Bacteria 1015
129 Ga0105239_10965165 3300010375 Bacteria 979
130 Ga0105239_11264498 3300010375 Bacteria 851
131 Ga0105246_11009831 3300011119 Bacteria 754
132 Ga0157373_10000086 3300013100 Bacteria 80524
133 Ga0157373_10000678 3300013100 Bacteria 26681
134 Ga0157373_10001842 3300013100 Bacteria 16117
135 Ga0157373_10008022 3300013100 Bacteria 7847
136 Ga0157373_10071533 3300013100 Bacteria 2449
137 Ga0157373_10071844 3300013100 Bacteria 2443
138 Ga0157373_10639818 3300013100 Bacteria 776
139 Ga0157371_10000027 3300013102 Bacteria 269243
140 Ga0157371_10000107 3300013102 Bacteria 126477
141 Ga0157371_10001199 3300013102 Bacteria 27770
142 Ga0157371_10007301 3300013102 Bacteria 8975
143 Ga0157371_10015463 3300013102 Bacteria 5723
144 Ga0157371_10052866 3300013102 Bacteria 2885
145 Ga0157370_10002773 3300013104 Bacteria 20941
146 Ga0157370_10010241 3300013104 Bacteria 9900
147 Ga0157370_10037715 3300013104 Bacteria 4682
148 Ga0157370_10040970 3300013104 Bacteria 4470
149 Ga0157370_10060967 3300013104 Bacteria 3580
150 Ga0157370_10154246 3300013104 Bacteria 2137
151 Ga0157370_10263875 3300013104 Bacteria 1591
152 Ga0157370_11295704 3300013104 Bacteria 656
153 Ga0157369_10000053 3300013105 Bacteria 162962
154 Ga0157369_10030384 3300013105 Bacteria 5958
155 Ga0157369_10064840 3300013105 Bacteria 3933
156 Ga0157369_10102604 3300013105 Bacteria 3048
157 Ga0157374_10000301 3300013296 Bacteria 45768
158 Ga0157374_10001665 3300013296 Bacteria 18606
159 Ga0157374_10040216 3300013296 Bacteria 4305
160 Ga0157374_10771293 3300013296 Bacteria 977
161 Ga0157378_10131260 3300013297 Bacteria 2319
162 Ga0157378_10256974 3300013297 Bacteria 1674
163 Ga0157378_11271762 3300013297 Bacteria 776
164 Ga0157378_11461580 3300013297 Bacteria 727
165 Ga0163162_10000012 3300013306 Bacteria 292674
166 Ga0163162_10001704 3300013306 Bacteria 20605
167 Ga0163162_10157883 3300013306 Bacteria 2389
168 Ga0163162_10534813 3300013306 Bacteria 1301
169 Ga0163162_10841068 3300013306 Bacteria 1033
170 Ga0163162_11628199 3300013306 Bacteria 737
171 Ga0157372_10000238 3300013307 Bacteria 60988
172 Ga0157372_10002381 3300013307 Bacteria 20343
173 Ga0157372_10025844 3300013307 Bacteria 6386
174 Ga0157372_10248316 3300013307 Bacteria 2065
175 Ga0157372_10463283 3300013307 Bacteria 1477
176 Ga0157372_11019471 3300013307 Bacteria 958
177 Ga0157372_12008063 3300013307 Bacteria 665
178 Ga0157375_10052665 3300013308 Bacteria 4002
179 Ga0157375_10245849 3300013308 Bacteria 1949
180 Ga0163163_10256878 3300014325 Bacteria 1798
181 Ga0157380_10890398 3300014326 Bacteria 915
182 Ga0182008_10000020 3300014497 Bacteria 228333
183 Ga0182008_10000053 3300014497 Bacteria 102934
184 Ga0182008_10009526 3300014497 Bacteria 5238
185 Ga0182008_10172814 3300014497 Bacteria 1091
186 Ga0182008_10175741 3300014497 Bacteria 1082
187 Ga0157377_10045510 3300014745 Bacteria 2452
188 Ga0157376_10175793 3300014969 Bacteria 1953
189 Ga0182006_1001480 3300015261 Bacteria 14113
190 Ga0182006_1002073 3300015261 Bacteria 11213
191 Ga0182006_1002254 3300015261 Bacteria 10653
192 Ga0182006_1005760 3300015261 Bacteria 5847
193 Ga0182007_10000005 3300015262 Bacteria 442702
194 Ga0182007_10020801 3300015262 Bacteria 2339
195 Ga0163161_10000869 3300017792 Bacteria 23538
196 Ga0163161_10004348 3300017792 Bacteria 9872
197 Ga0163161_10022159 3300017792 Bacteria 4471
198 Ga0163161_10204387 3300017792 Bacteria 1523
199 Ga0163161_11273292 3300017792 Bacteria 638
200 Ga0163161_11414056 3300017792 Bacteria 608
201 Ga0163161_11595766 3300017792 Bacteria 575
202 Ga0206351_10407532 3300020077 Bacteria 2565
203 Ga0213872_10041838 3300021361 Bacteria 2090
204 Ga0209563_114930 3300025230 Bacteria 986
205 Ga0207427_100122 3300025231 Bacteria 99064
206 Ga0209437_100048 3300025233 Bacteria 405107
207 Ga0209437_100102 3300025233 Bacteria 224216
208 Ga0209026_1000852 3300025250 Bacteria 15983
209 Ga0209026_1001432 3300025250 Bacteria 10552
210 Ga0209026_1003805 3300025250 Bacteria 4773
211 Ga0209233_1000029 3300025261 Bacteria 641642
212 Ga0209455_1005502 3300025272 Bacteria 3900
213 Ga0207656_10436429 3300025321 Bacteria 661
214 Ga0207642_10140442 3300025899 Bacteria 1273
215 Ga0207647_10000018 3300025904 Bacteria 124816
216 Ga0207647_10000071 3300025904 Bacteria 79170
217 Ga0207645_10000229 3300025907 Bacteria 46502
218 Ga0207643_10155399 3300025908 Bacteria 1374
219 Ga0207705_10000026 3300025909 Bacteria 256051
220 Ga0207705_10139125 3300025909 Bacteria 1812
221 Ga0207705_10242446 3300025909 Bacteria 1373
222 Ga0207705_10895070 3300025909 Bacteria 688
223 Ga0207684_10001184 3300025910 Bacteria 29184
224 Ga0207654_10001026 3300025911 Bacteria 15268
225 Ga0207654_10017176 3300025911 Bacteria 3780
226 Ga0207654_10433540 3300025911 Bacteria 919
227 Ga0207654_10493197 3300025911 Bacteria 864
228 Ga0207695_10000142 3300025913 Bacteria 214715
229 Ga0207695_10008758 3300025913 Bacteria 12617
230 Ga0207695_10014909 3300025913 Bacteria 9174
231 Ga0207695_10015835 3300025913 Bacteria 8858
232 Ga0207695_10242465 3300025913 Bacteria 1703
233 Ga0207695_10737429 3300025913 Bacteria 865
234 Ga0207671_10000110 3300025914 Bacteria 126480
235 Ga0207671_10001102 3300025914 Bacteria 32573
236 Ga0207671_10001959 3300025914 Bacteria 22712
237 Ga0207671_10031595 3300025914 Bacteria 3945
238 Ga0207671_10177031 3300025914 Bacteria 1658
239 Ga0207671_10451750 3300025914 Bacteria 1023
240 Ga0207671_10666811 3300025914 Bacteria 828
241 Ga0207671_10782013 3300025914 Bacteria 757
242 Ga0207657_10023154 3300025919 Bacteria 5790
243 Ga0207657_10047953 3300025919 Bacteria 3731
244 Ga0207657_10112838 3300025919 Bacteria 2242
