F449993

General Info

Members Datasets Scaffolds Average Seq Length
468 242 468 135

Family's Representative Sequence

Representative Sequence 3300005543|Ga0070672_100465110|Ga0070672_1004651101
Length 149
Sequence VSTSLDAYLGMHPAALRLREQRTELLARNLANADTPGYKAQDMDFRAALAAVSSSTGAPGTLQATRSGHFGVQGETGQGSVNQGAEAVLSGSTESFLRYRTPLAPSLDGNTVDAQLEQAAFADNAVRYQATLSFLSSKFRSLMTAITGQ

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
144 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
168 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
169 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
170 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
171 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
172 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
173 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
174 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
175 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
176 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
177 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
178 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
179 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
183 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
186 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
189 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
192 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
197 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
212 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
236 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
237 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
238 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
239 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
240 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
241 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0
Rhizoplane 4.49
Rhizosphere 84.19
Stem 0
Stem Tuber 0
Unclassified 9.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10079342 3300003316 Bacteria 6234
2 rootH2_10072707 3300003320 Bacteria 4980
3 rootL2_10103198 3300003322 Bacteria 1597
4 rootH1_10060200 3300003323 Bacteria 3659
5 Ga0065704_10070579 3300005289 Bacteria 19940
6 Ga0070658_11386024 3300005327 Bacteria 610
7 Ga0070683_100097009 3300005329 Bacteria 2773
8 Ga0070670_100099168 3300005331 Bacteria 2507
9 Ga0070670_101002119 3300005331 Unclassified 760
10 Ga0070677_10014380 3300005333 Bacteria 2784
11 Ga0070677_10043033 3300005333 Bacteria 1791
12 Ga0068869_100051988 3300005334 Bacteria 2974
13 Ga0068869_101586984 3300005334 Bacteria 582
14 Ga0070666_10174984 3300005335 Bacteria 1504
15 Ga0070682_100610287 3300005337 Bacteria 863
16 Ga0068868_101569183 3300005338 Bacteria 618
17 Ga0070689_100018416 3300005340 Bacteria 5144
18 Ga0070689_100128853 3300005340 Bacteria 2027
19 Ga0070689_100131781 3300005340 Bacteria 2005
20 Ga0070689_101659683 3300005340 Bacteria 581
21 Ga0070689_102112695 3300005340 Bacteria 516
22 Ga0070687_100350295 3300005343 Unclassified 953
23 Ga0070661_101194389 3300005344 Bacteria 636
24 Ga0070669_100167736 3300005353 Bacteria 1710
25 Ga0070669_101085638 3300005353 Bacteria 689
26 Ga0070669_101999813 3300005353 Unclassified 506
27 Ga0070675_100027247 3300005354 Bacteria 4590
28 Ga0070675_100042743 3300005354 Bacteria 3703
29 Ga0070675_100208868 3300005354 Bacteria 1696
30 Ga0070675_101528128 3300005354 Bacteria 616
31 Ga0070671_100000478 3300005355 Bacteria 27808
32 Ga0070671_100266886 3300005355 Bacteria 1455
33 Ga0070671_100315953 3300005355 Bacteria 1331
34 Ga0070671_100576159 3300005355 Bacteria 972
35 Ga0070674_100089354 3300005356 Bacteria 2219
36 Ga0070674_100141086 3300005356 Bacteria 1808
37 Ga0070674_100257621 3300005356 Bacteria 1373
38 Ga0070673_100060412 3300005364 Bacteria 3003
39 Ga0070673_100062077 3300005364 Bacteria 2968
40 Ga0070688_100254953 3300005365 Bacteria 1251
41 Ga0070688_100979605 3300005365 Bacteria 671
42 Ga0070667_100019855 3300005367 Bacteria 5576
43 Ga0070667_100020397 3300005367 Bacteria 5502
44 Ga0070667_100254339 3300005367 Bacteria 1571
45 Ga0070703_10029691 3300005406 Bacteria 1643
46 Ga0070701_10193986 3300005438 Bacteria 1197
47 Ga0070701_10229279 3300005438 Bacteria 1112
48 Ga0070701_10656939 3300005438 Bacteria 701
49 Ga0070705_100200144 3300005440 Bacteria 1369
50 Ga0070705_100804579 3300005440 Bacteria 748
51 Ga0070700_100056751 3300005441 Bacteria 2456
52 Ga0070700_100090622 3300005441 Bacteria 1994
53 Ga0070700_100147371 3300005441 Bacteria 1606
54 Ga0070700_100217456 3300005441 Bacteria 1352
55 Ga0070694_100018203 3300005444 Bacteria 4457
56 Ga0070663_100623263 3300005455 Bacteria 909
57 Ga0070663_101684960 3300005455 Bacteria 567
58 Ga0070678_100024624 3300005456 Bacteria 4034
59 Ga0070678_100050138 3300005456 Bacteria 3017
60 Ga0070678_100533090 3300005456 Bacteria 1040
61 Ga0070678_101253859 3300005456 Bacteria 689
62 Ga0070681_10277352 3300005458 Unclassified 1587
63 Ga0070681_10706782 3300005458 Bacteria 924
64 Ga0068867_100031083 3300005459 Bacteria 3854
65 Ga0068867_100060114 3300005459 Bacteria 2818
66 Ga0068867_101940060 3300005459 Bacteria 556
67 Ga0070685_11023442 3300005466 Bacteria 621
68 Ga0070685_11366690 3300005466 Bacteria 543
69 Ga0070679_100182767 3300005530 Bacteria 2069
70 Ga0070684_100677646 3300005535 Bacteria 961
71 Ga0070697_101700730 3300005536 Bacteria 564
72 Ga0070672_100032604 3300005543 Bacteria 3934
73 Ga0070672_100133643 3300005543 Bacteria 2041
74 Ga0070672_100465110 3300005543 Bacteria 1091
75 Ga0070672_100769976 3300005543 Bacteria 845
76 Ga0070672_101970075 3300005543 Bacteria 526
77 Ga0070686_100040261 3300005544 Bacteria 2915
78 Ga0070686_100108473 3300005544 Bacteria 1887
79 Ga0070686_100965447 3300005544 Bacteria 697
80 Ga0070696_100792778 3300005546 Bacteria 779
81 Ga0070693_100407181 3300005547 Bacteria 945
82 Ga0070693_101508067 3300005547 Bacteria 526
83 Ga0070665_100014405 3300005548 Bacteria 7935
84 Ga0070665_100061429 3300005548 Bacteria 3767
85 Ga0070665_100078759 3300005548 Bacteria 3302
86 Ga0070665_100131417 3300005548 Bacteria 2506
87 Ga0070665_101265945 3300005548 Bacteria 748
88 Ga0070665_101335909 3300005548 Bacteria 726
89 Ga0068855_100060286 3300005563 Bacteria 4438
90 Ga0070664_100056479 3300005564 Bacteria 3335
91 Ga0070664_100847576 3300005564 Bacteria 856
92 Ga0070664_100882389 3300005564 Unclassified 838
93 Ga0068857_100312890 3300005577 Bacteria 1449
94 Ga0068854_100132763 3300005578 Bacteria 1903
95 Ga0068856_100297086 3300005614 Bacteria 1632
96 Ga0068856_100326526 3300005614 Bacteria 1552
