F449993
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 468 | 242 | 468 | 135 |
Family's Representative Sequence
| Representative Sequence | 3300005543|Ga0070672_100465110|Ga0070672_1004651101 |
| Length | 149 |
| Sequence | VSTSLDAYLGMHPAALRLREQRTELLARNLANADTPGYKAQDMDFRAALAAVSSSTGAPGTLQATRSGHFGVQGETGQGSVNQGAEAVLSGSTESFLRYRTPLAPSLDGNTVDAQLEQAAFADNAVRYQATLSFLSSKFRSLMTAITGQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 90 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 91 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 143 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 144 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 146 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 147 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 148 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 149 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 150 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 151 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 153 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 154 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 155 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 159 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 160 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 161 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 162 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 163 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 165 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 166 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 167 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 168 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 169 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 170 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 171 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 173 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 174 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 176 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 177 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 178 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 179 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 180 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 181 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 182 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 201 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 202 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 203 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 204 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 205 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 207 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 208 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 209 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 210 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 211 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 212 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 213 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 214 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 215 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 216 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 217 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 233 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 235 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 236 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 237 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 238 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 239 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 240 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 241 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 242 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.79 |
| Metatranscriptomes | 0.21 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.14 |
| Nodule | 0 |
| Rhizoplane | 4.49 |
| Rhizosphere | 84.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10079342 | 3300003316 | Bacteria | 6234 |
| 2 | rootH2_10072707 | 3300003320 | Bacteria | 4980 |
| 3 | rootL2_10103198 | 3300003322 | Bacteria | 1597 |
| 4 | rootH1_10060200 | 3300003323 | Bacteria | 3659 |
| 5 | Ga0065704_10070579 | 3300005289 | Bacteria | 19940 |
| 6 | Ga0070658_11386024 | 3300005327 | Bacteria | 610 |
| 7 | Ga0070683_100097009 | 3300005329 | Bacteria | 2773 |
| 8 | Ga0070670_100099168 | 3300005331 | Bacteria | 2507 |
| 9 | Ga0070670_101002119 | 3300005331 | Unclassified | 760 |
| 10 | Ga0070677_10014380 | 3300005333 | Bacteria | 2784 |
| 11 | Ga0070677_10043033 | 3300005333 | Bacteria | 1791 |
| 12 | Ga0068869_100051988 | 3300005334 | Bacteria | 2974 |
| 13 | Ga0068869_101586984 | 3300005334 | Bacteria | 582 |
| 14 | Ga0070666_10174984 | 3300005335 | Bacteria | 1504 |
| 15 | Ga0070682_100610287 | 3300005337 | Bacteria | 863 |
| 16 | Ga0068868_101569183 | 3300005338 | Bacteria | 618 |
| 17 | Ga0070689_100018416 | 3300005340 | Bacteria | 5144 |
| 18 | Ga0070689_100128853 | 3300005340 | Bacteria | 2027 |
| 19 | Ga0070689_100131781 | 3300005340 | Bacteria | 2005 |
| 20 | Ga0070689_101659683 | 3300005340 | Bacteria | 581 |
| 21 | Ga0070689_102112695 | 3300005340 | Bacteria | 516 |
| 22 | Ga0070687_100350295 | 3300005343 | Unclassified | 953 |
| 23 | Ga0070661_101194389 | 3300005344 | Bacteria | 636 |
| 24 | Ga0070669_100167736 | 3300005353 | Bacteria | 1710 |
| 25 | Ga0070669_101085638 | 3300005353 | Bacteria | 689 |
| 26 | Ga0070669_101999813 | 3300005353 | Unclassified | 506 |
| 27 | Ga0070675_100027247 | 3300005354 | Bacteria | 4590 |
| 28 | Ga0070675_100042743 | 3300005354 | Bacteria | 3703 |
| 29 | Ga0070675_100208868 | 3300005354 | Bacteria | 1696 |
| 30 | Ga0070675_101528128 | 3300005354 | Bacteria | 616 |
| 31 | Ga0070671_100000478 | 3300005355 | Bacteria | 27808 |
| 32 | Ga0070671_100266886 | 3300005355 | Bacteria | 1455 |
| 33 | Ga0070671_100315953 | 3300005355 | Bacteria | 1331 |
| 34 | Ga0070671_100576159 | 3300005355 | Bacteria | 972 |
| 35 | Ga0070674_100089354 | 3300005356 | Bacteria | 2219 |
| 36 | Ga0070674_100141086 | 3300005356 | Bacteria | 1808 |
| 37 | Ga0070674_100257621 | 3300005356 | Bacteria | 1373 |
| 38 | Ga0070673_100060412 | 3300005364 | Bacteria | 3003 |
| 39 | Ga0070673_100062077 | 3300005364 | Bacteria | 2968 |
| 40 | Ga0070688_100254953 | 3300005365 | Bacteria | 1251 |
| 41 | Ga0070688_100979605 | 3300005365 | Bacteria | 671 |
| 42 | Ga0070667_100019855 | 3300005367 | Bacteria | 5576 |
| 43 | Ga0070667_100020397 | 3300005367 | Bacteria | 5502 |
| 44 | Ga0070667_100254339 | 3300005367 | Bacteria | 1571 |
| 45 | Ga0070703_10029691 | 3300005406 | Bacteria | 1643 |
| 46 | Ga0070701_10193986 | 3300005438 | Bacteria | 1197 |
| 47 | Ga0070701_10229279 | 3300005438 | Bacteria | 1112 |
| 48 | Ga0070701_10656939 | 3300005438 | Bacteria | 701 |
| 49 | Ga0070705_100200144 | 3300005440 | Bacteria | 1369 |
| 50 | Ga0070705_100804579 | 3300005440 | Bacteria | 748 |
| 51 | Ga0070700_100056751 | 3300005441 | Bacteria | 2456 |
| 52 | Ga0070700_100090622 | 3300005441 | Bacteria | 1994 |
| 53 | Ga0070700_100147371 | 3300005441 | Bacteria | 1606 |
| 54 | Ga0070700_100217456 | 3300005441 | Bacteria | 1352 |
| 55 | Ga0070694_100018203 | 3300005444 | Bacteria | 4457 |
| 56 | Ga0070663_100623263 | 3300005455 | Bacteria | 909 |
| 57 | Ga0070663_101684960 | 3300005455 | Bacteria | 567 |
| 58 | Ga0070678_100024624 | 3300005456 | Bacteria | 4034 |
| 59 | Ga0070678_100050138 | 3300005456 | Bacteria | 3017 |
| 60 | Ga0070678_100533090 | 3300005456 | Bacteria | 1040 |
| 61 | Ga0070678_101253859 | 3300005456 | Bacteria | 689 |
| 62 | Ga0070681_10277352 | 3300005458 | Unclassified | 1587 |
| 63 | Ga0070681_10706782 | 3300005458 | Bacteria | 924 |
| 64 | Ga0068867_100031083 | 3300005459 | Bacteria | 3854 |
| 65 | Ga0068867_100060114 | 3300005459 | Bacteria | 2818 |
| 66 | Ga0068867_101940060 | 3300005459 | Bacteria | 556 |
| 67 | Ga0070685_11023442 | 3300005466 | Bacteria | 621 |
| 68 | Ga0070685_11366690 | 3300005466 | Bacteria | 543 |
| 69 | Ga0070679_100182767 | 3300005530 | Bacteria | 2069 |
| 70 | Ga0070684_100677646 | 3300005535 | Bacteria | 961 |