245 Ga0207652_10045181 3300025921 Bacteria 3754
246 Ga0207646_10070081 3300025922 Bacteria 3131
247 Ga0207694_10059940 3300025924 Bacteria 2961
248 Ga0207694_10068792 3300025924 Bacteria 2765
249 Ga0207694_10232789 3300025924 Bacteria 1505
250 Ga0207694_10274782 3300025924 Bacteria 1383
251 Ga0207687_10040078 3300025927 Bacteria 3209
252 Ga0207690_10001688 3300025932 Bacteria 13606
253 Ga0207690_10006502 3300025932 Bacteria 6930
254 Ga0207690_10282088 3300025932 Bacteria 1294
255 Ga0207706_10005255 3300025933 Bacteria 12077
256 Ga0207686_10238570 3300025934 Bacteria 1322
257 Ga0207709_10000008 3300025935 Bacteria 713099
258 Ga0207709_10530724 3300025935 Bacteria 923
259 Ga0207704_10000047 3300025938 Bacteria 84386
260 Ga0207691_10232782 3300025940 Bacteria 1595
261 Ga0207689_10191814 3300025942 Bacteria 1686
262 Ga0207661_10245444 3300025944 Bacteria 1590
263 Ga0207667_10012483 3300025949 Bacteria 9783
264 Ga0207667_10026801 3300025949 Bacteria 6289
265 Ga0207667_10064910 3300025949 Bacteria 3809
266 Ga0207667_10130941 3300025949 Bacteria 2584
267 Ga0207667_10221240 3300025949 Bacteria 1940
268 Ga0207667_10553875 3300025949 Bacteria 1163
269 Ga0207667_10600839 3300025949 Bacteria 1109
270 Ga0207667_10668507 3300025949 Bacteria 1043
271 Ga0207651_10010529 3300025960 Bacteria 5130
272 Ga0207712_10802417 3300025961 Bacteria 827
273 Ga0207640_10303257 3300025981 Bacteria 1264
274 Ga0207703_10218707 3300026035 Bacteria 1702
275 Ga0207639_10009275 3300026041 Bacteria 6786
276 Ga0207639_10316462 3300026041 Bacteria 1384
277 Ga0207702_10002682 3300026078 Bacteria 16707
278 Ga0207702_10019319 3300026078 Bacteria 5638
279 Ga0207702_10069316 3300026078 Bacteria 3032
280 Ga0207702_10293151 3300026078 Bacteria 1542
281 Ga0207702_10642692 3300026078 Bacteria 1043
282 Ga0207702_10669085 3300026078 Bacteria 1022
283 Ga0207648_10007503 3300026089 Bacteria 10713
284 Ga0207674_10256679 3300026116 Bacteria 1695
285 Ga0207674_10416135 3300026116 Bacteria 1299
286 Ga0207683_10023462 3300026121 Bacteria 5308
287 Ga0207698_10010495 3300026142 Bacteria 5959
288 Ga0207698_11556216 3300026142 Bacteria 676
289 Ga0207698_11834074 3300026142 Bacteria 621
290 Ga0268266_10000121 3300028379 Bacteria 154995
291 Ga0307517_10000198 3300028786 Bacteria 102181
292 Ga0307515_10001436 3300028794 Bacteria 53821
293 Ga0307515_10260806 3300028794 Bacteria 1469
294 Ga0265338_10072380 3300028800 Bacteria 2943
295 Ga0316181_1228454 3300030744 Bacteria 775
296 Ga0265327_10207920 3300031251 Bacteria 884
297 Ga0307509_10100580 3300031507 Bacteria 2929
298 Ga0307408_100001326 3300031548 Bacteria 18558
299 Ga0307405_10550912 3300031731 Bacteria 933
300 Ga0307407_10000001 3300031903 Bacteria 570048
301 Ga0307412_10000001 3300031911 Bacteria 822691
302 Ga0307412_10008180 3300031911 Bacteria 5963
303 Ga0307412_10129794 3300031911 Bacteria 1829
304 Ga0307412_10203342 3300031911 Bacteria 1506
305 Ga0307412_10383105 3300031911 Bacteria 1139
306 Ga0307412_11276953 3300031911 Bacteria 660
307 Ga0307412_11498174 3300031911 Bacteria 613
308 Ga0307416_100000008 3300032002 Bacteria 401343
309 Ga0307414_10000470 3300032004 Bacteria 21107
310 Ga0307414_10002491 3300032004 Bacteria 9655
311 Ga0307414_10011763 3300032004 Bacteria 5148
312 Ga0307414_10032798 3300032004 Bacteria 3424
313 Ga0307414_10086939 3300032004 Bacteria 2308
314 Ga0307414_10195809 3300032004 Bacteria 1639
315 Ga0307414_10204184 3300032004 Bacteria 1610
316 Ga0307414_10217080 3300032004 Bacteria 1567
317 Ga0307414_10647644 3300032004 Bacteria 952
318 Ga0307414_11746139 3300032004 Bacteria 580
319 Ga0307415_100096313 3300032126 Bacteria 2157
320 Ga0307507_10000099 3300033179 Bacteria 139532
321 Ga0307510_10005580 3300033180 Bacteria 14995
322 Ga0373953_0149984 3300035117 Bacteria 999
323 Ga0395899_0000027 3300037312 Bacteria 337387
324 Ga0395899_0000811 3300037312 Bacteria 30415
325 Ga0395900_0000275 3300037418 Bacteria 78207
326 Ga0395900_0001518 3300037418 Bacteria 27559
327 Ga0395900_0010124 3300037418 Bacteria 9643
328 Ga0395898_0009566 3300037466 Bacteria 10183
329 Ga0395898_0080809 3300037466 Bacteria 3135
330 Ga0395905_0000248 3300037471 Bacteria 81042
331 Ga0395905_0000327 3300037471 Bacteria 68334
332 Ga0395901_0000595 3300038443 Bacteria 42132
333 Ga0395901_0008911 3300038443 Bacteria 10162
334 Ga0395901_0050730 3300038443 Bacteria 4310
335 Ga0436361_0179743 3300039447 Bacteria 769
336 Ga0436361_1048734 3300039447 Bacteria 5617
337 Ga0451797_0915911 3300041453 Bacteria 584
338 Ga0439448_0002912 3300042005 Bacteria 4690
339 Ga0439455_0016974 3300042012 Bacteria 1690
340 Ga0495592_0119577 3300046454 Bacteria 1855
341 Ga0495629_0519962 3300046459 Bacteria 801
342 Ga0495638_0306600 3300046460 Bacteria 853
343 Ga0495651_0284170 3300046462 Bacteria 1116
344 Ga0495650_0000231 3300046471 Bacteria 113969
345 Ga0495650_0021584 3300046471 Bacteria 3107
346 Ga0495650_0174249 3300046471 Bacteria 760
347 Ga0495585_0000037 3300046492 Bacteria 133335
348 Ga0495585_0001133 3300046492 Bacteria 21876
349 Ga0495596_0012832 3300046500 Bacteria 3574
350 Ga0495607_0263245 3300046501 Bacteria 825
351 Ga0495583_0019511 3300046506 Bacteria 3537
352 Ga0495606_0000060 3300046507 Bacteria 185907
353 Ga0495606_0015512 3300046507 Bacteria 5864
354 Ga0495606_0019551 3300046507 Bacteria 5033
355 Ga0495606_0051110 3300046507 Bacteria 2699
356 Ga0495606_0232659 3300046507 Bacteria 1032
357 Ga0495610_0000751 3300046512 Bacteria 30621
358 Ga0495616_0002278 3300046513 Bacteria 12835
359 Ga0495616_0010131 3300046513 Bacteria 5470
360 Ga0495616_0230303 3300046513 Bacteria 803
361 Ga0495618_0136731 3300046514 Bacteria 1568