97 Ga0070702_100069796 3300005615 Bacteria 2072
98 Ga0070702_100076676 3300005615 Bacteria 1990
99 Ga0068852_100381544 3300005616 Bacteria 1383
100 Ga0068859_100001791 3300005617 Bacteria 21873
101 Ga0068859_100046101 3300005617 Bacteria 4379
102 Ga0068859_100440066 3300005617 Bacteria 1400
103 Ga0068859_100472257 3300005617 Bacteria 1350
104 Ga0068864_100031015 3300005618 Bacteria 4534
105 Ga0068864_100126053 3300005618 Bacteria 2295
106 Ga0068864_100404546 3300005618 Bacteria 1298
107 Ga0068864_101288573 3300005618 Bacteria 731
108 Ga0068866_10260772 3300005718 Bacteria 1065
109 Ga0068861_100003252 3300005719 Bacteria 10754
110 Ga0068861_100105064 3300005719 Bacteria 2254
111 Ga0068861_100139153 3300005719 Bacteria 1979
112 Ga0068861_100147995 3300005719 Bacteria 1924
113 Ga0068861_100310018 3300005719 Bacteria 1370
114 Ga0068861_101190127 3300005719 Unclassified 736
115 Ga0068851_10322692 3300005834 Bacteria 893
116 Ga0068870_10012248 3300005840 Bacteria 4003
117 Ga0068870_10025237 3300005840 Bacteria 2949
118 Ga0068870_10103000 3300005840 Bacteria 1617
119 Ga0068863_100050921 3300005841 Bacteria 3925
120 Ga0068863_100693980 3300005841 Bacteria 1011
121 Ga0068858_100003886 3300005842 Bacteria 14756
122 Ga0068858_100027224 3300005842 Bacteria 5312
123 Ga0068860_100000336 3300005843 Bacteria 63681
124 Ga0068860_100010835 3300005843 Bacteria 8999
125 Ga0068860_100352211 3300005843 Bacteria 1449
126 Ga0068860_100820574 3300005843 Bacteria 944
127 Ga0068860_100884719 3300005843 Bacteria 909
128 Ga0068862_100057484 3300005844 Bacteria 3336
129 Ga0068862_100058883 3300005844 Bacteria 3297
130 Ga0068862_100118869 3300005844 Bacteria 2327
131 Ga0068862_100427875 3300005844 Bacteria 1244
132 Ga0068862_100501887 3300005844 Bacteria 1152
133 Ga0075366_10553688 3300006195 Bacteria 712
134 Ga0097621_100021188 3300006237 Bacteria 5022
135 Ga0097621_100148846 3300006237 Bacteria 2006
136 Ga0097621_100157887 3300006237 Bacteria 1948
137 Ga0097621_100238022 3300006237 Bacteria 1591
138 Ga0068871_100059944 3300006358 Bacteria 3102
139 Ga0068871_100212045 3300006358 Bacteria 1675
140 Ga0075428_100317233 3300006844 Bacteria 1675
141 Ga0075430_100457887 3300006846 Bacteria 1053
142 Ga0075430_100701481 3300006846 Bacteria 834
143 Ga0068865_100230813 3300006881 Bacteria 1452
144 Ga0068865_100542354 3300006881 Bacteria 976
145 Ga0097620_100001791 3300006931 Bacteria 21873
146 Ga0097620_100046100 3300006931 Bacteria 4379
147 Ga0097620_100440104 3300006931 Bacteria 1400
148 Ga0097620_100472179 3300006931 Bacteria 1350
149 Ga0105250_10173706 3300009092 Bacteria 903
150 Ga0105240_10049280 3300009093 Bacteria 5318
151 Ga0105240_10213674 3300009093 Bacteria 2252
152 Ga0105240_10274654 3300009093 Bacteria 1939
153 Ga0105240_12103353 3300009093 Bacteria 586
154 Ga0111539_11838937 3300009094 Bacteria 702
155 Ga0105245_10233900 3300009098 Bacteria 1778
156 Ga0105247_10001745 3300009101 Bacteria 15318
157 Ga0105247_10101356 3300009101 Bacteria 1841
158 Ga0105243_12052105 3300009148 Bacteria 607
159 Ga0105242_10874318 3300009176 Bacteria 896
160 Ga0105248_10037409 3300009177 Bacteria 5430
161 Ga0105248_10103908 3300009177 Bacteria 3203
162 Ga0105248_13069205 3300009177 Bacteria 532
163 Ga0105237_10029300 3300009545 Bacteria 5597
164 Ga0105237_10218150 3300009545 Bacteria 1908
165 Ga0105237_11189947 3300009545 Bacteria 769
166 Ga0105238_10107761 3300009551 Bacteria 2767
167 Ga0105238_10506563 3300009551 Bacteria 1208
168 Ga0105238_10834747 3300009551 Bacteria 938
169 Ga0105238_10850140 3300009551 Bacteria 930
170 Ga0105238_11041387 3300009551 Bacteria 840
171 Ga0105238_11238177 3300009551 Bacteria 771
172 Ga0105249_10012823 3300009553 Bacteria 7394
173 Ga0105249_10200265 3300009553 Bacteria 1954
174 Ga0105249_11666351 3300009553 Bacteria 710
175 Ga0105249_12152032 3300009553 Bacteria 631
176 Ga0105239_10382320 3300010375 Bacteria 1592
177 Ga0105246_10146527 3300011119 Bacteria 1782
178 Ga0157369_11029334 3300013105 Bacteria 843
179 Ga0157374_10061637 3300013296 Bacteria 3514
180 Ga0157374_10338149 3300013296 Bacteria 1494
181 Ga0163162_10125783 3300013306 Bacteria 2670
182 Ga0157372_10208691 3300013307 Bacteria 2263
183 Ga0157375_10748480 3300013308 Bacteria 1129
184 Ga0157375_13671108 3300013308 Bacteria 510
185 Ga0163163_10022613 3300014325 Bacteria 5959
186 Ga0163163_10193961 3300014325 Bacteria 2079
187 Ga0163163_10212999 3300014325 Bacteria 1981
188 Ga0163163_10407930 3300014325 Bacteria 1417
189 Ga0163163_10943550 3300014325 Bacteria 926
190 Ga0163163_11951237 3300014325 Unclassified 647
191 Ga0157380_10018508 3300014326 Bacteria 5171
192 Ga0157380_10195561 3300014326 Bacteria 1789
193 Ga0157380_10204219 3300014326 Bacteria 1755
194 Ga0157380_10226698 3300014326 Bacteria 1675
195 Ga0157380_10626832 3300014326 Bacteria 1068
196 Ga0157379_10017478 3300014968 Bacteria 6314
197 Ga0157379_10040520 3300014968 Bacteria 4157
198 Ga0157379_10062770 3300014968 Bacteria 3322
199 Ga0157376_11547504 3300014969 Bacteria 697
200 Ga0163161_10654489 3300017792 Bacteria 871
201 Ga0213874_10270047 3300021377 Bacteria 632
202 Ga0213876_10028478 3300021384 Bacteria 2946
203 Ga0207656_10110196 3300025321 Bacteria 1271
204 Ga0207682_10007692 3300025893 Bacteria 4287
205 Ga0207682_10025199 3300025893 Bacteria 2358
206 Ga0207682_10160259 3300025893 Bacteria 1019
207 Ga0207642_10487506 3300025899 Bacteria 753
208 Ga0207710_10000578 3300025900 Bacteria 21798
209 Ga0207688_10105323 3300025901 Bacteria 1632
210 Ga0207680_10009119 3300025903 Bacteria 4907
211 Ga0207647_10041293 3300025904 Bacteria 2902
212 Ga0207645_10284034 3300025907 Bacteria 1099
213 Ga0207643_10035998 3300025908 Bacteria 2776
214 Ga0207643_10122658 3300025908 Bacteria 1541
215 Ga0207643_10216881 3300025908 Bacteria 1170
216 Ga0207654_10458661 3300025911 Bacteria 895
217 Ga0207707_10079897 3300025912 Bacteria 2855
218 Ga0207695_10195390 3300025913 Bacteria 1939
219 Ga0207695_10501638 3300025913 Bacteria 1096
220 Ga0207671_10028270 3300025914 Bacteria 4190
221 Ga0207671_11557139 3300025914 Unclassified 509
222 Ga0207662_10163797 3300025918 Bacteria 1422
223 Ga0207652_10307181 3300025921 Bacteria 1432
224 Ga0207681_10281340 3300025923 Bacteria 1310
225 Ga0207694_10067915 3300025924 Bacteria 2783
226 Ga0207694_10135413 3300025924 Bacteria 1978
227 Ga0207650_11898314 3300025925 Bacteria 503
228 Ga0207659_10088467 3300025926 Bacteria 2307
229 Ga0207659_10184371 3300025926 Bacteria 1656
230 Ga0207664_11751954 3300025929 Bacteria 544
231 Ga0207644_10001813 3300025931 Bacteria 13872
232 Ga0207644_10456759 3300025931 Bacteria 1050