| 71 | Ga0070697_101700730 | 3300005536 | Bacteria | 564 |
| 72 | Ga0070672_100032604 | 3300005543 | Bacteria | 3934 |
| 73 | Ga0070672_100133643 | 3300005543 | Bacteria | 2041 |
| 74 | Ga0070672_100465110 | 3300005543 | Bacteria | 1091 |
| 75 | Ga0070672_100769976 | 3300005543 | Bacteria | 845 |
| 76 | Ga0070672_101970075 | 3300005543 | Bacteria | 526 |
| 77 | Ga0070686_100040261 | 3300005544 | Bacteria | 2915 |
| 78 | Ga0070686_100108473 | 3300005544 | Bacteria | 1887 |
| 79 | Ga0070686_100965447 | 3300005544 | Bacteria | 697 |
| 80 | Ga0070696_100792778 | 3300005546 | Bacteria | 779 |
| 81 | Ga0070693_100407181 | 3300005547 | Bacteria | 945 |
| 82 | Ga0070693_101508067 | 3300005547 | Bacteria | 526 |
| 83 | Ga0070665_100014405 | 3300005548 | Bacteria | 7935 |
| 84 | Ga0070665_100061429 | 3300005548 | Bacteria | 3767 |
| 85 | Ga0070665_100078759 | 3300005548 | Bacteria | 3302 |
| 86 | Ga0070665_100131417 | 3300005548 | Bacteria | 2506 |
| 87 | Ga0070665_101265945 | 3300005548 | Bacteria | 748 |
| 88 | Ga0070665_101335909 | 3300005548 | Bacteria | 726 |
| 89 | Ga0068855_100060286 | 3300005563 | Bacteria | 4438 |
| 90 | Ga0070664_100056479 | 3300005564 | Bacteria | 3335 |
| 91 | Ga0070664_100847576 | 3300005564 | Bacteria | 856 |
| 92 | Ga0070664_100882389 | 3300005564 | Unclassified | 838 |
| 93 | Ga0068857_100312890 | 3300005577 | Bacteria | 1449 |
| 94 | Ga0068854_100132763 | 3300005578 | Bacteria | 1903 |
| 95 | Ga0068856_100297086 | 3300005614 | Bacteria | 1632 |
| 96 | Ga0068856_100326526 | 3300005614 | Bacteria | 1552 |
| 97 | Ga0070702_100069796 | 3300005615 | Bacteria | 2072 |
| 98 | Ga0070702_100076676 | 3300005615 | Bacteria | 1990 |
| 99 | Ga0068852_100381544 | 3300005616 | Bacteria | 1383 |
| 100 | Ga0068859_100001791 | 3300005617 | Bacteria | 21873 |
| 101 | Ga0068859_100046101 | 3300005617 | Bacteria | 4379 |
| 102 | Ga0068859_100440066 | 3300005617 | Bacteria | 1400 |
| 103 | Ga0068859_100472257 | 3300005617 | Bacteria | 1350 |
| 104 | Ga0068864_100031015 | 3300005618 | Bacteria | 4534 |
| 105 | Ga0068864_100126053 | 3300005618 | Bacteria | 2295 |
| 106 | Ga0068864_100404546 | 3300005618 | Bacteria | 1298 |
| 107 | Ga0068864_101288573 | 3300005618 | Bacteria | 731 |
| 108 | Ga0068866_10260772 | 3300005718 | Bacteria | 1065 |
| 109 | Ga0068861_100003252 | 3300005719 | Bacteria | 10754 |
| 110 | Ga0068861_100105064 | 3300005719 | Bacteria | 2254 |
| 111 | Ga0068861_100139153 | 3300005719 | Bacteria | 1979 |
| 112 | Ga0068861_100147995 | 3300005719 | Bacteria | 1924 |
| 113 | Ga0068861_100310018 | 3300005719 | Bacteria | 1370 |
| 114 | Ga0068861_101190127 | 3300005719 | Unclassified | 736 |
| 115 | Ga0068851_10322692 | 3300005834 | Bacteria | 893 |
| 116 | Ga0068870_10012248 | 3300005840 | Bacteria | 4003 |
| 117 | Ga0068870_10025237 | 3300005840 | Bacteria | 2949 |
| 118 | Ga0068870_10103000 | 3300005840 | Bacteria | 1617 |
| 119 | Ga0068863_100050921 | 3300005841 | Bacteria | 3925 |
| 120 | Ga0068863_100693980 | 3300005841 | Bacteria | 1011 |
| 121 | Ga0068858_100003886 | 3300005842 | Bacteria | 14756 |
| 122 | Ga0068858_100027224 | 3300005842 | Bacteria | 5312 |
| 123 | Ga0068860_100000336 | 3300005843 | Bacteria | 63681 |
| 124 | Ga0068860_100010835 | 3300005843 | Bacteria | 8999 |
| 125 | Ga0068860_100352211 | 3300005843 | Bacteria | 1449 |
| 126 | Ga0068860_100820574 | 3300005843 | Bacteria | 944 |
| 127 | Ga0068860_100884719 | 3300005843 | Bacteria | 909 |
| 128 | Ga0068862_100057484 | 3300005844 | Bacteria | 3336 |
| 129 | Ga0068862_100058883 | 3300005844 | Bacteria | 3297 |
| 130 | Ga0068862_100118869 | 3300005844 | Bacteria | 2327 |
| 131 | Ga0068862_100427875 | 3300005844 | Bacteria | 1244 |
| 132 | Ga0068862_100501887 | 3300005844 | Bacteria | 1152 |
| 133 | Ga0075366_10553688 | 3300006195 | Bacteria | 712 |
| 134 | Ga0097621_100021188 | 3300006237 | Bacteria | 5022 |
| 135 | Ga0097621_100148846 | 3300006237 | Bacteria | 2006 |
| 136 | Ga0097621_100157887 | 3300006237 | Bacteria | 1948 |
| 137 | Ga0097621_100238022 | 3300006237 | Bacteria | 1591 |
| 138 | Ga0068871_100059944 | 3300006358 | Bacteria | 3102 |
| 139 | Ga0068871_100212045 | 3300006358 | Bacteria | 1675 |
| 140 | Ga0075428_100317233 | 3300006844 | Bacteria | 1675 |
| 141 | Ga0075430_100457887 | 3300006846 | Bacteria | 1053 |
| 142 | Ga0075430_100701481 | 3300006846 | Bacteria | 834 |
| 143 | Ga0068865_100230813 | 3300006881 | Bacteria | 1452 |
| 144 | Ga0068865_100542354 | 3300006881 | Bacteria | 976 |
| 145 | Ga0097620_100001791 | 3300006931 | Bacteria | 21873 |
| 146 | Ga0097620_100046100 | 3300006931 | Bacteria | 4379 |
| 147 | Ga0097620_100440104 | 3300006931 | Bacteria | 1400 |
| 148 | Ga0097620_100472179 | 3300006931 | Bacteria | 1350 |
| 149 | Ga0105250_10173706 | 3300009092 | Bacteria | 903 |
| 150 | Ga0105240_10049280 | 3300009093 | Bacteria | 5318 |
| 151 | Ga0105240_10213674 | 3300009093 | Bacteria | 2252 |
| 152 | Ga0105240_10274654 | 3300009093 | Bacteria | 1939 |
| 153 | Ga0105240_12103353 | 3300009093 | Bacteria | 586 |
| 154 | Ga0111539_11838937 | 3300009094 | Bacteria | 702 |
| 155 | Ga0105245_10233900 | 3300009098 | Bacteria | 1778 |
| 156 | Ga0105247_10001745 | 3300009101 | Bacteria | 15318 |
| 157 | Ga0105247_10101356 | 3300009101 | Bacteria | 1841 |
| 158 | Ga0105243_12052105 | 3300009148 | Bacteria | 607 |
| 159 | Ga0105242_10874318 | 3300009176 | Bacteria | 896 |
| 160 | Ga0105248_10037409 | 3300009177 | Bacteria | 5430 |
| 161 | Ga0105248_10103908 | 3300009177 | Bacteria | 3203 |
| 162 | Ga0105248_13069205 | 3300009177 | Bacteria | 532 |
| 163 | Ga0105237_10029300 | 3300009545 | Bacteria | 5597 |
| 164 | Ga0105237_10218150 | 3300009545 | Bacteria | 1908 |
| 165 | Ga0105237_11189947 | 3300009545 | Bacteria | 769 |
| 166 | Ga0105238_10107761 | 3300009551 | Bacteria | 2767 |
| 167 | Ga0105238_10506563 | 3300009551 | Bacteria | 1208 |
| 168 | Ga0105238_10834747 | 3300009551 | Bacteria | 938 |
| 169 | Ga0105238_10850140 | 3300009551 | Bacteria | 930 |
| 170 | Ga0105238_11041387 | 3300009551 | Bacteria | 840 |
| 171 | Ga0105238_11238177 | 3300009551 | Bacteria | 771 |
| 172 | Ga0105249_10012823 | 3300009553 | Bacteria | 7394 |
| 173 | Ga0105249_10200265 | 3300009553 | Bacteria | 1954 |
| 174 | Ga0105249_11666351 | 3300009553 | Bacteria | 710 |
| 175 | Ga0105249_12152032 | 3300009553 | Bacteria | 631 |
| 176 | Ga0105239_10382320 | 3300010375 | Bacteria | 1592 |
| 177 | Ga0105246_10146527 | 3300011119 | Bacteria | 1782 |
| 178 | Ga0157369_11029334 | 3300013105 | Bacteria | 843 |
| 179 | Ga0157374_10061637 | 3300013296 | Bacteria | 3514 |
| 180 | Ga0157374_10338149 | 3300013296 | Bacteria | 1494 |
| 181 | Ga0163162_10125783 | 3300013306 | Bacteria | 2670 |
| 182 | Ga0157372_10208691 | 3300013307 | Bacteria | 2263 |
| 183 | Ga0157375_10748480 | 3300013308 | Bacteria | 1129 |
| 184 | Ga0157375_13671108 | 3300013308 | Bacteria | 510 |
| 185 | Ga0163163_10022613 | 3300014325 | Bacteria | 5959 |
| 186 | Ga0163163_10193961 | 3300014325 | Bacteria | 2079 |
| 187 | Ga0163163_10212999 | 3300014325 | Bacteria | 1981 |
| 188 | Ga0163163_10407930 | 3300014325 | Bacteria | 1417 |
| 189 | Ga0163163_10943550 | 3300014325 | Bacteria | 926 |
| 190 | Ga0163163_11951237 | 3300014325 | Unclassified | 647 |
| 191 | Ga0157380_10018508 | 3300014326 | Bacteria | 5171 |
| 192 | Ga0157380_10195561 | 3300014326 | Bacteria | 1789 |
| 193 | Ga0157380_10204219 | 3300014326 | Bacteria | 1755 |
| 194 | Ga0157380_10226698 | 3300014326 | Bacteria | 1675 |
| 195 | Ga0157380_10626832 | 3300014326 | Bacteria | 1068 |
| 196 | Ga0157379_10017478 | 3300014968 | Bacteria | 6314 |
| 197 | Ga0157379_10040520 | 3300014968 | Bacteria | 4157 |
| 198 | Ga0157379_10062770 | 3300014968 | Bacteria | 3322 |
| 199 | Ga0157376_11547504 | 3300014969 | Bacteria | 697 |
| 200 | Ga0163161_10654489 | 3300017792 | Bacteria | 871 |
| 201 | Ga0213874_10270047 | 3300021377 | Bacteria | 632 |
| 202 | Ga0213876_10028478 | 3300021384 | Bacteria | 2946 |
| 203 | Ga0207656_10110196 | 3300025321 | Bacteria | 1271 |
| 204 | Ga0207682_10007692 | 3300025893 | Bacteria | 4287 |
| 205 | Ga0207682_10025199 | 3300025893 | Bacteria | 2358 |
| 206 | Ga0207682_10160259 | 3300025893 | Bacteria | 1019 |