362 Ga0495631_0001037 3300046518 Bacteria 17230
363 Ga0495632_0023088 3300046519 Bacteria 3326
364 Ga0495632_0192245 3300046519 Bacteria 932
365 Ga0495637_0023168 3300046520 Bacteria 2826
366 Ga0495644_0010092 3300046523 Bacteria 3638
367 Ga0495648_0028735 3300046524 Bacteria 3699
368 Ga0495642_0058737 3300046528 Bacteria 1593
369 Ga0495642_0143334 3300046528 Bacteria 1032
370 Ga0495642_0161011 3300046528 Bacteria 973
371 Ga0495652_0355428 3300046529 Bacteria 1048
372 Ga0495652_0533480 3300046529 Bacteria 809
373 Ga0495652_0763754 3300046529 Bacteria 646
374 Ga0495609_0004430 3300046538 Bacteria 7680
375 Ga0495609_0015197 3300046538 Bacteria 3607
376 Ga0495609_0015664 3300046538 Bacteria 3546
377 Ga0495609_0156479 3300046538 Bacteria 968
378 Ga0495609_0187084 3300046538 Bacteria 870
379 Ga0495622_0063454 3300046557 Bacteria 1709
380 Ga0495633_0000015 3300046558 Bacteria 254484
381 Ga0495633_0004451 3300046558 Bacteria 8910
382 Ga0495668_0000041 3300046616 Bacteria 229462
383 Ga0495668_0278759 3300046616 Bacteria 916
384 Ga0495611_0489490 3300046648 Bacteria 559
385 Ga0495625_0000191 3300046660 Bacteria 97363
386 Ga0495625_0001074 3300046660 Bacteria 35469
387 Ga0495625_0005576 3300046660 Bacteria 11413
388 Ga0495625_0071948 3300046660 Bacteria 2425
389 Ga0495625_0243985 3300046660 Bacteria 1168
390 Ga0495625_0287468 3300046660 Bacteria 1056
391 Ga0495625_0445919 3300046660 Bacteria 800
392 Ga0495625_0621354 3300046660 Bacteria 646
393 Ga0495661_0082697 3300046665 Bacteria 1847
394 Ga0495588_0315847 3300046674 Bacteria 822
395 Ga0495588_0450682 3300046674 Bacteria 675
396 Ga0495658_0061559 3300046683 Bacteria 2155
397 Ga0495669_0156515 3300046684 Bacteria 1080
398 Ga0495669_0270858 3300046684 Bacteria 816
399 Ga0495649_0000061 3300046694 Bacteria 97338
400 Ga0495649_0034219 3300046694 Bacteria 2796
401 Ga0495660_0022764 3300046810 Bacteria 3575
402 Ga0495660_0044026 3300046810 Bacteria 2458
403 Ga0495672_0025765 3300047320 Bacteria 3759
404 Ga0495683_0015934 3300047323 Bacteria 3904
405 Ga0495687_000570 3300047443 Bacteria 43484
406 Ga0495687_043561 3300047443 Bacteria 1954
407 Ga0495677_0016707 3300047445 Bacteria 2662
408 Ga0495685_046715 3300047447 Bacteria 1473
409 Ga0495673_0011433 3300047469 Bacteria 4772
410 Ga0495681_0094177 3300047470 Bacteria 1318
411 Ga0495686_0000679 3300047472 Bacteria 46024
412 Ga0495686_0002403 3300047472 Bacteria 17773
413 Ga0495686_0175761 3300047472 Bacteria 1243
414 Ga0495602_0709839 3300048088 Bacteria 682
415 Ga0496116_0003271 3300048919 Bacteria 16146
416 Ga0496117_0019589 3300048920 Bacteria 5551
417 Ga0496122_0007262 3300048925 Bacteria 12391
418 Ga0496122_0010569 3300048925 Bacteria 9484
419 Ga0496123_0000777 3300048926 Bacteria 51679
420 Ga0496123_0015571 3300048926 Bacteria 6228
421 Ga0496125_0482577 3300048928 Bacteria 702
422 Ga0496126_0320667 3300048929 Bacteria 1274
423 Ga0495678_017094 3300049459 Bacteria 3296
424 Ga0495682_0017181 3300049460 Bacteria 2734
425 Ga0501241_016036 3300049758 Bacteria 1365
426 nmdc:mga00v17_282104_c1 3300050491 Bacteria 1078
427 nmdc:mga0k408_179107_c1 3300050493 Bacteria 1264
428 nmdc:mga0k408_31_c1 3300050493 Bacteria 85612
429 nmdc:mga0k408_3587_c1 3300050493 Bacteria 4175
430 nmdc:mga07m45_62567_c1 3300050496 Bacteria 2109
431 nmdc:mga07m45_75609_c1 3300050496 Bacteria 1919
432 Ga0500635_0000960 3300053080 Bacteria 6937
433 Ga0500651_0000058 3300053093 Bacteria 72493
434 Ga0500650_0129273 3300053098 Bacteria 1175
435 Ga0500608_000440 3300053122 Bacteria 15676
436 Ga0500608_121674 3300053122 Bacteria 1182
437 Ga0500614_011559 3300053123 Bacteria 1914
438 Ga0500618_000016 3300053125 Bacteria 164049
439 Ga0500618_047778 3300053125 Bacteria 973
440 Ga0500564_167247 3300053138 Bacteria 926
441 Ga0500573_0155606 3300053140 Bacteria 1248
442 Ga0500616_0153765 3300053153 Bacteria 1062
443 Ga0500622_0010132 3300053156 Bacteria 5187
444 Ga0500624_001646 3300053157 Bacteria 3356
445 Ga0587069_038480 3300059642 Bacteria 806

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0025765 Ga0495672_0025765_2993_3487 145
2 3300046459 Ga0495629_0519962 Ga0495629_0519962_15_587 151
3 3300005467 Ga0070706_100000377 Ga0070706_10000037720 156
4 3300005468 Ga0070707_100087985 Ga0070707_1000879852 156
5 3300005471 Ga0070698_100156464 Ga0070698_1001564643 156
6 3300005518 Ga0070699_100210132 Ga0070699_1002101321 156
7 3300006844 Ga0075428_100263616 Ga0075428_1002636162 156
8 3300014497 Ga0182008_10175741 Ga0182008_101757411 156
9 3300025910 Ga0207684_10001184 Ga0207684_1000118418 156
10 3300025922 Ga0207646_10070081 Ga0207646_100700812 156
11 3300035117 Ga0373953_0149984 Ga0373953_0149984_170_757 156
12 iso_pu_bacteria 2852623160 2852627067 157
13 3300050491 nmdc:mga00v17_282104_c1 nmdc:mga00v17_282104_c1_561_1064 162
14 3300026035 Ga0207703_10218707 Ga0207703_102187074 164
15 iso_pu_bacteria 3003233435 3003235835 164
16 iso_pu_bacteria 2599185184 2599481423 166
17 iso_pu_bacteria 2721755487 2722731095 166
18 iso_pu_bacteria 2738541283 2738756036 166
19 iso_pu_bacteria 2738541284 2738763340 166
20 iso_pu_bacteria 2738541302 2738854591 166
21 iso_pu_bacteria 2738543023 2739304128 166
22 iso_pu_bacteria 2775506987 2776616055 166
23 iso_pu_bacteria 2852627209 2852630700 166
24 iso_pu_bacteria 2884933994 2884935199 166
25 iso_pu_bacteria 2890737413 2890738859 166
26 iso_pu_bacteria 2895498888 2895501155 166
27 iso_pu_bacteria 2904780799 2904783375 166
28 iso_pu_bacteria 2919177583 2919181241 166
29 iso_pu_bacteria 2919186247 2919190657 166
30 iso_pu_bacteria 2919437846 2919443056 166
31 iso_pu_bacteria 2928078545 2928083282 166