233 Ga0207690_10950352 3300025932 Bacteria 714
234 Ga0207706_10079427 3300025933 Bacteria 2885
235 Ga0207706_10291294 3300025933 Bacteria 1423
236 Ga0207706_10610264 3300025933 Bacteria 937
237 Ga0207709_10453547 3300025935 Bacteria 992
238 Ga0207670_10002422 3300025936 Bacteria 9786
239 Ga0207670_10700048 3300025936 Bacteria 839
240 Ga0207670_10754435 3300025936 Bacteria 808
241 Ga0207670_10862298 3300025936 Bacteria 757
242 Ga0207669_10170999 3300025937 Bacteria 1546
243 Ga0207669_10397597 3300025937 Bacteria 1078
244 Ga0207704_10199674 3300025938 Bacteria 1462
245 Ga0207704_10243754 3300025938 Bacteria 1345
246 Ga0207704_10329544 3300025938 Bacteria 1181
247 Ga0207704_10946315 3300025938 Bacteria 726
248 Ga0207691_10023894 3300025940 Bacteria 5752
249 Ga0207691_10049968 3300025940 Bacteria 3830
250 Ga0207691_10111380 3300025940 Bacteria 2434
251 Ga0207691_10990664 3300025940 Bacteria 702
252 Ga0207711_10195974 3300025941 Bacteria 1842
253 Ga0207711_10269758 3300025941 Bacteria 1565
254 Ga0207689_10236092 3300025942 Bacteria 1511
255 Ga0207661_10238299 3300025944 Bacteria 1613
256 Ga0207661_10439789 3300025944 Bacteria 1187
257 Ga0207661_11751383 3300025944 Unclassified 567
258 Ga0207679_10203307 3300025945 Bacteria 1656
259 Ga0207679_10277744 3300025945 Bacteria 1435
260 Ga0207667_10262287 3300025949 Bacteria 1766
261 Ga0207651_10041215 3300025960 Bacteria 3063
262 Ga0207651_10898500 3300025960 Bacteria 789
263 Ga0207651_11603733 3300025960 Bacteria 586
264 Ga0207712_10257478 3300025961 Bacteria 1414
265 Ga0207712_11580397 3300025961 Bacteria 588
266 Ga0207668_10264320 3300025972 Bacteria 1404
267 Ga0207668_11671880 3300025972 Bacteria 575
268 Ga0207640_10186700 3300025981 Bacteria 1559
269 Ga0207640_10382280 3300025981 Bacteria 1141
270 Ga0207658_10023125 3300025986 Bacteria 4334
271 Ga0207658_10358107 3300025986 Bacteria 1272
272 Ga0207658_10465798 3300025986 Bacteria 1121
273 Ga0207658_11048415 3300025986 Bacteria 744
274 Ga0207703_10001055 3300026035 Bacteria 26290
275 Ga0207703_10007856 3300026035 Bacteria 8436
276 Ga0207703_10951342 3300026035 Bacteria 823
277 Ga0207678_10006319 3300026067 Bacteria 10520
278 Ga0207678_10073378 3300026067 Bacteria 2932
279 Ga0207678_10162453 3300026067 Bacteria 1907
280 Ga0207678_11371273 3300026067 Bacteria 625
281 Ga0207708_10052890 3300026075 Bacteria 3093
282 Ga0207708_10243722 3300026075 Bacteria 1446
283 Ga0207708_10289676 3300026075 Bacteria 1329
284 Ga0207702_10907245 3300026078 Bacteria 873
285 Ga0207641_10000788 3300026088 Bacteria 33846
286 Ga0207641_10038112 3300026088 Bacteria 4018
287 Ga0207641_10576404 3300026088 Bacteria 1100
288 Ga0207648_10024885 3300026089 Bacteria 5338
289 Ga0207648_10083899 3300026089 Bacteria 2779
290 Ga0207648_10906049 3300026089 Bacteria 824
291 Ga0207648_10932439 3300026089 Bacteria 812
292 Ga0207676_10259126 3300026095 Bacteria 1569
293 Ga0207674_10090324 3300026116 Bacteria 3054
294 Ga0207674_10132140 3300026116 Bacteria 2459
295 Ga0207675_100005952 3300026118 Bacteria 11621
296 Ga0207675_100009707 3300026118 Bacteria 9006
297 Ga0207675_100065887 3300026118 Bacteria 3385
298 Ga0207675_100116858 3300026118 Bacteria 2521
299 Ga0207675_100160397 3300026118 Bacteria 2145
300 Ga0207675_100187219 3300026118 Bacteria 1984
301 Ga0207675_100302040 3300026118 Bacteria 1559
302 Ga0207675_101030834 3300026118 Bacteria 842
303 Ga0207675_101065548 3300026118 Bacteria 828
304 Ga0207683_10007590 3300026121 Bacteria 9292
305 Ga0207683_10056803 3300026121 Bacteria 3434
306 Ga0207683_10852070 3300026121 Bacteria 846
307 Ga0268266_10010200 3300028379 Bacteria 8230
308 Ga0268266_10028775 3300028379 Bacteria 4723
309 Ga0268266_10030805 3300028379 Bacteria 4555
310 Ga0268266_10179363 3300028379 Bacteria 1927
311 Ga0268266_10351773 3300028379 Bacteria 1385
312 Ga0268266_10466404 3300028379 Bacteria 1202
313 Ga0268265_10013311 3300028380 Bacteria 5589
314 Ga0268265_10079588 3300028380 Bacteria 2581
315 Ga0268265_10347525 3300028380 Bacteria 1353
316 Ga0268265_10571352 3300028380 Bacteria 1076
317 Ga0268265_11190008 3300028380 Bacteria 759
318 Ga0268265_11375421 3300028380 Bacteria 707
319 Ga0268264_10000034 3300028381 Bacteria 401894
320 Ga0268264_10023331 3300028381 Bacteria 5048
321 Ga0268264_10348702 3300028381 Bacteria 1408
322 Ga0268264_10369823 3300028381 Bacteria 1370
323 Ga0268264_10599313 3300028381 Bacteria 1086
324 Ga0307515_10166503 3300028794 Bacteria 2219
325 Ga0307511_10008918 3300030521 Bacteria 10009
326 Ga0307511_10296365 3300030521 Bacteria 734
327 Ga0265762_1046843 3300030760 Bacteria 859
328 Ga0265340_10117165 3300031247 Bacteria 1227
329 Ga0307513_10048981 3300031456 Bacteria 4580
330 Ga0307513_10052120 3300031456 Bacteria 4408
331 Ga0307513_10057408 3300031456 Bacteria 4146
332 Ga0307513_10060203 3300031456 Bacteria 4025
333 Ga0307509_10000106 3300031507 Bacteria 118906
334 Ga0307509_10096640 3300031507 Bacteria 3005
335 Ga0307509_10255531 3300031507 Bacteria 1532
336 Ga0307408_100184943 3300031548 Bacteria 1674
337 Ga0307508_10096552 3300031616 Bacteria 2547
338 Ga0307514_10123690 3300031649 Bacteria 1798
339 Ga0307405_10116415 3300031731 Bacteria 1820
340 Ga0307413_10003137 3300031824 Bacteria 6893
341 Ga0307410_10099677 3300031852 Bacteria 2080
342 Ga0307407_10203203 3300031903 Bacteria 1329
343 Ga0307407_10902506 3300031903 Bacteria 678
344 Ga0307412_11100798 3300031911 Bacteria 707
345 Ga0307412_11858672 3300031911 Bacteria 555
346 Ga0307409_100018163 3300031995 Bacteria 4715
347 Ga0307416_100077922 3300032002 Bacteria 2786
348 Ga0307416_100358275 3300032002 Bacteria 1480
349 Ga0307411_10290931 3300032005 Bacteria 1305
350 Ga0307411_11360864 3300032005 Bacteria 648
351 Ga0307415_100544996 3300032126 Bacteria 1023
352 Ga0307510_10000005 3300033180 Bacteria 633068
353 Ga0307510_10004723 3300033180 Bacteria 16106
354 Ga0373936_0013220 3300035113 Bacteria 3149
355 Ga0373936_0019073 3300035113 Bacteria 2656
356 Ga0373961_0411844 3300035241 Bacteria 521
357 Ga0373937_0616311 3300036401 Bacteria 1030
358 Ga0436364_0005604 3300037853 Bacteria 1329
359 Ga0436365_0371612 3300039437 Bacteria 2104
360 Ga0436365_1280088 3300039437 Bacteria 7083
361 Ga0436363_0794491 3300039450 Bacteria 638
362 Ga0451789_1144774 3300041443 Bacteria 579
363 Ga0451791_0084078 3300041451 Bacteria 2189
364 Ga0451791_1825438 3300041451 Bacteria 1528
365 Ga0451793_1110932 3300041452 Unclassified 556
366 Ga0451793_1112111 3300041452 Bacteria 1477
367 Ga0451797_1100325 3300041453 Bacteria 1198
368 Ga0451797_1381115 3300041453 Bacteria 1182
369 Ga0451800_0834743 3300041459 Bacteria 629