| 207 | Ga0207642_10487506 | 3300025899 | Bacteria | 753 |
| 208 | Ga0207710_10000578 | 3300025900 | Bacteria | 21798 |
| 209 | Ga0207688_10105323 | 3300025901 | Bacteria | 1632 |
| 210 | Ga0207680_10009119 | 3300025903 | Bacteria | 4907 |
| 211 | Ga0207647_10041293 | 3300025904 | Bacteria | 2902 |
| 212 | Ga0207645_10284034 | 3300025907 | Bacteria | 1099 |
| 213 | Ga0207643_10035998 | 3300025908 | Bacteria | 2776 |
| 214 | Ga0207643_10122658 | 3300025908 | Bacteria | 1541 |
| 215 | Ga0207643_10216881 | 3300025908 | Bacteria | 1170 |
| 216 | Ga0207654_10458661 | 3300025911 | Bacteria | 895 |
| 217 | Ga0207707_10079897 | 3300025912 | Bacteria | 2855 |
| 218 | Ga0207695_10195390 | 3300025913 | Bacteria | 1939 |
| 219 | Ga0207695_10501638 | 3300025913 | Bacteria | 1096 |
| 220 | Ga0207671_10028270 | 3300025914 | Bacteria | 4190 |
| 221 | Ga0207671_11557139 | 3300025914 | Unclassified | 509 |
| 222 | Ga0207662_10163797 | 3300025918 | Bacteria | 1422 |
| 223 | Ga0207652_10307181 | 3300025921 | Bacteria | 1432 |
| 224 | Ga0207681_10281340 | 3300025923 | Bacteria | 1310 |
| 225 | Ga0207694_10067915 | 3300025924 | Bacteria | 2783 |
| 226 | Ga0207694_10135413 | 3300025924 | Bacteria | 1978 |
| 227 | Ga0207650_11898314 | 3300025925 | Bacteria | 503 |
| 228 | Ga0207659_10088467 | 3300025926 | Bacteria | 2307 |
| 229 | Ga0207659_10184371 | 3300025926 | Bacteria | 1656 |
| 230 | Ga0207664_11751954 | 3300025929 | Bacteria | 544 |
| 231 | Ga0207644_10001813 | 3300025931 | Bacteria | 13872 |
| 232 | Ga0207644_10456759 | 3300025931 | Bacteria | 1050 |
| 233 | Ga0207690_10950352 | 3300025932 | Bacteria | 714 |
| 234 | Ga0207706_10079427 | 3300025933 | Bacteria | 2885 |
| 235 | Ga0207706_10291294 | 3300025933 | Bacteria | 1423 |
| 236 | Ga0207706_10610264 | 3300025933 | Bacteria | 937 |
| 237 | Ga0207709_10453547 | 3300025935 | Bacteria | 992 |
| 238 | Ga0207670_10002422 | 3300025936 | Bacteria | 9786 |
| 239 | Ga0207670_10700048 | 3300025936 | Bacteria | 839 |
| 240 | Ga0207670_10754435 | 3300025936 | Bacteria | 808 |
| 241 | Ga0207670_10862298 | 3300025936 | Bacteria | 757 |
| 242 | Ga0207669_10170999 | 3300025937 | Bacteria | 1546 |
| 243 | Ga0207669_10397597 | 3300025937 | Bacteria | 1078 |
| 244 | Ga0207704_10199674 | 3300025938 | Bacteria | 1462 |
| 245 | Ga0207704_10243754 | 3300025938 | Bacteria | 1345 |
| 246 | Ga0207704_10329544 | 3300025938 | Bacteria | 1181 |
| 247 | Ga0207704_10946315 | 3300025938 | Bacteria | 726 |
| 248 | Ga0207691_10023894 | 3300025940 | Bacteria | 5752 |
| 249 | Ga0207691_10049968 | 3300025940 | Bacteria | 3830 |
| 250 | Ga0207691_10111380 | 3300025940 | Bacteria | 2434 |
| 251 | Ga0207691_10990664 | 3300025940 | Bacteria | 702 |
| 252 | Ga0207711_10195974 | 3300025941 | Bacteria | 1842 |
| 253 | Ga0207711_10269758 | 3300025941 | Bacteria | 1565 |
| 254 | Ga0207689_10236092 | 3300025942 | Bacteria | 1511 |
| 255 | Ga0207661_10238299 | 3300025944 | Bacteria | 1613 |
| 256 | Ga0207661_10439789 | 3300025944 | Bacteria | 1187 |
| 257 | Ga0207661_11751383 | 3300025944 | Unclassified | 567 |
| 258 | Ga0207679_10203307 | 3300025945 | Bacteria | 1656 |
| 259 | Ga0207679_10277744 | 3300025945 | Bacteria | 1435 |
| 260 | Ga0207667_10262287 | 3300025949 | Bacteria | 1766 |
| 261 | Ga0207651_10041215 | 3300025960 | Bacteria | 3063 |
| 262 | Ga0207651_10898500 | 3300025960 | Bacteria | 789 |
| 263 | Ga0207651_11603733 | 3300025960 | Bacteria | 586 |
| 264 | Ga0207712_10257478 | 3300025961 | Bacteria | 1414 |
| 265 | Ga0207712_11580397 | 3300025961 | Bacteria | 588 |
| 266 | Ga0207668_10264320 | 3300025972 | Bacteria | 1404 |
| 267 | Ga0207668_11671880 | 3300025972 | Bacteria | 575 |
| 268 | Ga0207640_10186700 | 3300025981 | Bacteria | 1559 |
| 269 | Ga0207640_10382280 | 3300025981 | Bacteria | 1141 |
| 270 | Ga0207658_10023125 | 3300025986 | Bacteria | 4334 |
| 271 | Ga0207658_10358107 | 3300025986 | Bacteria | 1272 |
| 272 | Ga0207658_10465798 | 3300025986 | Bacteria | 1121 |
| 273 | Ga0207658_11048415 | 3300025986 | Bacteria | 744 |
| 274 | Ga0207703_10001055 | 3300026035 | Bacteria | 26290 |
| 275 | Ga0207703_10007856 | 3300026035 | Bacteria | 8436 |
| 276 | Ga0207703_10951342 | 3300026035 | Bacteria | 823 |
| 277 | Ga0207678_10006319 | 3300026067 | Bacteria | 10520 |
| 278 | Ga0207678_10073378 | 3300026067 | Bacteria | 2932 |
| 279 | Ga0207678_10162453 | 3300026067 | Bacteria | 1907 |
| 280 | Ga0207678_11371273 | 3300026067 | Bacteria | 625 |
| 281 | Ga0207708_10052890 | 3300026075 | Bacteria | 3093 |
| 282 | Ga0207708_10243722 | 3300026075 | Bacteria | 1446 |
| 283 | Ga0207708_10289676 | 3300026075 | Bacteria | 1329 |
| 284 | Ga0207702_10907245 | 3300026078 | Bacteria | 873 |
| 285 | Ga0207641_10000788 | 3300026088 | Bacteria | 33846 |
| 286 | Ga0207641_10038112 | 3300026088 | Bacteria | 4018 |
| 287 | Ga0207641_10576404 | 3300026088 | Bacteria | 1100 |
| 288 | Ga0207648_10024885 | 3300026089 | Bacteria | 5338 |
| 289 | Ga0207648_10083899 | 3300026089 | Bacteria | 2779 |
| 290 | Ga0207648_10906049 | 3300026089 | Bacteria | 824 |
| 291 | Ga0207648_10932439 | 3300026089 | Bacteria | 812 |
| 292 | Ga0207676_10259126 | 3300026095 | Bacteria | 1569 |
| 293 | Ga0207674_10090324 | 3300026116 | Bacteria | 3054 |
| 294 | Ga0207674_10132140 | 3300026116 | Bacteria | 2459 |
| 295 | Ga0207675_100005952 | 3300026118 | Bacteria | 11621 |
| 296 | Ga0207675_100009707 | 3300026118 | Bacteria | 9006 |
| 297 | Ga0207675_100065887 | 3300026118 | Bacteria | 3385 |
| 298 | Ga0207675_100116858 | 3300026118 | Bacteria | 2521 |
| 299 | Ga0207675_100160397 | 3300026118 | Bacteria | 2145 |
| 300 | Ga0207675_100187219 | 3300026118 | Bacteria | 1984 |
| 301 | Ga0207675_100302040 | 3300026118 | Bacteria | 1559 |
| 302 | Ga0207675_101030834 | 3300026118 | Bacteria | 842 |
| 303 | Ga0207675_101065548 | 3300026118 | Bacteria | 828 |
| 304 | Ga0207683_10007590 | 3300026121 | Bacteria | 9292 |
| 305 | Ga0207683_10056803 | 3300026121 | Bacteria | 3434 |
| 306 | Ga0207683_10852070 | 3300026121 | Bacteria | 846 |
| 307 | Ga0268266_10010200 | 3300028379 | Bacteria | 8230 |
| 308 | Ga0268266_10028775 | 3300028379 | Bacteria | 4723 |
| 309 | Ga0268266_10030805 | 3300028379 | Bacteria | 4555 |
| 310 | Ga0268266_10179363 | 3300028379 | Bacteria | 1927 |
| 311 | Ga0268266_10351773 | 3300028379 | Bacteria | 1385 |
| 312 | Ga0268266_10466404 | 3300028379 | Bacteria | 1202 |
| 313 | Ga0268265_10013311 | 3300028380 | Bacteria | 5589 |
| 314 | Ga0268265_10079588 | 3300028380 | Bacteria | 2581 |
| 315 | Ga0268265_10347525 | 3300028380 | Bacteria | 1353 |
| 316 | Ga0268265_10571352 | 3300028380 | Bacteria | 1076 |
| 317 | Ga0268265_11190008 | 3300028380 | Bacteria | 759 |
| 318 | Ga0268265_11375421 | 3300028380 | Bacteria | 707 |
| 319 | Ga0268264_10000034 | 3300028381 | Bacteria | 401894 |
| 320 | Ga0268264_10023331 | 3300028381 | Bacteria | 5048 |
| 321 | Ga0268264_10348702 | 3300028381 | Bacteria | 1408 |
| 322 | Ga0268264_10369823 | 3300028381 | Bacteria | 1370 |
| 323 | Ga0268264_10599313 | 3300028381 | Bacteria | 1086 |
| 324 | Ga0307515_10166503 | 3300028794 | Bacteria | 2219 |
| 325 | Ga0307511_10008918 | 3300030521 | Bacteria | 10009 |
| 326 | Ga0307511_10296365 | 3300030521 | Bacteria | 734 |
| 327 | Ga0265762_1046843 | 3300030760 | Bacteria | 859 |
| 328 | Ga0265340_10117165 | 3300031247 | Bacteria | 1227 |
| 329 | Ga0307513_10048981 | 3300031456 | Bacteria | 4580 |
| 330 | Ga0307513_10052120 | 3300031456 | Bacteria | 4408 |
| 331 | Ga0307513_10057408 | 3300031456 | Bacteria | 4146 |
| 332 | Ga0307513_10060203 | 3300031456 | Bacteria | 4025 |
| 333 | Ga0307509_10000106 | 3300031507 | Bacteria | 118906 |
| 334 | Ga0307509_10096640 | 3300031507 | Bacteria | 3005 |
| 335 | Ga0307509_10255531 | 3300031507 | Bacteria | 1532 |
| 336 | Ga0307408_100184943 | 3300031548 | Bacteria | 1674 |
| 337 | Ga0307508_10096552 | 3300031616 | Bacteria | 2547 |
| 338 | Ga0307514_10123690 | 3300031649 | Bacteria | 1798 |
| 339 | Ga0307405_10116415 | 3300031731 | Bacteria | 1820 |
| 340 | Ga0307413_10003137 | 3300031824 | Bacteria | 6893 |
| 341 | Ga0307410_10099677 | 3300031852 | Bacteria | 2080 |
| 342 | Ga0307407_10203203 | 3300031903 | Bacteria | 1329 |
| 343 | Ga0307407_10902506 | 3300031903 | Bacteria | 678 |