32 iso_pu_bacteria 2928147474 2928152744 166
33 iso_pu_bacteria 2932082852 2932088294 166
34 iso_pu_bacteria 2939664404 2939669133 166
35 iso_pu_bacteria 2977232053 2977234017 166
36 iso_pu_bacteria 8055588893 8055592070 166
37 3300014326 Ga0157380_10890398 Ga0157380_108903982 167
38 3300005289 Ga0065704_10540532 Ga0065704_105405321 168
39 3300032004 Ga0307414_11746139 Ga0307414_117461391 168
40 2162886007 SwRhRL2b_contig_1257564 SwRhRL2b_0234.00007720 170
41 2162886007 SwRhRL2b_contig_3184512 SwRhRL2b_0260.00000080 170
42 3300001989 JGI24739J22299_10019994 JGI24739J22299_100199941 170
43 3300001990 JGI24737J22298_10000060 JGI24737J22298_1000006015 170
44 3300001990 JGI24737J22298_10007402 JGI24737J22298_100074026 170
45 3300001991 JGI24743J22301_10127764 JGI24743J22301_101277641 170
46 3300002067 JGI24735J21928_10000032 JGI24735J21928_1000003237 170
47 3300002077 JGI24744J21845_10018174 JGI24744J21845_100181743 170
48 3300002737 JGI25162J39368_1000162 JGI25162J39368_10001623 170
49 3300002737 JGI25162J39368_1001606 JGI25162J39368_10016063 170
50 3300002772 JGI25164J39214_1002945 JGI25164J39214_10029452 170
51 3300003214 JGI25165J46597_1000742 JGI25165J46597_10007423 170
52 3300003316 rootH1_10173488 rootH1_101734883 170
53 3300003320 rootH2_10012714 rootH2_1001271439 170
54 3300003320 rootH2_10130325 rootH2_101303252 170
55 3300003320 rootH2_10140278 rootH2_101402782 170
56 3300003323 rootH1_10012646 rootH1_1001264659 170
57 3300003323 rootH1_10037602 rootH1_100376026 170
58 3300005288 Ga0065714_10003510 Ga0065714_100035108 170
59 3300005288 Ga0065714_10003515 Ga0065714_100035151 170
60 3300005288 Ga0065714_10004799 Ga0065714_100047996 170
61 3300005288 Ga0065714_10005806 Ga0065714_100058062 170
62 3300005288 Ga0065714_10047374 Ga0065714_100473741 170
63 3300005288 Ga0065714_10065068 Ga0065714_1006506810 170
64 3300005288 Ga0065714_10083365 Ga0065714_100833652 170
65 3300005288 Ga0065714_10129615 Ga0065714_101296152 170
66 3300005288 Ga0065714_10344721 Ga0065714_103447211 170
67 3300005288 Ga0065714_10349898 Ga0065714_103498981 170
68 3300005289 Ga0065704_10000273 Ga0065704_1000027330 170
69 3300005289 Ga0065704_10004114 Ga0065704_100041143 170
70 3300005289 Ga0065704_10088760 Ga0065704_100887601 170
71 3300005327 Ga0070658_10000008 Ga0070658_10000008193 170
72 3300005328 Ga0070676_10000113 Ga0070676_1000011322 170
73 3300005329 Ga0070683_100020627 Ga0070683_1000206272 170
74 3300005338 Ga0068868_100146062 Ga0068868_1001460622 170
75 3300005339 Ga0070660_100004582 Ga0070660_1000045824 170
76 3300005339 Ga0070660_100008013 Ga0070660_1000080133 170
77 3300005341 Ga0070691_10253731 Ga0070691_102537312 170
78 3300005355 Ga0070671_100040709 Ga0070671_1000407094 170
79 3300005356 Ga0070674_100366486 Ga0070674_1003664862 170
80 3300005364 Ga0070673_100024565 Ga0070673_1000245654 170
81 3300005366 Ga0070659_100001588 Ga0070659_10000158819 170
82 3300005366 Ga0070659_100001887 Ga0070659_1000018872 170
83 3300005456 Ga0070678_100215336 Ga0070678_1002153362 170
84 3300005457 Ga0070662_100000090 Ga0070662_10000009041 170
85 3300005459 Ga0068867_100003787 Ga0068867_1000037878 170
86 3300005530 Ga0070679_100019798 Ga0070679_1000197986 170
87 3300005530 Ga0070679_100679440 Ga0070679_1006794402 170
88 3300005535 Ga0070684_100105289 Ga0070684_1001052892 170
89 3300005535 Ga0070684_100895597 Ga0070684_1008955972 170
90 3300005543 Ga0070672_100210793 Ga0070672_1002107933 170
91 3300005548 Ga0070665_100000118 Ga0070665_100000118106 170
92 3300005563 Ga0068855_100000155 Ga0068855_10000015578 170
93 3300005563 Ga0068855_100032317 Ga0068855_1000323175 170
94 3300005563 Ga0068855_100042488 Ga0068855_1000424886 170
95 3300005563 Ga0068855_100278639 Ga0068855_1002786392 170
96 3300005563 Ga0068855_100681327 Ga0068855_1006813271 170
97 3300005563 Ga0068855_100961905 Ga0068855_1009619051 170
98 3300005577 Ga0068857_100032063 Ga0068857_1000320636 170
99 3300005577 Ga0068857_101033557 Ga0068857_1010335571 170
100 3300005614 Ga0068856_100001430 Ga0068856_1000014306 170
101 3300005614 Ga0068856_100007533 Ga0068856_1000075337 170
102 3300005614 Ga0068856_100015836 Ga0068856_1000158368 170
103 3300005614 Ga0068856_100202192 Ga0068856_1002021922 170
104 3300005616 Ga0068852_100020168 Ga0068852_1000201684 170
105 3300005616 Ga0068852_101910524 Ga0068852_1019105241 170
106 3300005834 Ga0068851_10715953 Ga0068851_107159531 170
107 3300005840 Ga0068870_10091520 Ga0068870_100915202 170
108 3300005842 Ga0068858_100433684 Ga0068858_1004336842 170
109 3300006195 Ga0075366_10000135 Ga0075366_1000013516 170
110 3300006195 Ga0075366_10000556 Ga0075366_100005562 170
111 3300006195 Ga0075366_10017062 Ga0075366_100170622 170
112 3300006195 Ga0075366_10159654 Ga0075366_101596542 170
113 3300006237 Ga0097621_100000015 Ga0097621_10000001586 170
114 3300006353 Ga0075370_10070928 Ga0075370_100709282 170
115 3300006358 Ga0068871_100000051 Ga0068871_10000005169 170
116 3300006881 Ga0068865_100002736 Ga0068865_10000273612 170
117 3300006881 Ga0068865_100248450 Ga0068865_1002484502 170
118 3300009093 Ga0105240_10002021 Ga0105240_100020214 170
119 3300009093 Ga0105240_10010451 Ga0105240_100104514 170
120 3300009093 Ga0105240_10054425 Ga0105240_100544255 170
121 3300009093 Ga0105240_10158015 Ga0105240_101580154 170
122 3300009093 Ga0105240_10193942 Ga0105240_101939422 170
123 3300009093 Ga0105240_10313131 Ga0105240_103131312 170
124 3300009093 Ga0105240_10474424 Ga0105240_104744241 170
125 3300009093 Ga0105240_10515225 Ga0105240_105152252 170
126 3300009093 Ga0105240_10593725 Ga0105240_105937251 170