370 Ga0451802_1142996 3300041460 Bacteria 619
371 Ga0451804_0423055 3300041463 Bacteria 617
372 Ga0451807_0207366 3300041486 Bacteria 697
373 Ga0451807_0246237 3300041486 Bacteria 872
374 Ga0451843_1454857 3300041509 Bacteria 697
375 Ga0450923_074767 3300042125 Bacteria 755
376 Ga0450898_031046 3300042134 Bacteria 981
377 Ga0439458_0032185 3300042157 Bacteria 1253
378 Ga0450916_023314 3300042530 Unclassified 863
379 Ga0451577_0434055 3300042876 Bacteria 1193
380 Ga0451577_1509221 3300042876 Bacteria 594
381 Ga0451576_0477997 3300045051 Bacteria 1309
382 Ga0451576_0486654 3300045051 Bacteria 1296
383 Ga0495617_037003 3300046452 Bacteria 1636
384 Ga0495590_0001726 3300046457 Bacteria 9295
385 Ga0495638_0016204 3300046460 Bacteria 4996
386 Ga0495638_0412014 3300046460 Bacteria 699
387 Ga0495641_0108590 3300046461 Bacteria 1238
388 Ga0495641_0148959 3300046461 Bacteria 1046
389 Ga0495584_0507684 3300046491 Bacteria 614
390 Ga0495606_0055714 3300046507 Bacteria 2556
391 Ga0495606_0114064 3300046507 Bacteria 1626
392 Ga0495610_0295096 3300046512 Bacteria 627
393 Ga0495616_0000636 3300046513 Bacteria 26231
394 Ga0495616_0100959 3300046513 Bacteria 1353
395 Ga0495628_1034665 3300046516 Bacteria 564
396 Ga0495632_0034307 3300046519 Bacteria 2598
397 Ga0495632_0288154 3300046519 Bacteria 730
398 Ga0495632_0300502 3300046519 Bacteria 712
399 Ga0495609_0260084 3300046538 Bacteria 713
400 Ga0495668_0172404 3300046616 Bacteria 1185
401 Ga0495611_0124715 3300046648 Bacteria 1201
402 Ga0495611_0475184 3300046648 Unclassified 569
403 Ga0495625_0015857 3300046660 Bacteria 5949
404 Ga0495625_0092992 3300046660 Bacteria 2083
405 Ga0495649_0010536 3300046694 Bacteria 5450
406 Ga0495649_0030403 3300046694 Bacteria 2983
407 Ga0495649_0121371 3300046694 Bacteria 1382
408 Ga0495589_0546999 3300046794 Bacteria 528
409 Ga0495686_0075849 3300047472 Bacteria 2061
410 Ga0495626_0108232 3300048091 Bacteria 1206
411 Ga0496102_0074653 3300048905 Bacteria 3117
412 Ga0496102_1312547 3300048905 Bacteria 643
413 Ga0496103_0169937 3300048906 Bacteria 1400
414 Ga0496104_1618736 3300048907 Bacteria 550
415 Ga0496106_0096407 3300048909 Bacteria 2289
416 Ga0496107_0688695 3300048910 Bacteria 752
417 Ga0496108_0631939 3300048911 Bacteria 931
418 Ga0496114_0813318 3300048917 Bacteria 814
419 Ga0496115_0118474 3300048918 Bacteria 2178
420 Ga0496116_0030685 3300048919 Bacteria 3858
421 Ga0496117_0000012 3300048920 Bacteria 608530
422 Ga0496118_0000051 3300048921 Bacteria 241198
423 Ga0496119_0006880 3300048922 Bacteria 10380
424 Ga0496119_0012331 3300048922 Bacteria 6953
425 Ga0496119_0132578 3300048922 Bacteria 1356
426 Ga0496119_0358263 3300048922 Bacteria 705
427 Ga0496120_0000191 3300048923 Bacteria 105146
428 Ga0496120_0042642 3300048923 Bacteria 2648
429 Ga0496120_0143696 3300048923 Bacteria 1208
430 Ga0496121_0005908 3300048924 Bacteria 15490
431 Ga0496121_0041860 3300048924 Bacteria 3995
432 Ga0496124_0036416 3300048927 Bacteria 4292
433 Ga0496125_0000194 3300048928 Bacteria 130058
434 Ga0496125_0052368 3300048928 Bacteria 3357
435 Ga0496125_0087671 3300048928 Bacteria 2349
436 Ga0496126_0027693 3300048929 Bacteria 5408
437 Ga0496126_0037305 3300048929 Bacteria 4537
438 Ga0495682_0339170 3300049460 Bacteria 530
439 Ga0501031_0464102 3300049568 Bacteria 818
440 Ga0501032_0804314 3300049569 Bacteria 594
441 Ga0501036_0773547 3300049572 Bacteria 791
442 Ga0501037_0313684 3300049573 Bacteria 1087
443 Ga0501038_0407437 3300049574 Bacteria 1051
444 Ga0501042_0075393 3300049578 Bacteria 2414
445 Ga0501042_0248205 3300049578 Bacteria 1284
446 Ga0501042_0433395 3300049578 Bacteria 953
447 Ga0501042_0783209 3300049578 Bacteria 694
448 Ga0501048_0542745 3300049582 Bacteria 834
449 Ga0501067_0441714 3300049583 Bacteria 726
450 Ga0501069_0097357 3300049585 Bacteria 1668
451 Ga0501070_0400605 3300049586 Bacteria 1110
452 Ga0501070_0422874 3300049586 Bacteria 1076
453 Ga0501071_0295115 3300049587 Bacteria 1228
454 Ga0501075_0560673 3300049591 Bacteria 872
455 Ga0501076_0115511 3300049592 Bacteria 2172
456 Ga0501077_0729894 3300049593 Bacteria 637
457 Ga0501235_046182 3300049669 Bacteria 1003
458 Ga0501045_0851367 3300049824 Bacteria 671
459 nmdc:mga0k408_631566_c1 3300050493 Bacteria 630
460 Ga0500651_0539729 3300053093 Bacteria 639
461 Ga0500648_212750 3300053097 Bacteria 957
462 Ga0500614_021833 3300053123 Bacteria 1489
463 Ga0500652_040330 3300053131 Bacteria 1876
464 Ga0500568_0048560 3300053139 Bacteria 1677
465 Ga0500568_0133670 3300053139 Bacteria 921
466 Ga0500616_0065902 3300053153 Bacteria 1861
467 Ga0500611_063008 3300053727 Bacteria 884
468 Ga0530510_0535689 3300061734 Bacteria 889

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10060200 rootH1_100602004 112
2 3300041486 Ga0451807_0207366 Ga0451807_0207366_10_378 116
3 3300005344 Ga0070661_101194389 Ga0070661_1011943892 117
4 3300046648 Ga0495611_0124715 Ga0495611_0124715_236_655 119
5 3300005364 Ga0070673_100062077 Ga0070673_1000620772 125
6 3300025960 Ga0207651_10041215 Ga0207651_100412154 125
7 3300005340 Ga0070689_101659683 Ga0070689_1016596831 126
8 3300046694 Ga0495649_0010536 Ga0495649_0010536_3999_4421 126
9 3300025944 Ga0207661_11751383 Ga0207661_117513831 128
10 3300041459 Ga0451800_0834743 Ga0451800_0834743_55_474 129
11 3300005564 Ga0070664_100882389 Ga0070664_1008823892 131
12 3300009093 Ga0105240_10213674 Ga0105240_102136742 131
13 3300009098 Ga0105245_10233900 Ga0105245_102339004 131
14 3300009551 Ga0105238_11041387 Ga0105238_110413872 131
15 3300014326 Ga0157380_10195561 Ga0157380_101955612 131
16 3300046461 Ga0495641_0148959 Ga0495641_0148959_292_696 131
17 3300005367 Ga0070667_100254339 Ga0070667_1002543391 132
18 3300005843 Ga0068860_100352211 Ga0068860_1003522113 132
19 3300009093 Ga0105240_10274654 Ga0105240_102746541 132
20 3300025913 Ga0207695_10195390 Ga0207695_101953901 132
21 3300025986 Ga0207658_11048415 Ga0207658_110484152 132
22 3300028381 Ga0268264_10369823 Ga0268264_103698231 132
23 3300032002 Ga0307416_100358275 Ga0307416_1003582753 132
24 3300045051 Ga0451576_0486654 Ga0451576_0486654_211_612 132
25 3300046519 Ga0495632_0300502 Ga0495632_0300502_126_533 132
26 3300046648 Ga0495611_0475184 Ga0495611_0475184_38_469 132
27 3300053131 Ga0500652_040330 Ga0500652_040330_360_767 132
28 3300053139 Ga0500568_0048560 Ga0500568_0048560_187_594 132
29 3300053139 Ga0500568_0133670 Ga0500568_0133670_95_502 132
30 3300003316 rootH1_10079342 rootH1_100793426 133
31 3300003320 rootH2_10072707 rootH2_100727074 133
32 3300003322 rootL2_10103198 rootL2_101031982 133
33 3300005289 Ga0065704_10070579 Ga0065704_1007057920 133