| 344 | Ga0307412_11100798 | 3300031911 | Bacteria | 707 |
| 345 | Ga0307412_11858672 | 3300031911 | Bacteria | 555 |
| 346 | Ga0307409_100018163 | 3300031995 | Bacteria | 4715 |
| 347 | Ga0307416_100077922 | 3300032002 | Bacteria | 2786 |
| 348 | Ga0307416_100358275 | 3300032002 | Bacteria | 1480 |
| 349 | Ga0307411_10290931 | 3300032005 | Bacteria | 1305 |
| 350 | Ga0307411_11360864 | 3300032005 | Bacteria | 648 |
| 351 | Ga0307415_100544996 | 3300032126 | Bacteria | 1023 |
| 352 | Ga0307510_10000005 | 3300033180 | Bacteria | 633068 |
| 353 | Ga0307510_10004723 | 3300033180 | Bacteria | 16106 |
| 354 | Ga0373936_0013220 | 3300035113 | Bacteria | 3149 |
| 355 | Ga0373936_0019073 | 3300035113 | Bacteria | 2656 |
| 356 | Ga0373961_0411844 | 3300035241 | Bacteria | 521 |
| 357 | Ga0373937_0616311 | 3300036401 | Bacteria | 1030 |
| 358 | Ga0436364_0005604 | 3300037853 | Bacteria | 1329 |
| 359 | Ga0436365_0371612 | 3300039437 | Bacteria | 2104 |
| 360 | Ga0436365_1280088 | 3300039437 | Bacteria | 7083 |
| 361 | Ga0436363_0794491 | 3300039450 | Bacteria | 638 |
| 362 | Ga0451789_1144774 | 3300041443 | Bacteria | 579 |
| 363 | Ga0451791_0084078 | 3300041451 | Bacteria | 2189 |
| 364 | Ga0451791_1825438 | 3300041451 | Bacteria | 1528 |
| 365 | Ga0451793_1110932 | 3300041452 | Unclassified | 556 |
| 366 | Ga0451793_1112111 | 3300041452 | Bacteria | 1477 |
| 367 | Ga0451797_1100325 | 3300041453 | Bacteria | 1198 |
| 368 | Ga0451797_1381115 | 3300041453 | Bacteria | 1182 |
| 369 | Ga0451800_0834743 | 3300041459 | Bacteria | 629 |
| 370 | Ga0451802_1142996 | 3300041460 | Bacteria | 619 |
| 371 | Ga0451804_0423055 | 3300041463 | Bacteria | 617 |
| 372 | Ga0451807_0207366 | 3300041486 | Bacteria | 697 |
| 373 | Ga0451807_0246237 | 3300041486 | Bacteria | 872 |
| 374 | Ga0451843_1454857 | 3300041509 | Bacteria | 697 |
| 375 | Ga0450923_074767 | 3300042125 | Bacteria | 755 |
| 376 | Ga0450898_031046 | 3300042134 | Bacteria | 981 |
| 377 | Ga0439458_0032185 | 3300042157 | Bacteria | 1253 |
| 378 | Ga0450916_023314 | 3300042530 | Unclassified | 863 |
| 379 | Ga0451577_0434055 | 3300042876 | Bacteria | 1193 |
| 380 | Ga0451577_1509221 | 3300042876 | Bacteria | 594 |
| 381 | Ga0451576_0477997 | 3300045051 | Bacteria | 1309 |
| 382 | Ga0451576_0486654 | 3300045051 | Bacteria | 1296 |
| 383 | Ga0495617_037003 | 3300046452 | Bacteria | 1636 |
| 384 | Ga0495590_0001726 | 3300046457 | Bacteria | 9295 |
| 385 | Ga0495638_0016204 | 3300046460 | Bacteria | 4996 |
| 386 | Ga0495638_0412014 | 3300046460 | Bacteria | 699 |
| 387 | Ga0495641_0108590 | 3300046461 | Bacteria | 1238 |
| 388 | Ga0495641_0148959 | 3300046461 | Bacteria | 1046 |
| 389 | Ga0495584_0507684 | 3300046491 | Bacteria | 614 |
| 390 | Ga0495606_0055714 | 3300046507 | Bacteria | 2556 |
| 391 | Ga0495606_0114064 | 3300046507 | Bacteria | 1626 |
| 392 | Ga0495610_0295096 | 3300046512 | Bacteria | 627 |
| 393 | Ga0495616_0000636 | 3300046513 | Bacteria | 26231 |
| 394 | Ga0495616_0100959 | 3300046513 | Bacteria | 1353 |
| 395 | Ga0495628_1034665 | 3300046516 | Bacteria | 564 |
| 396 | Ga0495632_0034307 | 3300046519 | Bacteria | 2598 |
| 397 | Ga0495632_0288154 | 3300046519 | Bacteria | 730 |
| 398 | Ga0495632_0300502 | 3300046519 | Bacteria | 712 |
| 399 | Ga0495609_0260084 | 3300046538 | Bacteria | 713 |
| 400 | Ga0495668_0172404 | 3300046616 | Bacteria | 1185 |
| 401 | Ga0495611_0124715 | 3300046648 | Bacteria | 1201 |
| 402 | Ga0495611_0475184 | 3300046648 | Unclassified | 569 |
| 403 | Ga0495625_0015857 | 3300046660 | Bacteria | 5949 |
| 404 | Ga0495625_0092992 | 3300046660 | Bacteria | 2083 |
| 405 | Ga0495649_0010536 | 3300046694 | Bacteria | 5450 |
| 406 | Ga0495649_0030403 | 3300046694 | Bacteria | 2983 |
| 407 | Ga0495649_0121371 | 3300046694 | Bacteria | 1382 |
| 408 | Ga0495589_0546999 | 3300046794 | Bacteria | 528 |
| 409 | Ga0495686_0075849 | 3300047472 | Bacteria | 2061 |
| 410 | Ga0495626_0108232 | 3300048091 | Bacteria | 1206 |
| 411 | Ga0496102_0074653 | 3300048905 | Bacteria | 3117 |
| 412 | Ga0496102_1312547 | 3300048905 | Bacteria | 643 |
| 413 | Ga0496103_0169937 | 3300048906 | Bacteria | 1400 |
| 414 | Ga0496104_1618736 | 3300048907 | Bacteria | 550 |
| 415 | Ga0496106_0096407 | 3300048909 | Bacteria | 2289 |
| 416 | Ga0496107_0688695 | 3300048910 | Bacteria | 752 |
| 417 | Ga0496108_0631939 | 3300048911 | Bacteria | 931 |
| 418 | Ga0496114_0813318 | 3300048917 | Bacteria | 814 |
| 419 | Ga0496115_0118474 | 3300048918 | Bacteria | 2178 |
| 420 | Ga0496116_0030685 | 3300048919 | Bacteria | 3858 |
| 421 | Ga0496117_0000012 | 3300048920 | Bacteria | 608530 |
| 422 | Ga0496118_0000051 | 3300048921 | Bacteria | 241198 |
| 423 | Ga0496119_0006880 | 3300048922 | Bacteria | 10380 |
| 424 | Ga0496119_0012331 | 3300048922 | Bacteria | 6953 |
| 425 | Ga0496119_0132578 | 3300048922 | Bacteria | 1356 |
| 426 | Ga0496119_0358263 | 3300048922 | Bacteria | 705 |
| 427 | Ga0496120_0000191 | 3300048923 | Bacteria | 105146 |
| 428 | Ga0496120_0042642 | 3300048923 | Bacteria | 2648 |
| 429 | Ga0496120_0143696 | 3300048923 | Bacteria | 1208 |
| 430 | Ga0496121_0005908 | 3300048924 | Bacteria | 15490 |
| 431 | Ga0496121_0041860 | 3300048924 | Bacteria | 3995 |
| 432 | Ga0496124_0036416 | 3300048927 | Bacteria | 4292 |
| 433 | Ga0496125_0000194 | 3300048928 | Bacteria | 130058 |
| 434 | Ga0496125_0052368 | 3300048928 | Bacteria | 3357 |
| 435 | Ga0496125_0087671 | 3300048928 | Bacteria | 2349 |
| 436 | Ga0496126_0027693 | 3300048929 | Bacteria | 5408 |
| 437 | Ga0496126_0037305 | 3300048929 | Bacteria | 4537 |
| 438 | Ga0495682_0339170 | 3300049460 | Bacteria | 530 |
| 439 | Ga0501031_0464102 | 3300049568 | Bacteria | 818 |
| 440 | Ga0501032_0804314 | 3300049569 | Bacteria | 594 |
| 441 | Ga0501036_0773547 | 3300049572 | Bacteria | 791 |
| 442 | Ga0501037_0313684 | 3300049573 | Bacteria | 1087 |
| 443 | Ga0501038_0407437 | 3300049574 | Bacteria | 1051 |
| 444 | Ga0501042_0075393 | 3300049578 | Bacteria | 2414 |
| 445 | Ga0501042_0248205 | 3300049578 | Bacteria | 1284 |
| 446 | Ga0501042_0433395 | 3300049578 | Bacteria | 953 |
| 447 | Ga0501042_0783209 | 3300049578 | Bacteria | 694 |
| 448 | Ga0501048_0542745 | 3300049582 | Bacteria | 834 |
| 449 | Ga0501067_0441714 | 3300049583 | Bacteria | 726 |
| 450 | Ga0501069_0097357 | 3300049585 | Bacteria | 1668 |
| 451 | Ga0501070_0400605 | 3300049586 | Bacteria | 1110 |
| 452 | Ga0501070_0422874 | 3300049586 | Bacteria | 1076 |
| 453 | Ga0501071_0295115 | 3300049587 | Bacteria | 1228 |
| 454 | Ga0501075_0560673 | 3300049591 | Bacteria | 872 |
| 455 | Ga0501076_0115511 | 3300049592 | Bacteria | 2172 |
| 456 | Ga0501077_0729894 | 3300049593 | Bacteria | 637 |
| 457 | Ga0501235_046182 | 3300049669 | Bacteria | 1003 |
| 458 | Ga0501045_0851367 | 3300049824 | Bacteria | 671 |
| 459 | nmdc:mga0k408_631566_c1 | 3300050493 | Bacteria | 630 |
| 460 | Ga0500651_0539729 | 3300053093 | Bacteria | 639 |
| 461 | Ga0500648_212750 | 3300053097 | Bacteria | 957 |
| 462 | Ga0500614_021833 | 3300053123 | Bacteria | 1489 |
| 463 | Ga0500652_040330 | 3300053131 | Bacteria | 1876 |
| 464 | Ga0500568_0048560 | 3300053139 | Bacteria | 1677 |
| 465 | Ga0500568_0133670 | 3300053139 | Bacteria | 921 |
| 466 | Ga0500616_0065902 | 3300053153 | Bacteria | 1861 |
| 467 | Ga0500611_063008 | 3300053727 | Bacteria | 884 |
| 468 | Ga0530510_0535689 | 3300061734 | Bacteria | 889 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003323 | rootH1_10060200 | rootH1_100602004 | 112 |
| 2 | 3300041486 | Ga0451807_0207366 | Ga0451807_0207366_10_378 | 116 |
| 3 | 3300005344 | Ga0070661_101194389 | Ga0070661_1011943892 | 117 |
| 4 | 3300046648 | Ga0495611_0124715 | Ga0495611_0124715_236_655 | 119 |
| 5 | 3300005364 | Ga0070673_100062077 | Ga0070673_1000620772 | 125 |
| 6 | 3300025960 | Ga0207651_10041215 | Ga0207651_100412154 | 125 |
| 7 | 3300005340 | Ga0070689_101659683 | Ga0070689_1016596831 | 126 |
| 8 | 3300046694 | Ga0495649_0010536 | Ga0495649_0010536_3999_4421 | 126 |
| 9 | 3300025944 | Ga0207661_11751383 | Ga0207661_117513831 | 128 |
| 10 | 3300041459 | Ga0451800_0834743 | Ga0451800_0834743_55_474 | 129 |
| 11 | 3300005564 | Ga0070664_100882389 | Ga0070664_1008823892 | 131 |