127 3300009093 Ga0105240_11462965 Ga0105240_114629652 170
128 3300009093 Ga0105240_11511337 Ga0105240_115113372 170
129 3300009098 Ga0105245_10072888 Ga0105245_100728885 170
130 3300009148 Ga0105243_10000003 Ga0105243_1000000357 170
131 3300009148 Ga0105243_10449275 Ga0105243_104492752 170
132 3300009174 Ga0105241_10000804 Ga0105241_1000080419 170
133 3300009174 Ga0105241_10100544 Ga0105241_101005443 170
134 3300009174 Ga0105241_10154448 Ga0105241_101544483 170
135 3300009174 Ga0105241_10210356 Ga0105241_102103561 170
136 3300009174 Ga0105241_10826512 Ga0105241_108265122 170
137 3300009174 Ga0105241_10938811 Ga0105241_109388111 170
138 3300009174 Ga0105241_11621924 Ga0105241_116219241 170
139 3300009176 Ga0105242_10886941 Ga0105242_108869411 170
140 3300009545 Ga0105237_10000394 Ga0105237_100003942 170
141 3300009545 Ga0105237_10001504 Ga0105237_1000150411 170
142 3300009545 Ga0105237_10001895 Ga0105237_1000189527 170
143 3300009545 Ga0105237_10003766 Ga0105237_1000376617 170
144 3300009545 Ga0105237_10010052 Ga0105237_100100527 170
145 3300009545 Ga0105237_10050797 Ga0105237_100507974 170
146 3300009545 Ga0105237_10094947 Ga0105237_100949473 170
147 3300009545 Ga0105237_10153344 Ga0105237_101533443 170
148 3300009545 Ga0105237_10161497 Ga0105237_101614974 170
149 3300009545 Ga0105237_10680387 Ga0105237_106803871 170
150 3300009545 Ga0105237_11225072 Ga0105237_112250722 170
151 3300009551 Ga0105238_10014065 Ga0105238_100140657 170
152 3300009551 Ga0105238_10040227 Ga0105238_100402274 170
153 3300009551 Ga0105238_10130807 Ga0105238_101308072 170
154 3300009551 Ga0105238_10237015 Ga0105238_102370152 170
155 3300009553 Ga0105249_10964796 Ga0105249_109647961 170
156 3300010375 Ga0105239_10000049 Ga0105239_10000049153 170
157 3300010375 Ga0105239_10000166 Ga0105239_1000016636 170
158 3300010375 Ga0105239_10086451 Ga0105239_100864514 170
159 3300010375 Ga0105239_10122644 Ga0105239_101226444 170
160 3300010375 Ga0105239_10814685 Ga0105239_108146851 170
161 3300010375 Ga0105239_10900960 Ga0105239_109009602 170
162 3300010375 Ga0105239_10965165 Ga0105239_109651651 170
163 3300010375 Ga0105239_11264498 Ga0105239_112644982 170
164 3300011119 Ga0105246_11009831 Ga0105246_110098311 170
165 3300013100 Ga0157373_10000086 Ga0157373_1000008631 170
166 3300013100 Ga0157373_10000678 Ga0157373_1000067824 170
167 3300013100 Ga0157373_10001842 Ga0157373_100018427 170
168 3300013100 Ga0157373_10008022 Ga0157373_100080227 170
169 3300013100 Ga0157373_10071533 Ga0157373_100715332 170
170 3300013100 Ga0157373_10071844 Ga0157373_100718444 170
171 3300013100 Ga0157373_10639818 Ga0157373_106398181 170
172 3300013102 Ga0157371_10000027 Ga0157371_100000278 170
173 3300013102 Ga0157371_10000107 Ga0157371_1000010737 170
174 3300013102 Ga0157371_10001199 Ga0157371_1000119922 170
175 3300013102 Ga0157371_10007301 Ga0157371_100073016 170
176 3300013102 Ga0157371_10015463 Ga0157371_100154632 170
177 3300013102 Ga0157371_10052866 Ga0157371_100528662 170
178 3300013104 Ga0157370_10002773 Ga0157370_1000277317 170
179 3300013104 Ga0157370_10010241 Ga0157370_100102414 170
180 3300013104 Ga0157370_10037715 Ga0157370_100377154 170
181 3300013104 Ga0157370_10040970 Ga0157370_100409702 170
182 3300013104 Ga0157370_10060967 Ga0157370_100609672 170
183 3300013104 Ga0157370_10154246 Ga0157370_101542462 170
184 3300013104 Ga0157370_10263875 Ga0157370_102638754 170
185 3300013104 Ga0157370_11295704 Ga0157370_112957041 170
186 3300013105 Ga0157369_10000053 Ga0157369_10000053151 170
187 3300013105 Ga0157369_10030384 Ga0157369_100303848 170
188 3300013105 Ga0157369_10064840 Ga0157369_100648404 170
189 3300013105 Ga0157369_10102604 Ga0157369_101026044 170
190 3300013296 Ga0157374_10000301 Ga0157374_1000030127 170
191 3300013296 Ga0157374_10001665 Ga0157374_100016656 170
192 3300013296 Ga0157374_10040216 Ga0157374_100402164 170
193 3300013296 Ga0157374_10771293 Ga0157374_107712932 170
194 3300013297 Ga0157378_10131260 Ga0157378_101312604 170
195 3300013297 Ga0157378_10256974 Ga0157378_102569742 170
196 3300013297 Ga0157378_11271762 Ga0157378_112717622 170
197 3300013297 Ga0157378_11461580 Ga0157378_114615801 170
198 3300013306 Ga0163162_10000012 Ga0163162_10000012117 170
199 3300013306 Ga0163162_10001704 Ga0163162_1000170413 170
200 3300013306 Ga0163162_10157883 Ga0163162_101578832 170
201 3300013306 Ga0163162_10534813 Ga0163162_105348132 170
202 3300013306 Ga0163162_10841068 Ga0163162_108410682 170
203 3300013306 Ga0163162_11628199 Ga0163162_116281991 170
204 3300013307 Ga0157372_10000238 Ga0157372_1000023825 170
205 3300013307 Ga0157372_10002381 Ga0157372_1000238116 170
206 3300013307 Ga0157372_10025844 Ga0157372_100258445 170
207 3300013307 Ga0157372_10248316 Ga0157372_102483164 170
208 3300013307 Ga0157372_10463283 Ga0157372_104632833 170
209 3300013307 Ga0157372_11019471 Ga0157372_110194711 170
210 3300013307 Ga0157372_12008063 Ga0157372_120080632 170
211 3300013308 Ga0157375_10052665 Ga0157375_100526654 170
212 3300013308 Ga0157375_10245849 Ga0157375_102458493 170
213 3300014325 Ga0163163_10256878 Ga0163163_102568784 170
214 3300014497 Ga0182008_10000020 Ga0182008_10000020103 170
215 3300014497 Ga0182008_10000053 Ga0182008_1000005344 170
216 3300014497 Ga0182008_10009526 Ga0182008_100095262 170
217 3300014497 Ga0182008_10172814 Ga0182008_101728142 170
218 3300014745 Ga0157377_10045510 Ga0157377_100455102 170
219 3300014969 Ga0157376_10175793 Ga0157376_101757934 170
220 3300015261 Ga0182006_1001480 Ga0182006_10014806 170
221 3300015261 Ga0182006_1002073 Ga0182006_10020734 170
222 3300015261 Ga0182006_1002254 Ga0182006_10022547 170