34 3300005327 Ga0070658_11386024 Ga0070658_113860241 133
35 3300005329 Ga0070683_100097009 Ga0070683_1000970092 133
36 3300005331 Ga0070670_100099168 Ga0070670_1000991682 133
37 3300005331 Ga0070670_101002119 Ga0070670_1010021191 133
38 3300005333 Ga0070677_10014380 Ga0070677_100143804 133
39 3300005333 Ga0070677_10043033 Ga0070677_100430331 133
40 3300005334 Ga0068869_100051988 Ga0068869_1000519882 133
41 3300005334 Ga0068869_101586984 Ga0068869_1015869841 133
42 3300005335 Ga0070666_10174984 Ga0070666_101749842 133
43 3300005337 Ga0070682_100610287 Ga0070682_1006102871 133
44 3300005338 Ga0068868_101569183 Ga0068868_1015691831 133
45 3300005340 Ga0070689_100018416 Ga0070689_1000184165 133
46 3300005340 Ga0070689_100128853 Ga0070689_1001288532 133
47 3300005340 Ga0070689_100131781 Ga0070689_1001317812 133
48 3300005340 Ga0070689_102112695 Ga0070689_1021126951 133
49 3300005343 Ga0070687_100350295 Ga0070687_1003502952 133
50 3300005353 Ga0070669_100167736 Ga0070669_1001677363 133
51 3300005353 Ga0070669_101085638 Ga0070669_1010856381 133
52 3300005353 Ga0070669_101999813 Ga0070669_1019998131 133
53 3300005354 Ga0070675_100027247 Ga0070675_1000272474 133
54 3300005354 Ga0070675_100042743 Ga0070675_1000427435 133
55 3300005354 Ga0070675_100208868 Ga0070675_1002088682 133
56 3300005354 Ga0070675_101528128 Ga0070675_1015281281 133
57 3300005355 Ga0070671_100000478 Ga0070671_10000047821 133
58 3300005355 Ga0070671_100266886 Ga0070671_1002668862 133
59 3300005355 Ga0070671_100315953 Ga0070671_1003159531 133
60 3300005355 Ga0070671_100576159 Ga0070671_1005761592 133
61 3300005356 Ga0070674_100089354 Ga0070674_1000893541 133
62 3300005356 Ga0070674_100141086 Ga0070674_1001410863 133
63 3300005356 Ga0070674_100257621 Ga0070674_1002576213 133
64 3300005364 Ga0070673_100060412 Ga0070673_1000604121 133
65 3300005365 Ga0070688_100254953 Ga0070688_1002549533 133
66 3300005365 Ga0070688_100979605 Ga0070688_1009796051 133
67 3300005367 Ga0070667_100019855 Ga0070667_1000198556 133
68 3300005367 Ga0070667_100020397 Ga0070667_1000203972 133
69 3300005406 Ga0070703_10029691 Ga0070703_100296913 133
70 3300005438 Ga0070701_10193986 Ga0070701_101939861 133
71 3300005438 Ga0070701_10229279 Ga0070701_102292791 133
72 3300005438 Ga0070701_10656939 Ga0070701_106569391 133
73 3300005440 Ga0070705_100200144 Ga0070705_1002001442 133
74 3300005440 Ga0070705_100804579 Ga0070705_1008045791 133
75 3300005441 Ga0070700_100056751 Ga0070700_1000567512 133
76 3300005441 Ga0070700_100090622 Ga0070700_1000906223 133
77 3300005441 Ga0070700_100147371 Ga0070700_1001473711 133
78 3300005441 Ga0070700_100217456 Ga0070700_1002174561 133
79 3300005444 Ga0070694_100018203 Ga0070694_1000182033 133
80 3300005455 Ga0070663_100623263 Ga0070663_1006232632 133
81 3300005455 Ga0070663_101684960 Ga0070663_1016849602 133
82 3300005456 Ga0070678_100024624 Ga0070678_1000246244 133
83 3300005456 Ga0070678_100050138 Ga0070678_1000501383 133
84 3300005456 Ga0070678_100533090 Ga0070678_1005330902 133
85 3300005456 Ga0070678_101253859 Ga0070678_1012538591 133
86 3300005458 Ga0070681_10277352 Ga0070681_102773521 133
87 3300005458 Ga0070681_10706782 Ga0070681_107067822 133
88 3300005459 Ga0068867_100031083 Ga0068867_1000310834 133
89 3300005459 Ga0068867_100060114 Ga0068867_1000601143 133
90 3300005459 Ga0068867_101940060 Ga0068867_1019400601 133
91 3300005466 Ga0070685_11023442 Ga0070685_110234422 133
92 3300005466 Ga0070685_11366690 Ga0070685_113666901 133
93 3300005530 Ga0070679_100182767 Ga0070679_1001827673 133
94 3300005535 Ga0070684_100677646 Ga0070684_1006776462 133
95 3300005536 Ga0070697_101700730 Ga0070697_1017007301 133
96 3300005543 Ga0070672_100032604 Ga0070672_1000326045 133
97 3300005543 Ga0070672_100133643 Ga0070672_1001336432 133
98 3300005543 Ga0070672_100465110 Ga0070672_1004651101 133
99 3300005543 Ga0070672_100769976 Ga0070672_1007699762 133
100 3300005543 Ga0070672_101970075 Ga0070672_1019700751 133
101 3300005544 Ga0070686_100040261 Ga0070686_1000402612 133
102 3300005544 Ga0070686_100108473 Ga0070686_1001084732 133
103 3300005544 Ga0070686_100965447 Ga0070686_1009654471 133
104 3300005546 Ga0070696_100792778 Ga0070696_1007927781 133
105 3300005547 Ga0070693_100407181 Ga0070693_1004071812 133
106 3300005547 Ga0070693_101508067 Ga0070693_1015080672 133
107 3300005548 Ga0070665_100014405 Ga0070665_1000144059 133
108 3300005548 Ga0070665_100061429 Ga0070665_1000614295 133
109 3300005548 Ga0070665_100078759 Ga0070665_1000787591 133
110 3300005548 Ga0070665_100131417 Ga0070665_1001314174 133
111 3300005548 Ga0070665_101265945 Ga0070665_1012659451 133
112 3300005548 Ga0070665_101335909 Ga0070665_1013359092 133
113 3300005563 Ga0068855_100060286 Ga0068855_1000602866 133
114 3300005564 Ga0070664_100056479 Ga0070664_1000564792 133
115 3300005564 Ga0070664_100847576 Ga0070664_1008475762 133
116 3300005577 Ga0068857_100312890 Ga0068857_1003128902 133
117 3300005578 Ga0068854_100132763 Ga0068854_1001327632 133
118 3300005614 Ga0068856_100297086 Ga0068856_1002970863 133
119 3300005614 Ga0068856_100326526 Ga0068856_1003265263 133
120 3300005615 Ga0070702_100069796 Ga0070702_1000697964 133
121 3300005615 Ga0070702_100076676 Ga0070702_1000766762 133
122 3300005616 Ga0068852_100381544 Ga0068852_1003815441 133
123 3300005617 Ga0068859_100001791 Ga0068859_1000017912 133
124 3300005617 Ga0068859_100046101 Ga0068859_1000461015 133
125 3300005617 Ga0068859_100440066 Ga0068859_1004400662 133
126 3300005617 Ga0068859_100472257 Ga0068859_1004722571 133
127 3300005618 Ga0068864_100031015 Ga0068864_1000310154 133
128 3300005618 Ga0068864_100126053 Ga0068864_1001260532 133
129 3300005618 Ga0068864_100404546 Ga0068864_1004045462 133
130 3300005618 Ga0068864_101288573 Ga0068864_1012885731 133
131 3300005718 Ga0068866_10260772 Ga0068866_102607722 133
132 3300005719 Ga0068861_100003252 Ga0068861_10000325211 133
133 3300005719 Ga0068861_100105064 Ga0068861_1001050643 133
134 3300005719 Ga0068861_100139153 Ga0068861_1001391531 133
135 3300005719 Ga0068861_100147995 Ga0068861_1001479951 133
136 3300005719 Ga0068861_100310018 Ga0068861_1003100182 133
137 3300005719 Ga0068861_101190127 Ga0068861_1011901271 133
138 3300005834 Ga0068851_10322692 Ga0068851_103226922 133
139 3300005840 Ga0068870_10012248 Ga0068870_100122484 133
140 3300005840 Ga0068870_10025237 Ga0068870_100252374 133
141 3300005840 Ga0068870_10103000 Ga0068870_101030002 133
142 3300005841 Ga0068863_100050921 Ga0068863_1000509217 133
143 3300005841 Ga0068863_100693980 Ga0068863_1006939802 133
144 3300005842 Ga0068858_100003886 Ga0068858_1000038864 133