| 12 | 3300009093 | Ga0105240_10213674 | Ga0105240_102136742 | 131 |
| 13 | 3300009098 | Ga0105245_10233900 | Ga0105245_102339004 | 131 |
| 14 | 3300009551 | Ga0105238_11041387 | Ga0105238_110413872 | 131 |
| 15 | 3300014326 | Ga0157380_10195561 | Ga0157380_101955612 | 131 |
| 16 | 3300046461 | Ga0495641_0148959 | Ga0495641_0148959_292_696 | 131 |
| 17 | 3300005367 | Ga0070667_100254339 | Ga0070667_1002543391 | 132 |
| 18 | 3300005843 | Ga0068860_100352211 | Ga0068860_1003522113 | 132 |
| 19 | 3300009093 | Ga0105240_10274654 | Ga0105240_102746541 | 132 |
| 20 | 3300025913 | Ga0207695_10195390 | Ga0207695_101953901 | 132 |
| 21 | 3300025986 | Ga0207658_11048415 | Ga0207658_110484152 | 132 |
| 22 | 3300028381 | Ga0268264_10369823 | Ga0268264_103698231 | 132 |
| 23 | 3300032002 | Ga0307416_100358275 | Ga0307416_1003582753 | 132 |
| 24 | 3300045051 | Ga0451576_0486654 | Ga0451576_0486654_211_612 | 132 |
| 25 | 3300046519 | Ga0495632_0300502 | Ga0495632_0300502_126_533 | 132 |
| 26 | 3300046648 | Ga0495611_0475184 | Ga0495611_0475184_38_469 | 132 |
| 27 | 3300053131 | Ga0500652_040330 | Ga0500652_040330_360_767 | 132 |
| 28 | 3300053139 | Ga0500568_0048560 | Ga0500568_0048560_187_594 | 132 |
| 29 | 3300053139 | Ga0500568_0133670 | Ga0500568_0133670_95_502 | 132 |
| 30 | 3300003316 | rootH1_10079342 | rootH1_100793426 | 133 |
| 31 | 3300003320 | rootH2_10072707 | rootH2_100727074 | 133 |
| 32 | 3300003322 | rootL2_10103198 | rootL2_101031982 | 133 |
| 33 | 3300005289 | Ga0065704_10070579 | Ga0065704_1007057920 | 133 |
| 34 | 3300005327 | Ga0070658_11386024 | Ga0070658_113860241 | 133 |
| 35 | 3300005329 | Ga0070683_100097009 | Ga0070683_1000970092 | 133 |
| 36 | 3300005331 | Ga0070670_100099168 | Ga0070670_1000991682 | 133 |
| 37 | 3300005331 | Ga0070670_101002119 | Ga0070670_1010021191 | 133 |
| 38 | 3300005333 | Ga0070677_10014380 | Ga0070677_100143804 | 133 |
| 39 | 3300005333 | Ga0070677_10043033 | Ga0070677_100430331 | 133 |
| 40 | 3300005334 | Ga0068869_100051988 | Ga0068869_1000519882 | 133 |
| 41 | 3300005334 | Ga0068869_101586984 | Ga0068869_1015869841 | 133 |
| 42 | 3300005335 | Ga0070666_10174984 | Ga0070666_101749842 | 133 |
| 43 | 3300005337 | Ga0070682_100610287 | Ga0070682_1006102871 | 133 |
| 44 | 3300005338 | Ga0068868_101569183 | Ga0068868_1015691831 | 133 |
| 45 | 3300005340 | Ga0070689_100018416 | Ga0070689_1000184165 | 133 |
| 46 | 3300005340 | Ga0070689_100128853 | Ga0070689_1001288532 | 133 |
| 47 | 3300005340 | Ga0070689_100131781 | Ga0070689_1001317812 | 133 |
| 48 | 3300005340 | Ga0070689_102112695 | Ga0070689_1021126951 | 133 |
| 49 | 3300005343 | Ga0070687_100350295 | Ga0070687_1003502952 | 133 |
| 50 | 3300005353 | Ga0070669_100167736 | Ga0070669_1001677363 | 133 |
| 51 | 3300005353 | Ga0070669_101085638 | Ga0070669_1010856381 | 133 |
| 52 | 3300005353 | Ga0070669_101999813 | Ga0070669_1019998131 | 133 |
| 53 | 3300005354 | Ga0070675_100027247 | Ga0070675_1000272474 | 133 |
| 54 | 3300005354 | Ga0070675_100042743 | Ga0070675_1000427435 | 133 |
| 55 | 3300005354 | Ga0070675_100208868 | Ga0070675_1002088682 | 133 |
| 56 | 3300005354 | Ga0070675_101528128 | Ga0070675_1015281281 | 133 |
| 57 | 3300005355 | Ga0070671_100000478 | Ga0070671_10000047821 | 133 |
| 58 | 3300005355 | Ga0070671_100266886 | Ga0070671_1002668862 | 133 |
| 59 | 3300005355 | Ga0070671_100315953 | Ga0070671_1003159531 | 133 |
| 60 | 3300005355 | Ga0070671_100576159 | Ga0070671_1005761592 | 133 |
| 61 | 3300005356 | Ga0070674_100089354 | Ga0070674_1000893541 | 133 |
| 62 | 3300005356 | Ga0070674_100141086 | Ga0070674_1001410863 | 133 |
| 63 | 3300005356 | Ga0070674_100257621 | Ga0070674_1002576213 | 133 |
| 64 | 3300005364 | Ga0070673_100060412 | Ga0070673_1000604121 | 133 |
| 65 | 3300005365 | Ga0070688_100254953 | Ga0070688_1002549533 | 133 |
| 66 | 3300005365 | Ga0070688_100979605 | Ga0070688_1009796051 | 133 |
| 67 | 3300005367 | Ga0070667_100019855 | Ga0070667_1000198556 | 133 |
| 68 | 3300005367 | Ga0070667_100020397 | Ga0070667_1000203972 | 133 |
| 69 | 3300005406 | Ga0070703_10029691 | Ga0070703_100296913 | 133 |
| 70 | 3300005438 | Ga0070701_10193986 | Ga0070701_101939861 | 133 |
| 71 | 3300005438 | Ga0070701_10229279 | Ga0070701_102292791 | 133 |
| 72 | 3300005438 | Ga0070701_10656939 | Ga0070701_106569391 | 133 |
| 73 | 3300005440 | Ga0070705_100200144 | Ga0070705_1002001442 | 133 |
| 74 | 3300005440 | Ga0070705_100804579 | Ga0070705_1008045791 | 133 |
| 75 | 3300005441 | Ga0070700_100056751 | Ga0070700_1000567512 | 133 |
| 76 | 3300005441 | Ga0070700_100090622 | Ga0070700_1000906223 | 133 |
| 77 | 3300005441 | Ga0070700_100147371 | Ga0070700_1001473711 | 133 |
| 78 | 3300005441 | Ga0070700_100217456 | Ga0070700_1002174561 | 133 |
| 79 | 3300005444 | Ga0070694_100018203 | Ga0070694_1000182033 | 133 |
| 80 | 3300005455 | Ga0070663_100623263 | Ga0070663_1006232632 | 133 |
| 81 | 3300005455 | Ga0070663_101684960 | Ga0070663_1016849602 | 133 |
| 82 | 3300005456 | Ga0070678_100024624 | Ga0070678_1000246244 | 133 |
| 83 | 3300005456 | Ga0070678_100050138 | Ga0070678_1000501383 | 133 |
| 84 | 3300005456 | Ga0070678_100533090 | Ga0070678_1005330902 | 133 |
| 85 | 3300005456 | Ga0070678_101253859 | Ga0070678_1012538591 | 133 |
| 86 | 3300005458 | Ga0070681_10277352 | Ga0070681_102773521 | 133 |
| 87 | 3300005458 | Ga0070681_10706782 | Ga0070681_107067822 | 133 |
| 88 | 3300005459 | Ga0068867_100031083 | Ga0068867_1000310834 | 133 |
| 89 | 3300005459 | Ga0068867_100060114 | Ga0068867_1000601143 | 133 |
| 90 | 3300005459 | Ga0068867_101940060 | Ga0068867_1019400601 | 133 |
| 91 | 3300005466 | Ga0070685_11023442 | Ga0070685_110234422 | 133 |
| 92 | 3300005466 | Ga0070685_11366690 | Ga0070685_113666901 | 133 |
| 93 | 3300005530 | Ga0070679_100182767 | Ga0070679_1001827673 | 133 |
| 94 | 3300005535 | Ga0070684_100677646 | Ga0070684_1006776462 | 133 |
| 95 | 3300005536 | Ga0070697_101700730 | Ga0070697_1017007301 | 133 |
| 96 | 3300005543 | Ga0070672_100032604 | Ga0070672_1000326045 | 133 |
| 97 | 3300005543 | Ga0070672_100133643 | Ga0070672_1001336432 | 133 |
| 98 | 3300005543 | Ga0070672_100465110 | Ga0070672_1004651101 | 133 |
| 99 | 3300005543 | Ga0070672_100769976 | Ga0070672_1007699762 | 133 |
| 100 | 3300005543 | Ga0070672_101970075 | Ga0070672_1019700751 | 133 |
| 101 | 3300005544 | Ga0070686_100040261 | Ga0070686_1000402612 | 133 |
| 102 | 3300005544 | Ga0070686_100108473 | Ga0070686_1001084732 | 133 |
| 103 | 3300005544 | Ga0070686_100965447 | Ga0070686_1009654471 | 133 |
| 104 | 3300005546 | Ga0070696_100792778 | Ga0070696_1007927781 | 133 |
| 105 | 3300005547 | Ga0070693_100407181 | Ga0070693_1004071812 | 133 |
| 106 | 3300005547 | Ga0070693_101508067 | Ga0070693_1015080672 | 133 |
| 107 | 3300005548 | Ga0070665_100014405 | Ga0070665_1000144059 | 133 |
| 108 | 3300005548 | Ga0070665_100061429 | Ga0070665_1000614295 | 133 |
| 109 | 3300005548 | Ga0070665_100078759 | Ga0070665_1000787591 | 133 |
| 110 | 3300005548 | Ga0070665_100131417 | Ga0070665_1001314174 | 133 |
| 111 | 3300005548 | Ga0070665_101265945 | Ga0070665_1012659451 | 133 |
| 112 | 3300005548 | Ga0070665_101335909 | Ga0070665_1013359092 | 133 |
| 113 | 3300005563 | Ga0068855_100060286 | Ga0068855_1000602866 | 133 |
| 114 | 3300005564 | Ga0070664_100056479 | Ga0070664_1000564792 | 133 |
| 115 | 3300005564 | Ga0070664_100847576 | Ga0070664_1008475762 | 133 |
| 116 | 3300005577 | Ga0068857_100312890 | Ga0068857_1003128902 | 133 |
| 117 | 3300005578 | Ga0068854_100132763 | Ga0068854_1001327632 | 133 |
| 118 | 3300005614 | Ga0068856_100297086 | Ga0068856_1002970863 | 133 |
| 119 | 3300005614 | Ga0068856_100326526 | Ga0068856_1003265263 | 133 |
| 120 | 3300005615 | Ga0070702_100069796 | Ga0070702_1000697964 | 133 |
| 121 | 3300005615 | Ga0070702_100076676 | Ga0070702_1000766762 | 133 |
| 122 | 3300005616 | Ga0068852_100381544 | Ga0068852_1003815441 | 133 |
| 123 | 3300005617 | Ga0068859_100001791 | Ga0068859_1000017912 | 133 |
| 124 | 3300005617 | Ga0068859_100046101 | Ga0068859_1000461015 | 133 |
| 125 | 3300005617 | Ga0068859_100440066 | Ga0068859_1004400662 | 133 |
| 126 | 3300005617 | Ga0068859_100472257 | Ga0068859_1004722571 | 133 |
| 127 | 3300005618 | Ga0068864_100031015 | Ga0068864_1000310154 | 133 |