223 3300015261 Ga0182006_1005760 Ga0182006_10057603 170
224 3300015262 Ga0182007_10000005 Ga0182007_10000005264 170
225 3300015262 Ga0182007_10020801 Ga0182007_100208012 170
226 3300017792 Ga0163161_10000869 Ga0163161_1000086925 170
227 3300017792 Ga0163161_10004348 Ga0163161_100043482 170
228 3300017792 Ga0163161_10022159 Ga0163161_100221592 170
229 3300017792 Ga0163161_10204387 Ga0163161_102043871 170
230 3300017792 Ga0163161_11273292 Ga0163161_112732921 170
231 3300017792 Ga0163161_11414056 Ga0163161_114140561 170
232 3300017792 Ga0163161_11595766 Ga0163161_115957661 170
233 3300020077 Ga0206351_10407532 Ga0206351_104075322 170
234 3300021361 Ga0213872_10041838 Ga0213872_100418384 170
235 3300025230 Ga0209563_114930 Ga0209563_1149302 170
236 3300025231 Ga0207427_100122 Ga0207427_10012242 170
237 3300025233 Ga0209437_100048 Ga0209437_100048254 170
238 3300025233 Ga0209437_100102 Ga0209437_100102151 170
239 3300025250 Ga0209026_1000852 Ga0209026_100085219 170
240 3300025250 Ga0209026_1001432 Ga0209026_100143211 170
241 3300025250 Ga0209026_1003805 Ga0209026_10038054 170
242 3300025261 Ga0209233_1000029 Ga0209233_1000029122 170
243 3300025272 Ga0209455_1005502 Ga0209455_10055023 170
244 3300025321 Ga0207656_10436429 Ga0207656_104364291 170
245 3300025899 Ga0207642_10140442 Ga0207642_101404422 170
246 3300025904 Ga0207647_10000018 Ga0207647_1000001897 170
247 3300025904 Ga0207647_10000071 Ga0207647_1000007145 170
248 3300025907 Ga0207645_10000229 Ga0207645_1000022929 170
249 3300025908 Ga0207643_10155399 Ga0207643_101553992 170
250 3300025909 Ga0207705_10000026 Ga0207705_10000026194 170
251 3300025909 Ga0207705_10139125 Ga0207705_101391252 170
252 3300025909 Ga0207705_10242446 Ga0207705_102424462 170
253 3300025909 Ga0207705_10895070 Ga0207705_108950701 170
254 3300025911 Ga0207654_10001026 Ga0207654_1000102615 170
255 3300025911 Ga0207654_10017176 Ga0207654_100171763 170
256 3300025911 Ga0207654_10433540 Ga0207654_104335401 170
257 3300025911 Ga0207654_10493197 Ga0207654_104931972 170
258 3300025913 Ga0207695_10000142 Ga0207695_1000014285 170
259 3300025913 Ga0207695_10008758 Ga0207695_100087584 170
260 3300025913 Ga0207695_10014909 Ga0207695_1001490910 170
261 3300025913 Ga0207695_10015835 Ga0207695_100158358 170
262 3300025913 Ga0207695_10242465 Ga0207695_102424652 170
263 3300025913 Ga0207695_10737429 Ga0207695_107374292 170
264 3300025914 Ga0207671_10000110 Ga0207671_1000011065 170
265 3300025914 Ga0207671_10001102 Ga0207671_1000110212 170
266 3300025914 Ga0207671_10001959 Ga0207671_1000195919 170
267 3300025914 Ga0207671_10031595 Ga0207671_100315953 170
268 3300025914 Ga0207671_10177031 Ga0207671_101770312 170
269 3300025914 Ga0207671_10451750 Ga0207671_104517501 170
270 3300025914 Ga0207671_10666811 Ga0207671_106668112 170
271 3300025914 Ga0207671_10782013 Ga0207671_107820132 170
272 3300025919 Ga0207657_10023154 Ga0207657_100231545 170
273 3300025919 Ga0207657_10047953 Ga0207657_100479533 170
274 3300025919 Ga0207657_10112838 Ga0207657_101128382 170
275 3300025921 Ga0207652_10045181 Ga0207652_100451815 170
276 3300025924 Ga0207694_10059940 Ga0207694_100599403 170
277 3300025924 Ga0207694_10068792 Ga0207694_100687924 170
278 3300025924 Ga0207694_10232789 Ga0207694_102327892 170
279 3300025924 Ga0207694_10274782 Ga0207694_102747821 170
280 3300025927 Ga0207687_10040078 Ga0207687_100400782 170
281 3300025932 Ga0207690_10001688 Ga0207690_100016887 170
282 3300025932 Ga0207690_10006502 Ga0207690_100065029 170
283 3300025932 Ga0207690_10282088 Ga0207690_102820884 170
284 3300025933 Ga0207706_10005255 Ga0207706_1000525512 170
285 3300025934 Ga0207686_10238570 Ga0207686_102385702 170
286 3300025935 Ga0207709_10000008 Ga0207709_10000008517 170
287 3300025935 Ga0207709_10530724 Ga0207709_105307241 170
288 3300025938 Ga0207704_10000047 Ga0207704_1000004745 170
289 3300025940 Ga0207691_10232782 Ga0207691_102327822 170
290 3300025942 Ga0207689_10191814 Ga0207689_101918142 170
291 3300025944 Ga0207661_10245444 Ga0207661_102454442 170
292 3300025949 Ga0207667_10012483 Ga0207667_100124839 170
293 3300025949 Ga0207667_10026801 Ga0207667_100268012 170
294 3300025949 Ga0207667_10064910 Ga0207667_100649103 170
295 3300025949 Ga0207667_10130941 Ga0207667_101309412 170
296 3300025949 Ga0207667_10221240 Ga0207667_102212402 170
297 3300025949 Ga0207667_10553875 Ga0207667_105538752 170
298 3300025949 Ga0207667_10600839 Ga0207667_106008391 170
299 3300025949 Ga0207667_10668507 Ga0207667_106685073 170
300 3300025960 Ga0207651_10010529 Ga0207651_100105294 170
301 3300025961 Ga0207712_10802417 Ga0207712_108024172 170
302 3300025981 Ga0207640_10303257 Ga0207640_103032574 170
303 3300026041 Ga0207639_10009275 Ga0207639_100092758 170
304 3300026041 Ga0207639_10316462 Ga0207639_103164622 170
305 3300026078 Ga0207702_10002682 Ga0207702_100026826 170
306 3300026078 Ga0207702_10019319 Ga0207702_100193194 170
307 3300026078 Ga0207702_10069316 Ga0207702_100693166 170
308 3300026078 Ga0207702_10293151 Ga0207702_102931512 170
309 3300026078 Ga0207702_10642692 Ga0207702_106426921 170
310 3300026078 Ga0207702_10669085 Ga0207702_106690852 170
311 3300026089 Ga0207648_10007503 Ga0207648_100075038 170
312 3300026116 Ga0207674_10256679 Ga0207674_102566792 170
313 3300026116 Ga0207674_10416135 Ga0207674_104161353 170
314 3300026121 Ga0207683_10023462 Ga0207683_100234622 170
315 3300026142 Ga0207698_10010495 Ga0207698_100104952 170
316 3300026142 Ga0207698_11556216 Ga0207698_115562162 170
317 3300026142 Ga0207698_11834074 Ga0207698_118340741 170
318 3300028379 Ga0268266_10000121 Ga0268266_1000012150 170
319 3300028786 Ga0307517_10000198 Ga0307517_1000019847 170