145 3300005842 Ga0068858_100027224 Ga0068858_1000272246 133
146 3300005843 Ga0068860_100000336 Ga0068860_10000033656 133
147 3300005843 Ga0068860_100010835 Ga0068860_1000108355 133
148 3300005843 Ga0068860_100820574 Ga0068860_1008205742 133
149 3300005843 Ga0068860_100884719 Ga0068860_1008847191 133
150 3300005844 Ga0068862_100057484 Ga0068862_1000574843 133
151 3300005844 Ga0068862_100058883 Ga0068862_1000588833 133
152 3300005844 Ga0068862_100118869 Ga0068862_1001188693 133
153 3300005844 Ga0068862_100427875 Ga0068862_1004278752 133
154 3300005844 Ga0068862_100501887 Ga0068862_1005018872 133
155 3300006195 Ga0075366_10553688 Ga0075366_105536882 133
156 3300006237 Ga0097621_100021188 Ga0097621_1000211884 133
157 3300006237 Ga0097621_100148846 Ga0097621_1001488462 133
158 3300006237 Ga0097621_100157887 Ga0097621_1001578873 133
159 3300006237 Ga0097621_100238022 Ga0097621_1002380222 133
160 3300006358 Ga0068871_100059944 Ga0068871_1000599442 133
161 3300006358 Ga0068871_100212045 Ga0068871_1002120452 133
162 3300006844 Ga0075428_100317233 Ga0075428_1003172332 133
163 3300006846 Ga0075430_100457887 Ga0075430_1004578872 133
164 3300006846 Ga0075430_100701481 Ga0075430_1007014811 133
165 3300006881 Ga0068865_100230813 Ga0068865_1002308132 133
166 3300006881 Ga0068865_100542354 Ga0068865_1005423542 133
167 3300006931 Ga0097620_100001791 Ga0097620_1000017912 133
168 3300006931 Ga0097620_100046100 Ga0097620_1000461002 133
169 3300006931 Ga0097620_100440104 Ga0097620_1004401042 133
170 3300006931 Ga0097620_100472179 Ga0097620_1004721791 133
171 3300009092 Ga0105250_10173706 Ga0105250_101737062 133
172 3300009093 Ga0105240_10049280 Ga0105240_100492807 133
173 3300009093 Ga0105240_12103353 Ga0105240_121033531 133
174 3300009094 Ga0111539_11838937 Ga0111539_118389371 133
175 3300009101 Ga0105247_10001745 Ga0105247_1000174517 133
176 3300009101 Ga0105247_10101356 Ga0105247_101013561 133
177 3300009148 Ga0105243_12052105 Ga0105243_120521051 133
178 3300009176 Ga0105242_10874318 Ga0105242_108743181 133
179 3300009177 Ga0105248_10037409 Ga0105248_100374094 133
180 3300009177 Ga0105248_10103908 Ga0105248_101039082 133
181 3300009177 Ga0105248_13069205 Ga0105248_130692051 133
182 3300009545 Ga0105237_10029300 Ga0105237_100293005 133
183 3300009545 Ga0105237_10218150 Ga0105237_102181501 133
184 3300009545 Ga0105237_11189947 Ga0105237_111899471 133
185 3300009551 Ga0105238_10107761 Ga0105238_101077614 133
186 3300009551 Ga0105238_10506563 Ga0105238_105065632 133
187 3300009551 Ga0105238_10834747 Ga0105238_108347471 133
188 3300009551 Ga0105238_10850140 Ga0105238_108501402 133
189 3300009551 Ga0105238_11238177 Ga0105238_112381771 133
190 3300009553 Ga0105249_10012823 Ga0105249_100128233 133
191 3300009553 Ga0105249_10200265 Ga0105249_102002652 133
192 3300009553 Ga0105249_11666351 Ga0105249_116663512 133
193 3300009553 Ga0105249_12152032 Ga0105249_121520321 133
194 3300010375 Ga0105239_10382320 Ga0105239_103823202 133
195 3300011119 Ga0105246_10146527 Ga0105246_101465272 133
196 3300013105 Ga0157369_11029334 Ga0157369_110293341 133
197 3300013296 Ga0157374_10061637 Ga0157374_100616372 133
198 3300013296 Ga0157374_10338149 Ga0157374_103381492 133
199 3300013306 Ga0163162_10125783 Ga0163162_101257834 133
200 3300013307 Ga0157372_10208691 Ga0157372_102086912 133
201 3300013308 Ga0157375_10748480 Ga0157375_107484801 133
202 3300013308 Ga0157375_13671108 Ga0157375_136711081 133
203 3300014325 Ga0163163_10022613 Ga0163163_100226132 133
204 3300014325 Ga0163163_10193961 Ga0163163_101939613 133
205 3300014325 Ga0163163_10212999 Ga0163163_102129994 133
206 3300014325 Ga0163163_10407930 Ga0163163_104079302 133
207 3300014325 Ga0163163_10943550 Ga0163163_109435502 133
208 3300014325 Ga0163163_11951237 Ga0163163_119512371 133
209 3300014326 Ga0157380_10018508 Ga0157380_100185087 133
210 3300014326 Ga0157380_10204219 Ga0157380_102042192 133
211 3300014326 Ga0157380_10226698 Ga0157380_102266982 133
212 3300014326 Ga0157380_10626832 Ga0157380_106268321 133
213 3300014968 Ga0157379_10017478 Ga0157379_100174782 133
214 3300014968 Ga0157379_10040520 Ga0157379_100405206 133
215 3300014968 Ga0157379_10062770 Ga0157379_100627703 133
216 3300014969 Ga0157376_11547504 Ga0157376_115475041 133
217 3300017792 Ga0163161_10654489 Ga0163161_106544892 133
218 3300021377 Ga0213874_10270047 Ga0213874_102700472 133
219 3300021384 Ga0213876_10028478 Ga0213876_100284782 133
220 3300025321 Ga0207656_10110196 Ga0207656_101101961 133
221 3300025893 Ga0207682_10007692 Ga0207682_100076924 133
222 3300025893 Ga0207682_10025199 Ga0207682_100251993 133
223 3300025893 Ga0207682_10160259 Ga0207682_101602592 133
224 3300025899 Ga0207642_10487506 Ga0207642_104875062 133
225 3300025900 Ga0207710_10000578 Ga0207710_1000057819 133
226 3300025901 Ga0207688_10105323 Ga0207688_101053232 133
227 3300025903 Ga0207680_10009119 Ga0207680_100091192 133
228 3300025904 Ga0207647_10041293 Ga0207647_100412931 133
229 3300025907 Ga0207645_10284034 Ga0207645_102840342 133
230 3300025908 Ga0207643_10035998 Ga0207643_100359981 133
231 3300025908 Ga0207643_10122658 Ga0207643_101226581 133
232 3300025908 Ga0207643_10216881 Ga0207643_102168812 133
233 3300025911 Ga0207654_10458661 Ga0207654_104586612 133
234 3300025912 Ga0207707_10079897 Ga0207707_100798974 133
235 3300025913 Ga0207695_10501638 Ga0207695_105016382 133
236 3300025914 Ga0207671_10028270 Ga0207671_100282703 133
237 3300025914 Ga0207671_11557139 Ga0207671_115571391 133
238 3300025918 Ga0207662_10163797 Ga0207662_101637972 133
239 3300025921 Ga0207652_10307181 Ga0207652_103071812 133
240 3300025923 Ga0207681_10281340 Ga0207681_102813401 133
241 3300025924 Ga0207694_10067915 Ga0207694_100679154 133
242 3300025924 Ga0207694_10135413 Ga0207694_101354134 133
243 3300025925 Ga0207650_11898314 Ga0207650_118983141 133
244 3300025926 Ga0207659_10088467 Ga0207659_100884672 133
245 3300025926 Ga0207659_10184371 Ga0207659_101843711 133
246 3300025929 Ga0207664_11751954 Ga0207664_117519541 133
247 3300025931 Ga0207644_10001813 Ga0207644_1000181313 133
248 3300025931 Ga0207644_10456759 Ga0207644_104567591 133
249 3300025932 Ga0207690_10950352 Ga0207690_109503521 133
250 3300025933 Ga0207706_10079427 Ga0207706_100794272 133
251 3300025933 Ga0207706_10291294 Ga0207706_102912942 133
252 3300025933 Ga0207706_10610264 Ga0207706_106102642 133
253 3300025935 Ga0207709_10453547 Ga0207709_104535471 133
254 3300025936 Ga0207670_10002422 Ga0207670_100024229 133
255 3300025936 Ga0207670_10700048 Ga0207670_107000481 133
256 3300025936 Ga0207670_10754435 Ga0207670_107544351 133