| 128 | 3300005618 | Ga0068864_100126053 | Ga0068864_1001260532 | 133 |
| 129 | 3300005618 | Ga0068864_100404546 | Ga0068864_1004045462 | 133 |
| 130 | 3300005618 | Ga0068864_101288573 | Ga0068864_1012885731 | 133 |
| 131 | 3300005718 | Ga0068866_10260772 | Ga0068866_102607722 | 133 |
| 132 | 3300005719 | Ga0068861_100003252 | Ga0068861_10000325211 | 133 |
| 133 | 3300005719 | Ga0068861_100105064 | Ga0068861_1001050643 | 133 |
| 134 | 3300005719 | Ga0068861_100139153 | Ga0068861_1001391531 | 133 |
| 135 | 3300005719 | Ga0068861_100147995 | Ga0068861_1001479951 | 133 |
| 136 | 3300005719 | Ga0068861_100310018 | Ga0068861_1003100182 | 133 |
| 137 | 3300005719 | Ga0068861_101190127 | Ga0068861_1011901271 | 133 |
| 138 | 3300005834 | Ga0068851_10322692 | Ga0068851_103226922 | 133 |
| 139 | 3300005840 | Ga0068870_10012248 | Ga0068870_100122484 | 133 |
| 140 | 3300005840 | Ga0068870_10025237 | Ga0068870_100252374 | 133 |
| 141 | 3300005840 | Ga0068870_10103000 | Ga0068870_101030002 | 133 |
| 142 | 3300005841 | Ga0068863_100050921 | Ga0068863_1000509217 | 133 |
| 143 | 3300005841 | Ga0068863_100693980 | Ga0068863_1006939802 | 133 |
| 144 | 3300005842 | Ga0068858_100003886 | Ga0068858_1000038864 | 133 |
| 145 | 3300005842 | Ga0068858_100027224 | Ga0068858_1000272246 | 133 |
| 146 | 3300005843 | Ga0068860_100000336 | Ga0068860_10000033656 | 133 |
| 147 | 3300005843 | Ga0068860_100010835 | Ga0068860_1000108355 | 133 |
| 148 | 3300005843 | Ga0068860_100820574 | Ga0068860_1008205742 | 133 |
| 149 | 3300005843 | Ga0068860_100884719 | Ga0068860_1008847191 | 133 |
| 150 | 3300005844 | Ga0068862_100057484 | Ga0068862_1000574843 | 133 |
| 151 | 3300005844 | Ga0068862_100058883 | Ga0068862_1000588833 | 133 |
| 152 | 3300005844 | Ga0068862_100118869 | Ga0068862_1001188693 | 133 |
| 153 | 3300005844 | Ga0068862_100427875 | Ga0068862_1004278752 | 133 |
| 154 | 3300005844 | Ga0068862_100501887 | Ga0068862_1005018872 | 133 |
| 155 | 3300006195 | Ga0075366_10553688 | Ga0075366_105536882 | 133 |
| 156 | 3300006237 | Ga0097621_100021188 | Ga0097621_1000211884 | 133 |
| 157 | 3300006237 | Ga0097621_100148846 | Ga0097621_1001488462 | 133 |
| 158 | 3300006237 | Ga0097621_100157887 | Ga0097621_1001578873 | 133 |
| 159 | 3300006237 | Ga0097621_100238022 | Ga0097621_1002380222 | 133 |
| 160 | 3300006358 | Ga0068871_100059944 | Ga0068871_1000599442 | 133 |
| 161 | 3300006358 | Ga0068871_100212045 | Ga0068871_1002120452 | 133 |
| 162 | 3300006844 | Ga0075428_100317233 | Ga0075428_1003172332 | 133 |
| 163 | 3300006846 | Ga0075430_100457887 | Ga0075430_1004578872 | 133 |
| 164 | 3300006846 | Ga0075430_100701481 | Ga0075430_1007014811 | 133 |
| 165 | 3300006881 | Ga0068865_100230813 | Ga0068865_1002308132 | 133 |
| 166 | 3300006881 | Ga0068865_100542354 | Ga0068865_1005423542 | 133 |
| 167 | 3300006931 | Ga0097620_100001791 | Ga0097620_1000017912 | 133 |
| 168 | 3300006931 | Ga0097620_100046100 | Ga0097620_1000461002 | 133 |
| 169 | 3300006931 | Ga0097620_100440104 | Ga0097620_1004401042 | 133 |
| 170 | 3300006931 | Ga0097620_100472179 | Ga0097620_1004721791 | 133 |
| 171 | 3300009092 | Ga0105250_10173706 | Ga0105250_101737062 | 133 |
| 172 | 3300009093 | Ga0105240_10049280 | Ga0105240_100492807 | 133 |
| 173 | 3300009093 | Ga0105240_12103353 | Ga0105240_121033531 | 133 |
| 174 | 3300009094 | Ga0111539_11838937 | Ga0111539_118389371 | 133 |
| 175 | 3300009101 | Ga0105247_10001745 | Ga0105247_1000174517 | 133 |
| 176 | 3300009101 | Ga0105247_10101356 | Ga0105247_101013561 | 133 |
| 177 | 3300009148 | Ga0105243_12052105 | Ga0105243_120521051 | 133 |
| 178 | 3300009176 | Ga0105242_10874318 | Ga0105242_108743181 | 133 |
| 179 | 3300009177 | Ga0105248_10037409 | Ga0105248_100374094 | 133 |
| 180 | 3300009177 | Ga0105248_10103908 | Ga0105248_101039082 | 133 |
| 181 | 3300009177 | Ga0105248_13069205 | Ga0105248_130692051 | 133 |
| 182 | 3300009545 | Ga0105237_10029300 | Ga0105237_100293005 | 133 |
| 183 | 3300009545 | Ga0105237_10218150 | Ga0105237_102181501 | 133 |
| 184 | 3300009545 | Ga0105237_11189947 | Ga0105237_111899471 | 133 |
| 185 | 3300009551 | Ga0105238_10107761 | Ga0105238_101077614 | 133 |
| 186 | 3300009551 | Ga0105238_10506563 | Ga0105238_105065632 | 133 |
| 187 | 3300009551 | Ga0105238_10834747 | Ga0105238_108347471 | 133 |
| 188 | 3300009551 | Ga0105238_10850140 | Ga0105238_108501402 | 133 |
| 189 | 3300009551 | Ga0105238_11238177 | Ga0105238_112381771 | 133 |
| 190 | 3300009553 | Ga0105249_10012823 | Ga0105249_100128233 | 133 |
| 191 | 3300009553 | Ga0105249_10200265 | Ga0105249_102002652 | 133 |
| 192 | 3300009553 | Ga0105249_11666351 | Ga0105249_116663512 | 133 |
| 193 | 3300009553 | Ga0105249_12152032 | Ga0105249_121520321 | 133 |
| 194 | 3300010375 | Ga0105239_10382320 | Ga0105239_103823202 | 133 |
| 195 | 3300011119 | Ga0105246_10146527 | Ga0105246_101465272 | 133 |
| 196 | 3300013105 | Ga0157369_11029334 | Ga0157369_110293341 | 133 |
| 197 | 3300013296 | Ga0157374_10061637 | Ga0157374_100616372 | 133 |
| 198 | 3300013296 | Ga0157374_10338149 | Ga0157374_103381492 | 133 |
| 199 | 3300013306 | Ga0163162_10125783 | Ga0163162_101257834 | 133 |
| 200 | 3300013307 | Ga0157372_10208691 | Ga0157372_102086912 | 133 |
| 201 | 3300013308 | Ga0157375_10748480 | Ga0157375_107484801 | 133 |
| 202 | 3300013308 | Ga0157375_13671108 | Ga0157375_136711081 | 133 |
| 203 | 3300014325 | Ga0163163_10022613 | Ga0163163_100226132 | 133 |
| 204 | 3300014325 | Ga0163163_10193961 | Ga0163163_101939613 | 133 |
| 205 | 3300014325 | Ga0163163_10212999 | Ga0163163_102129994 | 133 |
| 206 | 3300014325 | Ga0163163_10407930 | Ga0163163_104079302 | 133 |
| 207 | 3300014325 | Ga0163163_10943550 | Ga0163163_109435502 | 133 |
| 208 | 3300014325 | Ga0163163_11951237 | Ga0163163_119512371 | 133 |
| 209 | 3300014326 | Ga0157380_10018508 | Ga0157380_100185087 | 133 |
| 210 | 3300014326 | Ga0157380_10204219 | Ga0157380_102042192 | 133 |
| 211 | 3300014326 | Ga0157380_10226698 | Ga0157380_102266982 | 133 |
| 212 | 3300014326 | Ga0157380_10626832 | Ga0157380_106268321 | 133 |
| 213 | 3300014968 | Ga0157379_10017478 | Ga0157379_100174782 | 133 |
| 214 | 3300014968 | Ga0157379_10040520 | Ga0157379_100405206 | 133 |
| 215 | 3300014968 | Ga0157379_10062770 | Ga0157379_100627703 | 133 |
| 216 | 3300014969 | Ga0157376_11547504 | Ga0157376_115475041 | 133 |
| 217 | 3300017792 | Ga0163161_10654489 | Ga0163161_106544892 | 133 |
| 218 | 3300021377 | Ga0213874_10270047 | Ga0213874_102700472 | 133 |
| 219 | 3300021384 | Ga0213876_10028478 | Ga0213876_100284782 | 133 |
| 220 | 3300025321 | Ga0207656_10110196 | Ga0207656_101101961 | 133 |
| 221 | 3300025893 | Ga0207682_10007692 | Ga0207682_100076924 | 133 |
| 222 | 3300025893 | Ga0207682_10025199 | Ga0207682_100251993 | 133 |
| 223 | 3300025893 | Ga0207682_10160259 | Ga0207682_101602592 | 133 |
| 224 | 3300025899 | Ga0207642_10487506 | Ga0207642_104875062 | 133 |
| 225 | 3300025900 | Ga0207710_10000578 | Ga0207710_1000057819 | 133 |
| 226 | 3300025901 | Ga0207688_10105323 | Ga0207688_101053232 | 133 |
| 227 | 3300025903 | Ga0207680_10009119 | Ga0207680_100091192 | 133 |
| 228 | 3300025904 | Ga0207647_10041293 | Ga0207647_100412931 | 133 |
| 229 | 3300025907 | Ga0207645_10284034 | Ga0207645_102840342 | 133 |
| 230 | 3300025908 | Ga0207643_10035998 | Ga0207643_100359981 | 133 |
| 231 | 3300025908 | Ga0207643_10122658 | Ga0207643_101226581 | 133 |
| 232 | 3300025908 | Ga0207643_10216881 | Ga0207643_102168812 | 133 |
| 233 | 3300025911 | Ga0207654_10458661 | Ga0207654_104586612 | 133 |
| 234 | 3300025912 | Ga0207707_10079897 | Ga0207707_100798974 | 133 |
| 235 | 3300025913 | Ga0207695_10501638 | Ga0207695_105016382 | 133 |
| 236 | 3300025914 | Ga0207671_10028270 | Ga0207671_100282703 | 133 |
| 237 | 3300025914 | Ga0207671_11557139 | Ga0207671_115571391 | 133 |
| 238 | 3300025918 | Ga0207662_10163797 | Ga0207662_101637972 | 133 |
| 239 | 3300025921 | Ga0207652_10307181 | Ga0207652_103071812 | 133 |
| 240 | 3300025923 | Ga0207681_10281340 | Ga0207681_102813401 | 133 |
| 241 | 3300025924 | Ga0207694_10067915 | Ga0207694_100679154 | 133 |
| 242 | 3300025924 | Ga0207694_10135413 | Ga0207694_101354134 | 133 |
| 243 | 3300025925 | Ga0207650_11898314 | Ga0207650_118983141 | 133 |