320 3300028794 Ga0307515_10001436 Ga0307515_100014362 170
321 3300028794 Ga0307515_10260806 Ga0307515_102608062 170
322 3300028800 Ga0265338_10072380 Ga0265338_100723803 170
323 3300030744 Ga0316181_1228454 Ga0316181_12284542 170
324 3300031251 Ga0265327_10207920 Ga0265327_102079202 170
325 3300031507 Ga0307509_10100580 Ga0307509_101005803 170
326 3300031548 Ga0307408_100001326 Ga0307408_10000132610 170
327 3300031731 Ga0307405_10550912 Ga0307405_105509122 170
328 3300031903 Ga0307407_10000001 Ga0307407_10000001203 170
329 3300031911 Ga0307412_10000001 Ga0307412_10000001297 170
330 3300031911 Ga0307412_10008180 Ga0307412_100081807 170
331 3300031911 Ga0307412_10129794 Ga0307412_101297941 170
332 3300031911 Ga0307412_10203342 Ga0307412_102033422 170
333 3300031911 Ga0307412_10383105 Ga0307412_103831052 170
334 3300031911 Ga0307412_11276953 Ga0307412_112769531 170
335 3300031911 Ga0307412_11498174 Ga0307412_114981741 170
336 3300032002 Ga0307416_100000008 Ga0307416_100000008186 170
337 3300032004 Ga0307414_10000470 Ga0307414_1000047017 170
338 3300032004 Ga0307414_10002491 Ga0307414_100024916 170
339 3300032004 Ga0307414_10011763 Ga0307414_100117633 170
340 3300032004 Ga0307414_10032798 Ga0307414_100327982 170
341 3300032004 Ga0307414_10086939 Ga0307414_100869392 170
342 3300032004 Ga0307414_10195809 Ga0307414_101958092 170
343 3300032004 Ga0307414_10204184 Ga0307414_102041842 170
344 3300032004 Ga0307414_10217080 Ga0307414_102170801 170
345 3300032004 Ga0307414_10647644 Ga0307414_106476442 170
346 3300032126 Ga0307415_100096313 Ga0307415_1000963132 170
347 3300033179 Ga0307507_10000099 Ga0307507_1000009974 170
348 3300033180 Ga0307510_10005580 Ga0307510_100055806 170
349 3300037312 Ga0395899_0000027 Ga0395899_0000027_118744_119268 170
350 3300037312 Ga0395899_0000811 Ga0395899_0000811_15530_16054 170
351 3300037418 Ga0395900_0000275 Ga0395900_0000275_33219_33743 170
352 3300037418 Ga0395900_0001518 Ga0395900_0001518_16288_16812 170
353 3300037418 Ga0395900_0010124 Ga0395900_0010124_373_897 170
354 3300037466 Ga0395898_0009566 Ga0395898_0009566_2179_2703 170
355 3300037466 Ga0395898_0080809 Ga0395898_0080809_490_1014 170
356 3300037471 Ga0395905_0000248 Ga0395905_0000248_16166_16690 170
357 3300037471 Ga0395905_0000327 Ga0395905_0000327_21341_21865 170
358 3300038443 Ga0395901_0000595 Ga0395901_0000595_12784_13308 170
359 3300038443 Ga0395901_0008911 Ga0395901_0008911_4072_4596 170
360 3300038443 Ga0395901_0050730 Ga0395901_0050730_797_1318 170
361 3300039447 Ga0436361_0179743 Ga0436361_0179743_204_734 170
362 3300039447 Ga0436361_1048734 Ga0436361_1048734_3332_3856 170
363 3300041453 Ga0451797_0915911 Ga0451797_0915911_15_530 170
364 3300042005 Ga0439448_0002912 Ga0439448_0002912_3433_3957 170
365 3300042012 Ga0439455_0016974 Ga0439455_0016974_506_1030 170
366 3300046454 Ga0495592_0119577 Ga0495592_0119577_1008_1532 170
367 3300046460 Ga0495638_0306600 Ga0495638_0306600_184_708 170
368 3300046462 Ga0495651_0284170 Ga0495651_0284170_272_796 170
369 3300046471 Ga0495650_0000231 Ga0495650_0000231_40335_40859 170
370 3300046471 Ga0495650_0021584 Ga0495650_0021584_590_1114 170
371 3300046471 Ga0495650_0174249 Ga0495650_0174249_171_695 170
372 3300046492 Ga0495585_0000037 Ga0495585_0000037_44807_45331 170
373 3300046492 Ga0495585_0001133 Ga0495585_0001133_4934_5458 170
374 3300046500 Ga0495596_0012832 Ga0495596_0012832_1579_2103 170
375 3300046501 Ga0495607_0263245 Ga0495607_0263245_104_628 170
376 3300046506 Ga0495583_0019511 Ga0495583_0019511_113_637 170
377 3300046507 Ga0495606_0000060 Ga0495606_0000060_54795_55319 170
378 3300046507 Ga0495606_0015512 Ga0495606_0015512_1746_2270 170
379 3300046507 Ga0495606_0019551 Ga0495606_0019551_24_548 170
380 3300046507 Ga0495606_0051110 Ga0495606_0051110_994_1518 170
381 3300046507 Ga0495606_0232659 Ga0495606_0232659_212_736 170
382 3300046512 Ga0495610_0000751 Ga0495610_0000751_28271_28795 170
383 3300046513 Ga0495616_0002278 Ga0495616_0002278_3174_3698 170
384 3300046513 Ga0495616_0010131 Ga0495616_0010131_4522_5046 170
385 3300046513 Ga0495616_0230303 Ga0495616_0230303_79_603 170
386 3300046514 Ga0495618_0136731 Ga0495618_0136731_289_813 170
387 3300046518 Ga0495631_0001037 Ga0495631_0001037_6572_7096 170
388 3300046519 Ga0495632_0023088 Ga0495632_0023088_2519_3043 170
389 3300046519 Ga0495632_0192245 Ga0495632_0192245_334_858 170
390 3300046520 Ga0495637_0023168 Ga0495637_0023168_1416_1940 170
391 3300046523 Ga0495644_0010092 Ga0495644_0010092_1643_2167 170
392 3300046524 Ga0495648_0028735 Ga0495648_0028735_472_996 170
393 3300046528 Ga0495642_0058737 Ga0495642_0058737_170_694 170
394 3300046528 Ga0495642_0143334 Ga0495642_0143334_352_876 170
395 3300046528 Ga0495642_0161011 Ga0495642_0161011_73_597 170
396 3300046529 Ga0495652_0355428 Ga0495652_0355428_384_908 170
397 3300046529 Ga0495652_0533480 Ga0495652_0533480_63_587 170
398 3300046529 Ga0495652_0763754 Ga0495652_0763754_81_605 170
399 3300046538 Ga0495609_0004430 Ga0495609_0004430_1540_2064 170
400 3300046538 Ga0495609_0015197 Ga0495609_0015197_1234_1758 170
401 3300046538 Ga0495609_0015664 Ga0495609_0015664_1842_2354 170
402 3300046538 Ga0495609_0156479 Ga0495609_0156479_356_880 170
403 3300046538 Ga0495609_0187084 Ga0495609_0187084_22_549 170
404 3300046557 Ga0495622_0063454 Ga0495622_0063454_935_1459 170
405 3300046558 Ga0495633_0000015 Ga0495633_0000015_117444_117968 170
406 3300046558 Ga0495633_0004451 Ga0495633_0004451_1741_2265 170
407 3300046616 Ga0495668_0000041 Ga0495668_0000041_58627_59151 170
408 3300046616 Ga0495668_0278759 Ga0495668_0278759_292_816 170