257 3300025936 Ga0207670_10862298 Ga0207670_108622981 133
258 3300025937 Ga0207669_10170999 Ga0207669_101709992 133
259 3300025937 Ga0207669_10397597 Ga0207669_103975972 133
260 3300025938 Ga0207704_10199674 Ga0207704_101996741 133
261 3300025938 Ga0207704_10243754 Ga0207704_102437543 133
262 3300025938 Ga0207704_10329544 Ga0207704_103295441 133
263 3300025938 Ga0207704_10946315 Ga0207704_109463152 133
264 3300025940 Ga0207691_10023894 Ga0207691_100238945 133
265 3300025940 Ga0207691_10049968 Ga0207691_100499682 133
266 3300025940 Ga0207691_10111380 Ga0207691_101113804 133
267 3300025940 Ga0207691_10990664 Ga0207691_109906641 133
268 3300025941 Ga0207711_10195974 Ga0207711_101959743 133
269 3300025941 Ga0207711_10269758 Ga0207711_102697583 133
270 3300025942 Ga0207689_10236092 Ga0207689_102360922 133
271 3300025944 Ga0207661_10238299 Ga0207661_102382993 133
272 3300025944 Ga0207661_10439789 Ga0207661_104397892 133
273 3300025945 Ga0207679_10203307 Ga0207679_102033072 133
274 3300025945 Ga0207679_10277744 Ga0207679_102777442 133
275 3300025949 Ga0207667_10262287 Ga0207667_102622872 133
276 3300025960 Ga0207651_10898500 Ga0207651_108985001 133
277 3300025960 Ga0207651_11603733 Ga0207651_116037332 133
278 3300025961 Ga0207712_10257478 Ga0207712_102574783 133
279 3300025961 Ga0207712_11580397 Ga0207712_115803972 133
280 3300025972 Ga0207668_10264320 Ga0207668_102643203 133
281 3300025972 Ga0207668_11671880 Ga0207668_116718801 133
282 3300025981 Ga0207640_10186700 Ga0207640_101867001 133
283 3300025981 Ga0207640_10382280 Ga0207640_103822802 133
284 3300025986 Ga0207658_10023125 Ga0207658_100231252 133
285 3300025986 Ga0207658_10358107 Ga0207658_103581072 133
286 3300025986 Ga0207658_10465798 Ga0207658_104657982 133
287 3300026035 Ga0207703_10001055 Ga0207703_1000105519 133
288 3300026035 Ga0207703_10007856 Ga0207703_100078564 133
289 3300026035 Ga0207703_10951342 Ga0207703_109513422 133
290 3300026067 Ga0207678_10006319 Ga0207678_100063192 133
291 3300026067 Ga0207678_10073378 Ga0207678_100733784 133
292 3300026067 Ga0207678_10162453 Ga0207678_101624533 133
293 3300026067 Ga0207678_11371273 Ga0207678_113712731 133
294 3300026075 Ga0207708_10052890 Ga0207708_100528902 133
295 3300026075 Ga0207708_10243722 Ga0207708_102437222 133
296 3300026075 Ga0207708_10289676 Ga0207708_102896761 133
297 3300026078 Ga0207702_10907245 Ga0207702_109072452 133
298 3300026088 Ga0207641_10000788 Ga0207641_1000078811 133
299 3300026088 Ga0207641_10038112 Ga0207641_100381124 133
300 3300026088 Ga0207641_10576404 Ga0207641_105764042 133
301 3300026089 Ga0207648_10024885 Ga0207648_100248854 133
302 3300026089 Ga0207648_10083899 Ga0207648_100838993 133
303 3300026089 Ga0207648_10906049 Ga0207648_109060491 133
304 3300026089 Ga0207648_10932439 Ga0207648_109324392 133
305 3300026095 Ga0207676_10259126 Ga0207676_102591263 133
306 3300026116 Ga0207674_10090324 Ga0207674_100903242 133
307 3300026116 Ga0207674_10132140 Ga0207674_101321401 133
308 3300026118 Ga0207675_100005952 Ga0207675_10000595211 133
309 3300026118 Ga0207675_100009707 Ga0207675_1000097078 133
310 3300026118 Ga0207675_100065887 Ga0207675_1000658873 133
311 3300026118 Ga0207675_100116858 Ga0207675_1001168582 133
312 3300026118 Ga0207675_100160397 Ga0207675_1001603973 133
313 3300026118 Ga0207675_100187219 Ga0207675_1001872193 133
314 3300026118 Ga0207675_100302040 Ga0207675_1003020403 133
315 3300026118 Ga0207675_101030834 Ga0207675_1010308342 133
316 3300026118 Ga0207675_101065548 Ga0207675_1010655482 133
317 3300026121 Ga0207683_10007590 Ga0207683_100075906 133
318 3300026121 Ga0207683_10056803 Ga0207683_100568034 133
319 3300026121 Ga0207683_10852070 Ga0207683_108520701 133
320 3300028379 Ga0268266_10010200 Ga0268266_1001020011 133
321 3300028379 Ga0268266_10028775 Ga0268266_100287754 133
322 3300028379 Ga0268266_10030805 Ga0268266_100308052 133
323 3300028379 Ga0268266_10179363 Ga0268266_101793634 133
324 3300028379 Ga0268266_10351773 Ga0268266_103517733 133
325 3300028379 Ga0268266_10466404 Ga0268266_104664042 133
326 3300028380 Ga0268265_10013311 Ga0268265_100133115 133
327 3300028380 Ga0268265_10079588 Ga0268265_100795885 133
328 3300028380 Ga0268265_10347525 Ga0268265_103475251 133
329 3300028380 Ga0268265_10571352 Ga0268265_105713522 133
330 3300028380 Ga0268265_11190008 Ga0268265_111900081 133
331 3300028380 Ga0268265_11375421 Ga0268265_113754212 133
332 3300028381 Ga0268264_10000034 Ga0268264_10000034244 133
333 3300028381 Ga0268264_10023331 Ga0268264_100233315 133
334 3300028381 Ga0268264_10348702 Ga0268264_103487022 133
335 3300028381 Ga0268264_10599313 Ga0268264_105993132 133
336 3300028794 Ga0307515_10166503 Ga0307515_101665034 133
337 3300030521 Ga0307511_10008918 Ga0307511_1000891815 133
338 3300030521 Ga0307511_10296365 Ga0307511_102963652 133
339 3300030760 Ga0265762_1046843 Ga0265762_10468432 133
340 3300031247 Ga0265340_10117165 Ga0265340_101171652 133
341 3300031456 Ga0307513_10048981 Ga0307513_100489815 133
342 3300031456 Ga0307513_10052120 Ga0307513_100521205 133
343 3300031456 Ga0307513_10057408 Ga0307513_100574085 133
344 3300031456 Ga0307513_10060203 Ga0307513_100602032 133
345 3300031507 Ga0307509_10000106 Ga0307509_1000010638 133
346 3300031507 Ga0307509_10096640 Ga0307509_100966404 133
347 3300031507 Ga0307509_10255531 Ga0307509_102555312 133
348 3300031548 Ga0307408_100184943 Ga0307408_1001849431 133
349 3300031616 Ga0307508_10096552 Ga0307508_100965523 133
350 3300031649 Ga0307514_10123690 Ga0307514_101236901 133
351 3300031731 Ga0307405_10116415 Ga0307405_101164152 133
352 3300031824 Ga0307413_10003137 Ga0307413_100031372 133
353 3300031852 Ga0307410_10099677 Ga0307410_100996773 133
354 3300031903 Ga0307407_10203203 Ga0307407_102032032 133
355 3300031903 Ga0307407_10902506 Ga0307407_109025062 133
356 3300031911 Ga0307412_11100798 Ga0307412_111007981 133
357 3300031911 Ga0307412_11858672 Ga0307412_118586721 133
358 3300031995 Ga0307409_100018163 Ga0307409_1000181635 133
359 3300032002 Ga0307416_100077922 Ga0307416_1000779224 133
360 3300032005 Ga0307411_10290931 Ga0307411_102909313 133
361 3300032005 Ga0307411_11360864 Ga0307411_113608641 133
362 3300032126 Ga0307415_100544996 Ga0307415_1005449961 133
363 3300033180 Ga0307510_10000005 Ga0307510_10000005160 133
364 3300033180 Ga0307510_10004723 Ga0307510_1000472310 133
365 3300035113 Ga0373936_0013220 Ga0373936_0013220_1909_2310 133
366 3300035113 Ga0373936_0019073 Ga0373936_0019073_1976_2377 133
367 3300035241 Ga0373961_0411844 Ga0373961_0411844_21_434 133
368 3300036401 Ga0373937_0616311 Ga0373937_0616311_368_805 133