| 244 | 3300025926 | Ga0207659_10088467 | Ga0207659_100884672 | 133 |
| 245 | 3300025926 | Ga0207659_10184371 | Ga0207659_101843711 | 133 |
| 246 | 3300025929 | Ga0207664_11751954 | Ga0207664_117519541 | 133 |
| 247 | 3300025931 | Ga0207644_10001813 | Ga0207644_1000181313 | 133 |
| 248 | 3300025931 | Ga0207644_10456759 | Ga0207644_104567591 | 133 |
| 249 | 3300025932 | Ga0207690_10950352 | Ga0207690_109503521 | 133 |
| 250 | 3300025933 | Ga0207706_10079427 | Ga0207706_100794272 | 133 |
| 251 | 3300025933 | Ga0207706_10291294 | Ga0207706_102912942 | 133 |
| 252 | 3300025933 | Ga0207706_10610264 | Ga0207706_106102642 | 133 |
| 253 | 3300025935 | Ga0207709_10453547 | Ga0207709_104535471 | 133 |
| 254 | 3300025936 | Ga0207670_10002422 | Ga0207670_100024229 | 133 |
| 255 | 3300025936 | Ga0207670_10700048 | Ga0207670_107000481 | 133 |
| 256 | 3300025936 | Ga0207670_10754435 | Ga0207670_107544351 | 133 |
| 257 | 3300025936 | Ga0207670_10862298 | Ga0207670_108622981 | 133 |
| 258 | 3300025937 | Ga0207669_10170999 | Ga0207669_101709992 | 133 |
| 259 | 3300025937 | Ga0207669_10397597 | Ga0207669_103975972 | 133 |
| 260 | 3300025938 | Ga0207704_10199674 | Ga0207704_101996741 | 133 |
| 261 | 3300025938 | Ga0207704_10243754 | Ga0207704_102437543 | 133 |
| 262 | 3300025938 | Ga0207704_10329544 | Ga0207704_103295441 | 133 |
| 263 | 3300025938 | Ga0207704_10946315 | Ga0207704_109463152 | 133 |
| 264 | 3300025940 | Ga0207691_10023894 | Ga0207691_100238945 | 133 |
| 265 | 3300025940 | Ga0207691_10049968 | Ga0207691_100499682 | 133 |
| 266 | 3300025940 | Ga0207691_10111380 | Ga0207691_101113804 | 133 |
| 267 | 3300025940 | Ga0207691_10990664 | Ga0207691_109906641 | 133 |
| 268 | 3300025941 | Ga0207711_10195974 | Ga0207711_101959743 | 133 |
| 269 | 3300025941 | Ga0207711_10269758 | Ga0207711_102697583 | 133 |
| 270 | 3300025942 | Ga0207689_10236092 | Ga0207689_102360922 | 133 |
| 271 | 3300025944 | Ga0207661_10238299 | Ga0207661_102382993 | 133 |
| 272 | 3300025944 | Ga0207661_10439789 | Ga0207661_104397892 | 133 |
| 273 | 3300025945 | Ga0207679_10203307 | Ga0207679_102033072 | 133 |
| 274 | 3300025945 | Ga0207679_10277744 | Ga0207679_102777442 | 133 |
| 275 | 3300025949 | Ga0207667_10262287 | Ga0207667_102622872 | 133 |
| 276 | 3300025960 | Ga0207651_10898500 | Ga0207651_108985001 | 133 |
| 277 | 3300025960 | Ga0207651_11603733 | Ga0207651_116037332 | 133 |
| 278 | 3300025961 | Ga0207712_10257478 | Ga0207712_102574783 | 133 |
| 279 | 3300025961 | Ga0207712_11580397 | Ga0207712_115803972 | 133 |
| 280 | 3300025972 | Ga0207668_10264320 | Ga0207668_102643203 | 133 |
| 281 | 3300025972 | Ga0207668_11671880 | Ga0207668_116718801 | 133 |
| 282 | 3300025981 | Ga0207640_10186700 | Ga0207640_101867001 | 133 |
| 283 | 3300025981 | Ga0207640_10382280 | Ga0207640_103822802 | 133 |
| 284 | 3300025986 | Ga0207658_10023125 | Ga0207658_100231252 | 133 |
| 285 | 3300025986 | Ga0207658_10358107 | Ga0207658_103581072 | 133 |
| 286 | 3300025986 | Ga0207658_10465798 | Ga0207658_104657982 | 133 |
| 287 | 3300026035 | Ga0207703_10001055 | Ga0207703_1000105519 | 133 |
| 288 | 3300026035 | Ga0207703_10007856 | Ga0207703_100078564 | 133 |
| 289 | 3300026035 | Ga0207703_10951342 | Ga0207703_109513422 | 133 |
| 290 | 3300026067 | Ga0207678_10006319 | Ga0207678_100063192 | 133 |
| 291 | 3300026067 | Ga0207678_10073378 | Ga0207678_100733784 | 133 |
| 292 | 3300026067 | Ga0207678_10162453 | Ga0207678_101624533 | 133 |
| 293 | 3300026067 | Ga0207678_11371273 | Ga0207678_113712731 | 133 |
| 294 | 3300026075 | Ga0207708_10052890 | Ga0207708_100528902 | 133 |
| 295 | 3300026075 | Ga0207708_10243722 | Ga0207708_102437222 | 133 |
| 296 | 3300026075 | Ga0207708_10289676 | Ga0207708_102896761 | 133 |
| 297 | 3300026078 | Ga0207702_10907245 | Ga0207702_109072452 | 133 |
| 298 | 3300026088 | Ga0207641_10000788 | Ga0207641_1000078811 | 133 |
| 299 | 3300026088 | Ga0207641_10038112 | Ga0207641_100381124 | 133 |
| 300 | 3300026088 | Ga0207641_10576404 | Ga0207641_105764042 | 133 |
| 301 | 3300026089 | Ga0207648_10024885 | Ga0207648_100248854 | 133 |
| 302 | 3300026089 | Ga0207648_10083899 | Ga0207648_100838993 | 133 |
| 303 | 3300026089 | Ga0207648_10906049 | Ga0207648_109060491 | 133 |
| 304 | 3300026089 | Ga0207648_10932439 | Ga0207648_109324392 | 133 |
| 305 | 3300026095 | Ga0207676_10259126 | Ga0207676_102591263 | 133 |
| 306 | 3300026116 | Ga0207674_10090324 | Ga0207674_100903242 | 133 |
| 307 | 3300026116 | Ga0207674_10132140 | Ga0207674_101321401 | 133 |
| 308 | 3300026118 | Ga0207675_100005952 | Ga0207675_10000595211 | 133 |
| 309 | 3300026118 | Ga0207675_100009707 | Ga0207675_1000097078 | 133 |
| 310 | 3300026118 | Ga0207675_100065887 | Ga0207675_1000658873 | 133 |
| 311 | 3300026118 | Ga0207675_100116858 | Ga0207675_1001168582 | 133 |
| 312 | 3300026118 | Ga0207675_100160397 | Ga0207675_1001603973 | 133 |
| 313 | 3300026118 | Ga0207675_100187219 | Ga0207675_1001872193 | 133 |
| 314 | 3300026118 | Ga0207675_100302040 | Ga0207675_1003020403 | 133 |
| 315 | 3300026118 | Ga0207675_101030834 | Ga0207675_1010308342 | 133 |
| 316 | 3300026118 | Ga0207675_101065548 | Ga0207675_1010655482 | 133 |
| 317 | 3300026121 | Ga0207683_10007590 | Ga0207683_100075906 | 133 |
| 318 | 3300026121 | Ga0207683_10056803 | Ga0207683_100568034 | 133 |
| 319 | 3300026121 | Ga0207683_10852070 | Ga0207683_108520701 | 133 |
| 320 | 3300028379 | Ga0268266_10010200 | Ga0268266_1001020011 | 133 |
| 321 | 3300028379 | Ga0268266_10028775 | Ga0268266_100287754 | 133 |
| 322 | 3300028379 | Ga0268266_10030805 | Ga0268266_100308052 | 133 |
| 323 | 3300028379 | Ga0268266_10179363 | Ga0268266_101793634 | 133 |
| 324 | 3300028379 | Ga0268266_10351773 | Ga0268266_103517733 | 133 |
| 325 | 3300028379 | Ga0268266_10466404 | Ga0268266_104664042 | 133 |
| 326 | 3300028380 | Ga0268265_10013311 | Ga0268265_100133115 | 133 |
| 327 | 3300028380 | Ga0268265_10079588 | Ga0268265_100795885 | 133 |
| 328 | 3300028380 | Ga0268265_10347525 | Ga0268265_103475251 | 133 |
| 329 | 3300028380 | Ga0268265_10571352 | Ga0268265_105713522 | 133 |
| 330 | 3300028380 | Ga0268265_11190008 | Ga0268265_111900081 | 133 |
| 331 | 3300028380 | Ga0268265_11375421 | Ga0268265_113754212 | 133 |
| 332 | 3300028381 | Ga0268264_10000034 | Ga0268264_10000034244 | 133 |
| 333 | 3300028381 | Ga0268264_10023331 | Ga0268264_100233315 | 133 |
| 334 | 3300028381 | Ga0268264_10348702 | Ga0268264_103487022 | 133 |
| 335 | 3300028381 | Ga0268264_10599313 | Ga0268264_105993132 | 133 |
| 336 | 3300028794 | Ga0307515_10166503 | Ga0307515_101665034 | 133 |
| 337 | 3300030521 | Ga0307511_10008918 | Ga0307511_1000891815 | 133 |
| 338 | 3300030521 | Ga0307511_10296365 | Ga0307511_102963652 | 133 |
| 339 | 3300030760 | Ga0265762_1046843 | Ga0265762_10468432 | 133 |
| 340 | 3300031247 | Ga0265340_10117165 | Ga0265340_101171652 | 133 |
| 341 | 3300031456 | Ga0307513_10048981 | Ga0307513_100489815 | 133 |
| 342 | 3300031456 | Ga0307513_10052120 | Ga0307513_100521205 | 133 |
| 343 | 3300031456 | Ga0307513_10057408 | Ga0307513_100574085 | 133 |
| 344 | 3300031456 | Ga0307513_10060203 | Ga0307513_100602032 | 133 |
| 345 | 3300031507 | Ga0307509_10000106 | Ga0307509_1000010638 | 133 |
| 346 | 3300031507 | Ga0307509_10096640 | Ga0307509_100966404 | 133 |
| 347 | 3300031507 | Ga0307509_10255531 | Ga0307509_102555312 | 133 |
| 348 | 3300031548 | Ga0307408_100184943 | Ga0307408_1001849431 | 133 |
| 349 | 3300031616 | Ga0307508_10096552 | Ga0307508_100965523 | 133 |
| 350 | 3300031649 | Ga0307514_10123690 | Ga0307514_101236901 | 133 |
| 351 | 3300031731 | Ga0307405_10116415 | Ga0307405_101164152 | 133 |
| 352 | 3300031824 | Ga0307413_10003137 | Ga0307413_100031372 | 133 |
| 353 | 3300031852 | Ga0307410_10099677 | Ga0307410_100996773 | 133 |
| 354 | 3300031903 | Ga0307407_10203203 | Ga0307407_102032032 | 133 |
| 355 | 3300031903 | Ga0307407_10902506 | Ga0307407_109025062 | 133 |
| 356 | 3300031911 | Ga0307412_11100798 | Ga0307412_111007981 | 133 |
| 357 | 3300031911 | Ga0307412_11858672 | Ga0307412_118586721 | 133 |
| 358 | 3300031995 | Ga0307409_100018163 | Ga0307409_1000181635 | 133 |
| 359 | 3300032002 | Ga0307416_100077922 | Ga0307416_1000779224 | 133 |
| 360 | 3300032005 | Ga0307411_10290931 | Ga0307411_102909313 | 133 |