409 3300046648 Ga0495611_0489490 Ga0495611_0489490_21_545 170
410 3300046660 Ga0495625_0000191 Ga0495625_0000191_53664_54188 170
411 3300046660 Ga0495625_0001074 Ga0495625_0001074_10382_10906 170
412 3300046660 Ga0495625_0005576 Ga0495625_0005576_804_1328 170
413 3300046660 Ga0495625_0071948 Ga0495625_0071948_221_745 170
414 3300046660 Ga0495625_0243985 Ga0495625_0243985_341_865 170
415 3300046660 Ga0495625_0287468 Ga0495625_0287468_469_993 170
416 3300046660 Ga0495625_0445919 Ga0495625_0445919_128_652 170
417 3300046660 Ga0495625_0621354 Ga0495625_0621354_29_553 170
418 3300046665 Ga0495661_0082697 Ga0495661_0082697_60_584 170
419 3300046674 Ga0495588_0315847 Ga0495588_0315847_75_599 170
420 3300046674 Ga0495588_0450682 Ga0495588_0450682_26_550 170
421 3300046683 Ga0495658_0061559 Ga0495658_0061559_1044_1568 170
422 3300046684 Ga0495669_0156515 Ga0495669_0156515_117_641 170
423 3300046684 Ga0495669_0270858 Ga0495669_0270858_91_615 170
424 3300046694 Ga0495649_0000061 Ga0495649_0000061_43176_43700 170
425 3300046694 Ga0495649_0034219 Ga0495649_0034219_1377_1901 170
426 3300046810 Ga0495660_0022764 Ga0495660_0022764_1668_2192 170
427 3300046810 Ga0495660_0044026 Ga0495660_0044026_495_1019 170
428 3300047323 Ga0495683_0015934 Ga0495683_0015934_1498_2022 170
429 3300047443 Ga0495687_000570 Ga0495687_000570_28745_29269 170
430 3300047443 Ga0495687_043561 Ga0495687_043561_166_690 170
431 3300047445 Ga0495677_0016707 Ga0495677_0016707_96_620 170
432 3300047447 Ga0495685_046715 Ga0495685_046715_281_805 170
433 3300047469 Ga0495673_0011433 Ga0495673_0011433_2699_3223 170
434 3300047470 Ga0495681_0094177 Ga0495681_0094177_179_694 170
435 3300047472 Ga0495686_0000679 Ga0495686_0000679_37933_38457 170
436 3300047472 Ga0495686_0002403 Ga0495686_0002403_1586_2113 170
437 3300047472 Ga0495686_0175761 Ga0495686_0175761_173_697 170
438 3300048088 Ga0495602_0709839 Ga0495602_0709839_131_655 170
439 3300048919 Ga0496116_0003271 Ga0496116_0003271_9732_10253 170
440 3300048920 Ga0496117_0019589 Ga0496117_0019589_3107_3628 170
441 3300048925 Ga0496122_0007262 Ga0496122_0007262_5021_5542 170
442 3300048925 Ga0496122_0010569 Ga0496122_0010569_4496_5008 170
443 3300048926 Ga0496123_0000777 Ga0496123_0000777_4688_5200 170
444 3300048926 Ga0496123_0015571 Ga0496123_0015571_969_1490 170
445 3300048928 Ga0496125_0482577 Ga0496125_0482577_108_629 170
446 3300048929 Ga0496126_0320667 Ga0496126_0320667_298_819 170
447 3300049459 Ga0495678_017094 Ga0495678_017094_2363_2887 170
448 3300049460 Ga0495682_0017181 Ga0495682_0017181_1005_1529 170
449 3300049758 Ga0501241_016036 Ga0501241_016036_265_777 170
450 3300050493 nmdc:mga0k408_179107_c1 nmdc:mga0k408_179107_c1_307_831 170
451 3300050493 nmdc:mga0k408_31_c1 nmdc:mga0k408_31_c1_52619_53143 170
452 3300050493 nmdc:mga0k408_3587_c1 nmdc:mga0k408_3587_c1_2453_2977 170
453 3300050496 nmdc:mga07m45_62567_c1 nmdc:mga07m45_62567_c1_804_1328 170
454 3300050496 nmdc:mga07m45_75609_c1 nmdc:mga07m45_75609_c1_512_1045 170
455 3300053080 Ga0500635_0000960 Ga0500635_0000960_4134_4658 170
456 3300053093 Ga0500651_0000058 Ga0500651_0000058_34505_35017 170
457 3300053098 Ga0500650_0129273 Ga0500650_0129273_564_1088 170
458 3300053122 Ga0500608_000440 Ga0500608_000440_8625_9149 170
459 3300053122 Ga0500608_121674 Ga0500608_121674_398_922 170
460 3300053123 Ga0500614_011559 Ga0500614_011559_1259_1783 170
461 3300053125 Ga0500618_000016 Ga0500618_000016_12470_12994 170
462 3300053125 Ga0500618_047778 Ga0500618_047778_162_686 170
463 3300053138 Ga0500564_167247 Ga0500564_167247_17_541 170
464 3300053140 Ga0500573_0155606 Ga0500573_0155606_41_553 170
465 3300053153 Ga0500616_0153765 Ga0500616_0153765_384_908 170
466 3300053156 Ga0500622_0010132 Ga0500622_0010132_1770_2294 170
467 3300053157 Ga0500624_001646 Ga0500624_001646_2167_2691 170
468 3300059642 Ga0587069_038480 Ga0587069_038480_175_699 170

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

20

168

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a24-assembly1.cif.gz_B assembly intermediate of the plant mitochondrial complex i 0.9603 9 169
7p7c-assembly1.cif.gz_E complex i from e. coli, ddm/lmng-purified, apo, open state 0.9593 10 166
8b9z-assembly1.cif.gz_E drosophila melanogaster complex i in the active state (dm1) 0.9585 9 168
7v2c-assembly1.cif.gz_O active state complex i from q10 dataset 0.9552 7 168
6x89-assembly1.cif.gz_V2 vigna radiata mitochondrial complex i* 0.9534 9 169
ID Description Score Start End Superfamily
af_Q6PBX8_48_121_1.10.10.1590 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9896 10 83 1.10.10.1590
af_Q6PBX8_48_121_1.10.10.1590 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9765 10 83 1.10.10.1590
af_O13691_6_74_1.10.10.1590 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9564 11 76 1.10.10.1590
af_Q9D6J6_126_223_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.956 85 168 3.40.30.10
af_B4FPX5_191_300_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9429 85 169 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A519UYH2-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.9871 30 170 GO:0003954
GO:0046872
GO:0051537
AF-A0A7W3R2U2-F1-model_v4 deleted 0.9865 9 169
AF-A0A4V1USE5-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.9862 47 170 GO:0003954
GO:0046872
GO:0051537
AF-A0A1I6ULP5-F1-model_v4 NADH dehydrogenase subunit E 0.9828 9 169 GO:0003954
GO:0046872
GO:0051537
AF-A0A7Y4WLW5-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.9781 12 168 GO:0003954
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
91 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map