369 3300037853 Ga0436364_0005604 Ga0436364_0005604_796_1197 133
370 3300039437 Ga0436365_0371612 Ga0436365_0371612_383_784 133
371 3300039437 Ga0436365_1280088 Ga0436365_1280088_3984_4385 133
372 3300039450 Ga0436363_0794491 Ga0436363_0794491_154_555 133
373 3300041443 Ga0451789_1144774 Ga0451789_1144774_147_563 133
374 3300041451 Ga0451791_0084078 Ga0451791_0084078_727_1137 133
375 3300041451 Ga0451791_1825438 Ga0451791_1825438_237_656 133
376 3300041452 Ga0451793_1110932 Ga0451793_1110932_110_535 133
377 3300041452 Ga0451793_1112111 Ga0451793_1112111_37_447 133
378 3300041453 Ga0451797_1100325 Ga0451797_1100325_484_909 133
379 3300041453 Ga0451797_1381115 Ga0451797_1381115_378_788 133
380 3300041460 Ga0451802_1142996 Ga0451802_1142996_165_575 133
381 3300041463 Ga0451804_0423055 Ga0451804_0423055_88_513 133
382 3300041486 Ga0451807_0246237 Ga0451807_0246237_404_814 133
383 3300041509 Ga0451843_1454857 Ga0451843_1454857_49_465 133
384 3300042125 Ga0450923_074767 Ga0450923_074767_214_642 133
385 3300042134 Ga0450898_031046 Ga0450898_031046_34_447 133
386 3300042157 Ga0439458_0032185 Ga0439458_0032185_10_423 133
387 3300042530 Ga0450916_023314 Ga0450916_023314_34_447 133
388 3300042876 Ga0451577_0434055 Ga0451577_0434055_771_1175 133
389 3300042876 Ga0451577_1509221 Ga0451577_1509221_77_481 133
390 3300045051 Ga0451576_0477997 Ga0451576_0477997_822_1226 133
391 3300046452 Ga0495617_037003 Ga0495617_037003_1017_1430 133
392 3300046457 Ga0495590_0001726 Ga0495590_0001726_7768_8181 133
393 3300046460 Ga0495638_0016204 Ga0495638_0016204_124_534 133
394 3300046460 Ga0495638_0412014 Ga0495638_0412014_107_526 133
395 3300046461 Ga0495641_0108590 Ga0495641_0108590_55_492 133
396 3300046491 Ga0495584_0507684 Ga0495584_0507684_157_558 133
397 3300046507 Ga0495606_0055714 Ga0495606_0055714_1388_1789 133
398 3300046507 Ga0495606_0114064 Ga0495606_0114064_289_690 133
399 3300046512 Ga0495610_0295096 Ga0495610_0295096_110_523 133
400 3300046513 Ga0495616_0000636 Ga0495616_0000636_10194_10604 133
401 3300046513 Ga0495616_0100959 Ga0495616_0100959_640_1050 133
402 3300046516 Ga0495628_1034665 Ga0495628_1034665_55_456 133
403 3300046519 Ga0495632_0034307 Ga0495632_0034307_688_1101 133
404 3300046519 Ga0495632_0288154 Ga0495632_0288154_56_466 133
405 3300046538 Ga0495609_0260084 Ga0495609_0260084_186_587 133
406 3300046616 Ga0495668_0172404 Ga0495668_0172404_430_843 133
407 3300046660 Ga0495625_0015857 Ga0495625_0015857_2718_3140 133
408 3300046660 Ga0495625_0092992 Ga0495625_0092992_631_1044 133
409 3300046694 Ga0495649_0030403 Ga0495649_0030403_1639_2040 133
410 3300046694 Ga0495649_0121371 Ga0495649_0121371_801_1214 133
411 3300046794 Ga0495589_0546999 Ga0495589_0546999_62_472 133
412 3300047472 Ga0495686_0075849 Ga0495686_0075849_1488_1898 133
413 3300048091 Ga0495626_0108232 Ga0495626_0108232_751_1164 133
414 3300048905 Ga0496102_0074653 Ga0496102_0074653_1470_1871 133
415 3300048905 Ga0496102_1312547 Ga0496102_1312547_147_548 133
416 3300048906 Ga0496103_0169937 Ga0496103_0169937_162_563 133
417 3300048907 Ga0496104_1618736 Ga0496104_1618736_43_444 133
418 3300048909 Ga0496106_0096407 Ga0496106_0096407_1179_1580 133
419 3300048910 Ga0496107_0688695 Ga0496107_0688695_145_546 133
420 3300048911 Ga0496108_0631939 Ga0496108_0631939_161_562 133
421 3300048917 Ga0496114_0813318 Ga0496114_0813318_209_610 133
422 3300048918 Ga0496115_0118474 Ga0496115_0118474_314_715 133
423 3300048919 Ga0496116_0030685 Ga0496116_0030685_1466_1867 133
424 3300048920 Ga0496117_0000012 Ga0496117_0000012_409272_409673 133
425 3300048921 Ga0496118_0000051 Ga0496118_0000051_40388_40789 133
426 3300048922 Ga0496119_0006880 Ga0496119_0006880_6012_6413 133
427 3300048922 Ga0496119_0012331 Ga0496119_0012331_4997_5398 133
428 3300048922 Ga0496119_0132578 Ga0496119_0132578_506_907 133
429 3300048922 Ga0496119_0358263 Ga0496119_0358263_205_606 133
430 3300048923 Ga0496120_0000191 Ga0496120_0000191_80253_80654 133
431 3300048923 Ga0496120_0042642 Ga0496120_0042642_77_478 133
432 3300048923 Ga0496120_0143696 Ga0496120_0143696_338_739 133
433 3300048924 Ga0496121_0005908 Ga0496121_0005908_14746_15147 133
434 3300048924 Ga0496121_0041860 Ga0496121_0041860_3257_3658 133
435 3300048927 Ga0496124_0036416 Ga0496124_0036416_11_412 133
436 3300048928 Ga0496125_0000194 Ga0496125_0000194_106944_107345 133
437 3300048928 Ga0496125_0052368 Ga0496125_0052368_50_451 133
438 3300048928 Ga0496125_0087671 Ga0496125_0087671_77_478 133
439 3300048929 Ga0496126_0027693 Ga0496126_0027693_1553_1954 133
440 3300048929 Ga0496126_0037305 Ga0496126_0037305_3791_4192 133
441 3300049460 Ga0495682_0339170 Ga0495682_0339170_93_506 133
442 3300049568 Ga0501031_0464102 Ga0501031_0464102_154_567 133
443 3300049569 Ga0501032_0804314 Ga0501032_0804314_164_577 133
444 3300049572 Ga0501036_0773547 Ga0501036_0773547_344_757 133
445 3300049573 Ga0501037_0313684 Ga0501037_0313684_203_616 133
446 3300049574 Ga0501038_0407437 Ga0501038_0407437_510_932 133
447 3300049578 Ga0501042_0075393 Ga0501042_0075393_1822_2235 133
448 3300049578 Ga0501042_0248205 Ga0501042_0248205_349_762 133
449 3300049578 Ga0501042_0433395 Ga0501042_0433395_434_847 133
450 3300049578 Ga0501042_0783209 Ga0501042_0783209_198_620 133
451 3300049582 Ga0501048_0542745 Ga0501048_0542745_89_502 133
452 3300049583 Ga0501067_0441714 Ga0501067_0441714_166_585 133
453 3300049585 Ga0501069_0097357 Ga0501069_0097357_312_725 133
454 3300049586 Ga0501070_0400605 Ga0501070_0400605_338_751 133
455 3300049586 Ga0501070_0422874 Ga0501070_0422874_403_816 133
456 3300049587 Ga0501071_0295115 Ga0501071_0295115_342_755 133
457 3300049591 Ga0501075_0560673 Ga0501075_0560673_204_617 133
458 3300049592 Ga0501076_0115511 Ga0501076_0115511_1451_1864 133
459 3300049593 Ga0501077_0729894 Ga0501077_0729894_55_468 133
460 3300049669 Ga0501235_046182 Ga0501235_046182_385_792 133
461 3300049824 Ga0501045_0851367 Ga0501045_0851367_195_608 133
462 3300050493 nmdc:mga0k408_631566_c1 nmdc:mga0k408_631566_c1_85_498 133
463 3300053093 Ga0500651_0539729 Ga0500651_0539729_161_571 133
464 3300053097 Ga0500648_212750 Ga0500648_212750_79_480 133
465 3300053123 Ga0500614_021833 Ga0500614_021833_1038_1439 133
466 3300053153 Ga0500616_0065902 Ga0500616_0065902_547_963 133
467 3300053727 Ga0500611_063008 Ga0500611_063008_275_685 133
468 3300061734 Ga0530510_0535689 Ga0530510_0535689_251_664 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00460

Flg_bb_rod

Flagella basal body rod protein

12

39

0.92

Feature Viewer

pLDDT pTM Quality
60.01 0.2 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map