| 361 | 3300032005 | Ga0307411_11360864 | Ga0307411_113608641 | 133 |
| 362 | 3300032126 | Ga0307415_100544996 | Ga0307415_1005449961 | 133 |
| 363 | 3300033180 | Ga0307510_10000005 | Ga0307510_10000005160 | 133 |
| 364 | 3300033180 | Ga0307510_10004723 | Ga0307510_1000472310 | 133 |
| 365 | 3300035113 | Ga0373936_0013220 | Ga0373936_0013220_1909_2310 | 133 |
| 366 | 3300035113 | Ga0373936_0019073 | Ga0373936_0019073_1976_2377 | 133 |
| 367 | 3300035241 | Ga0373961_0411844 | Ga0373961_0411844_21_434 | 133 |
| 368 | 3300036401 | Ga0373937_0616311 | Ga0373937_0616311_368_805 | 133 |
| 369 | 3300037853 | Ga0436364_0005604 | Ga0436364_0005604_796_1197 | 133 |
| 370 | 3300039437 | Ga0436365_0371612 | Ga0436365_0371612_383_784 | 133 |
| 371 | 3300039437 | Ga0436365_1280088 | Ga0436365_1280088_3984_4385 | 133 |
| 372 | 3300039450 | Ga0436363_0794491 | Ga0436363_0794491_154_555 | 133 |
| 373 | 3300041443 | Ga0451789_1144774 | Ga0451789_1144774_147_563 | 133 |
| 374 | 3300041451 | Ga0451791_0084078 | Ga0451791_0084078_727_1137 | 133 |
| 375 | 3300041451 | Ga0451791_1825438 | Ga0451791_1825438_237_656 | 133 |
| 376 | 3300041452 | Ga0451793_1110932 | Ga0451793_1110932_110_535 | 133 |
| 377 | 3300041452 | Ga0451793_1112111 | Ga0451793_1112111_37_447 | 133 |
| 378 | 3300041453 | Ga0451797_1100325 | Ga0451797_1100325_484_909 | 133 |
| 379 | 3300041453 | Ga0451797_1381115 | Ga0451797_1381115_378_788 | 133 |
| 380 | 3300041460 | Ga0451802_1142996 | Ga0451802_1142996_165_575 | 133 |
| 381 | 3300041463 | Ga0451804_0423055 | Ga0451804_0423055_88_513 | 133 |
| 382 | 3300041486 | Ga0451807_0246237 | Ga0451807_0246237_404_814 | 133 |
| 383 | 3300041509 | Ga0451843_1454857 | Ga0451843_1454857_49_465 | 133 |
| 384 | 3300042125 | Ga0450923_074767 | Ga0450923_074767_214_642 | 133 |
| 385 | 3300042134 | Ga0450898_031046 | Ga0450898_031046_34_447 | 133 |
| 386 | 3300042157 | Ga0439458_0032185 | Ga0439458_0032185_10_423 | 133 |
| 387 | 3300042530 | Ga0450916_023314 | Ga0450916_023314_34_447 | 133 |
| 388 | 3300042876 | Ga0451577_0434055 | Ga0451577_0434055_771_1175 | 133 |
| 389 | 3300042876 | Ga0451577_1509221 | Ga0451577_1509221_77_481 | 133 |
| 390 | 3300045051 | Ga0451576_0477997 | Ga0451576_0477997_822_1226 | 133 |
| 391 | 3300046452 | Ga0495617_037003 | Ga0495617_037003_1017_1430 | 133 |
| 392 | 3300046457 | Ga0495590_0001726 | Ga0495590_0001726_7768_8181 | 133 |
| 393 | 3300046460 | Ga0495638_0016204 | Ga0495638_0016204_124_534 | 133 |
| 394 | 3300046460 | Ga0495638_0412014 | Ga0495638_0412014_107_526 | 133 |
| 395 | 3300046461 | Ga0495641_0108590 | Ga0495641_0108590_55_492 | 133 |
| 396 | 3300046491 | Ga0495584_0507684 | Ga0495584_0507684_157_558 | 133 |
| 397 | 3300046507 | Ga0495606_0055714 | Ga0495606_0055714_1388_1789 | 133 |
| 398 | 3300046507 | Ga0495606_0114064 | Ga0495606_0114064_289_690 | 133 |
| 399 | 3300046512 | Ga0495610_0295096 | Ga0495610_0295096_110_523 | 133 |
| 400 | 3300046513 | Ga0495616_0000636 | Ga0495616_0000636_10194_10604 | 133 |
| 401 | 3300046513 | Ga0495616_0100959 | Ga0495616_0100959_640_1050 | 133 |
| 402 | 3300046516 | Ga0495628_1034665 | Ga0495628_1034665_55_456 | 133 |
| 403 | 3300046519 | Ga0495632_0034307 | Ga0495632_0034307_688_1101 | 133 |
| 404 | 3300046519 | Ga0495632_0288154 | Ga0495632_0288154_56_466 | 133 |
| 405 | 3300046538 | Ga0495609_0260084 | Ga0495609_0260084_186_587 | 133 |
| 406 | 3300046616 | Ga0495668_0172404 | Ga0495668_0172404_430_843 | 133 |
| 407 | 3300046660 | Ga0495625_0015857 | Ga0495625_0015857_2718_3140 | 133 |
| 408 | 3300046660 | Ga0495625_0092992 | Ga0495625_0092992_631_1044 | 133 |
| 409 | 3300046694 | Ga0495649_0030403 | Ga0495649_0030403_1639_2040 | 133 |
| 410 | 3300046694 | Ga0495649_0121371 | Ga0495649_0121371_801_1214 | 133 |
| 411 | 3300046794 | Ga0495589_0546999 | Ga0495589_0546999_62_472 | 133 |
| 412 | 3300047472 | Ga0495686_0075849 | Ga0495686_0075849_1488_1898 | 133 |
| 413 | 3300048091 | Ga0495626_0108232 | Ga0495626_0108232_751_1164 | 133 |
| 414 | 3300048905 | Ga0496102_0074653 | Ga0496102_0074653_1470_1871 | 133 |
| 415 | 3300048905 | Ga0496102_1312547 | Ga0496102_1312547_147_548 | 133 |
| 416 | 3300048906 | Ga0496103_0169937 | Ga0496103_0169937_162_563 | 133 |
| 417 | 3300048907 | Ga0496104_1618736 | Ga0496104_1618736_43_444 | 133 |
| 418 | 3300048909 | Ga0496106_0096407 | Ga0496106_0096407_1179_1580 | 133 |
| 419 | 3300048910 | Ga0496107_0688695 | Ga0496107_0688695_145_546 | 133 |
| 420 | 3300048911 | Ga0496108_0631939 | Ga0496108_0631939_161_562 | 133 |
| 421 | 3300048917 | Ga0496114_0813318 | Ga0496114_0813318_209_610 | 133 |
| 422 | 3300048918 | Ga0496115_0118474 | Ga0496115_0118474_314_715 | 133 |
| 423 | 3300048919 | Ga0496116_0030685 | Ga0496116_0030685_1466_1867 | 133 |
| 424 | 3300048920 | Ga0496117_0000012 | Ga0496117_0000012_409272_409673 | 133 |
| 425 | 3300048921 | Ga0496118_0000051 | Ga0496118_0000051_40388_40789 | 133 |
| 426 | 3300048922 | Ga0496119_0006880 | Ga0496119_0006880_6012_6413 | 133 |
| 427 | 3300048922 | Ga0496119_0012331 | Ga0496119_0012331_4997_5398 | 133 |
| 428 | 3300048922 | Ga0496119_0132578 | Ga0496119_0132578_506_907 | 133 |
| 429 | 3300048922 | Ga0496119_0358263 | Ga0496119_0358263_205_606 | 133 |
| 430 | 3300048923 | Ga0496120_0000191 | Ga0496120_0000191_80253_80654 | 133 |
| 431 | 3300048923 | Ga0496120_0042642 | Ga0496120_0042642_77_478 | 133 |
| 432 | 3300048923 | Ga0496120_0143696 | Ga0496120_0143696_338_739 | 133 |
| 433 | 3300048924 | Ga0496121_0005908 | Ga0496121_0005908_14746_15147 | 133 |
| 434 | 3300048924 | Ga0496121_0041860 | Ga0496121_0041860_3257_3658 | 133 |
| 435 | 3300048927 | Ga0496124_0036416 | Ga0496124_0036416_11_412 | 133 |
| 436 | 3300048928 | Ga0496125_0000194 | Ga0496125_0000194_106944_107345 | 133 |
| 437 | 3300048928 | Ga0496125_0052368 | Ga0496125_0052368_50_451 | 133 |
| 438 | 3300048928 | Ga0496125_0087671 | Ga0496125_0087671_77_478 | 133 |
| 439 | 3300048929 | Ga0496126_0027693 | Ga0496126_0027693_1553_1954 | 133 |
| 440 | 3300048929 | Ga0496126_0037305 | Ga0496126_0037305_3791_4192 | 133 |
| 441 | 3300049460 | Ga0495682_0339170 | Ga0495682_0339170_93_506 | 133 |
| 442 | 3300049568 | Ga0501031_0464102 | Ga0501031_0464102_154_567 | 133 |
| 443 | 3300049569 | Ga0501032_0804314 | Ga0501032_0804314_164_577 | 133 |
| 444 | 3300049572 | Ga0501036_0773547 | Ga0501036_0773547_344_757 | 133 |
| 445 | 3300049573 | Ga0501037_0313684 | Ga0501037_0313684_203_616 | 133 |
| 446 | 3300049574 | Ga0501038_0407437 | Ga0501038_0407437_510_932 | 133 |
| 447 | 3300049578 | Ga0501042_0075393 | Ga0501042_0075393_1822_2235 | 133 |
| 448 | 3300049578 | Ga0501042_0248205 | Ga0501042_0248205_349_762 | 133 |
| 449 | 3300049578 | Ga0501042_0433395 | Ga0501042_0433395_434_847 | 133 |
| 450 | 3300049578 | Ga0501042_0783209 | Ga0501042_0783209_198_620 | 133 |
| 451 | 3300049582 | Ga0501048_0542745 | Ga0501048_0542745_89_502 | 133 |
| 452 | 3300049583 | Ga0501067_0441714 | Ga0501067_0441714_166_585 | 133 |
| 453 | 3300049585 | Ga0501069_0097357 | Ga0501069_0097357_312_725 | 133 |
| 454 | 3300049586 | Ga0501070_0400605 | Ga0501070_0400605_338_751 | 133 |
| 455 | 3300049586 | Ga0501070_0422874 | Ga0501070_0422874_403_816 | 133 |
| 456 | 3300049587 | Ga0501071_0295115 | Ga0501071_0295115_342_755 | 133 |
| 457 | 3300049591 | Ga0501075_0560673 | Ga0501075_0560673_204_617 | 133 |
| 458 | 3300049592 | Ga0501076_0115511 | Ga0501076_0115511_1451_1864 | 133 |
| 459 | 3300049593 | Ga0501077_0729894 | Ga0501077_0729894_55_468 | 133 |
| 460 | 3300049669 | Ga0501235_046182 | Ga0501235_046182_385_792 | 133 |
| 461 | 3300049824 | Ga0501045_0851367 | Ga0501045_0851367_195_608 | 133 |
| 462 | 3300050493 | nmdc:mga0k408_631566_c1 | nmdc:mga0k408_631566_c1_85_498 | 133 |
| 463 | 3300053093 | Ga0500651_0539729 | Ga0500651_0539729_161_571 | 133 |
| 464 | 3300053097 | Ga0500648_212750 | Ga0500648_212750_79_480 | 133 |
| 465 | 3300053123 | Ga0500614_021833 | Ga0500614_021833_1038_1439 | 133 |
| 466 | 3300053153 | Ga0500616_0065902 | Ga0500616_0065902_547_963 | 133 |
| 467 | 3300053727 | Ga0500611_063008 | Ga0500611_063008_275_685 | 133 |
| 468 | 3300061734 | Ga0530510_0535689 | Ga0530510_0535689_251_664 | 133 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar