F449926

General Info

Members Datasets Scaffolds Average Seq Length
467 205 934 84

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0973818|Ga0501035_0973818_124_423
Length 99
Sequence MNEADIRTVLQEELGNIAPEMDLQALDPAADLREALDIDSMDFLNFVIGLDRSLGVAVPESEYPRIATLDGCVAYLAEQLEPSGRVNSKEPDAPDAGRG

Samples

Sample ID Description Type Environment
1 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
72 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
73 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
76 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
80 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
81 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
82 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
83 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
84 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
85 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
88 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
89 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
104 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
105 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
111 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
130 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
205 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0.21
Rhizoplane 6
Rhizosphere 93.58
Stem 0
Stem Tuber 0
Unclassified 16.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501035_0973818 3300049822 Unclassified 668
2 Ga0070670_100065375 3300005331 Bacteria 3121
3 Ga0070660_101617264 3300005339 Bacteria 551
4 Ga0070689_102166446 3300005340 Bacteria 509
5 Ga0070661_101809770 3300005344 Bacteria 518
6 Ga0070668_100399179 3300005347 Bacteria 1174
7 Ga0070671_101101631 3300005355 Bacteria 697
8 Ga0070659_100928371 3300005366 Bacteria 762
9 Ga0070701_10938643 3300005438 Bacteria 600
10 Ga0070663_100501105 3300005455 Bacteria 1008
11 Ga0070681_10244957 3300005458 Bacteria 1706
12 Ga0070681_10284458 3300005458 Unclassified 1564
13 Ga0070679_100010322 3300005530 Bacteria 8853
14 Ga0070684_100115230 3300005535 Bacteria 2413
15 Ga0068853_101435458 3300005539 Bacteria 668
16 Ga0070665_101186169 3300005548 Bacteria 774
17 Ga0068855_100961434 3300005563 Bacteria 899
18 Ga0070664_100126861 3300005564 Bacteria 2239
19 Ga0068856_101062353 3300005614 Unclassified 827
20 Ga0070702_100126075 3300005615 Bacteria 1610
21 Ga0068852_102492183 3300005616 Bacteria 537
22 Ga0068859_101639635 3300005617 Bacteria 710
23 Ga0068863_100227296 3300005841 Bacteria 1799
24 Ga0068863_100343980 3300005841 Bacteria 1451
25 Ga0068858_100231487 3300005842 Bacteria 1752
26 Ga0070717_10326435 3300006028 Bacteria 1368
27 Ga0075364_10534712 3300006051 Bacteria 801
28 Ga0097621_100595039 3300006237 Bacteria 1010
29 Ga0068871_100464736 3300006358 Bacteria 1136
30 Ga0075428_100098391 3300006844 Bacteria 3189
31 Ga0075430_100530395 3300006846 Bacteria 971
32 Ga0075431_100891675 3300006847 Unclassified 859
33 Ga0075431_100911377 3300006847 Bacteria 848
34 Ga0075434_100218283 3300006871 Bacteria 1927
35 Ga0075434_100657326 3300006871 Unclassified 1066
36 Ga0075429_100269128 3300006880 Bacteria 1492
37 Ga0068865_100841414 3300006881 Bacteria 794
38 Ga0075435_100557748 3300007076 Unclassified 992
39 Ga0111539_10122040 3300009094 Bacteria 3053
40 Ga0111539_11549081 3300009094 Bacteria 769
41 Ga0105245_11402365 3300009098 Bacteria 749
42 Ga0105247_10116790 3300009101 Bacteria 1724
43 Ga0114129_10009810 3300009147 Bacteria 13655
44 Ga0105243_11644050 3300009148 Unclassified 670
45 Ga0105248_11690994 3300009177 Bacteria 717
46 Ga0105238_11242990 3300009551 Bacteria 770
47 Ga0105238_11461026 3300009551 Bacteria 712
48 Ga0105249_10705511 3300009553 Bacteria 1069
49 Ga0105249_11380532 3300009553 Bacteria 776
50 Ga0105239_10677402 3300010375 Bacteria 1179
51 Ga0105246_10468628 3300011119 Bacteria 1063
52 Ga0105246_10851569 3300011119 Bacteria 813
53 Ga0157378_10764943 3300013297 Bacteria 989
54 Ga0157378_12553482 3300013297 Bacteria 563
55 Ga0163162_11394760 3300013306 Bacteria 797
56 Ga0157375_10936449 3300013308 Bacteria 1009
57 Ga0163163_10026784 3300014325 Bacteria 5515
58 Ga0157380_11077545 3300014326 Bacteria 841
59 Ga0182008_10201836 3300014497 Bacteria 1012
60 Ga0157379_10202496 3300014968 Bacteria 1795
61 Ga0157379_10389253 3300014968 Bacteria 1280
62 Ga0157376_10940335 3300014969 Bacteria 884
63 Ga0207707_10239342 3300025912 Bacteria 1578
64 Ga0207707_10665864 3300025912 Unclassified 876
65 Ga0207660_10232829 3300025917 Bacteria 1449
66 Ga0207649_11475797 3300025920 Bacteria 538
67 Ga0207652_10484206 3300025921 Bacteria 1114
68 Ga0207650_10037763 3300025925 Bacteria 3522
69 Ga0207659_11687848 3300025926 Bacteria 540
70 Ga0207690_10706691 3300025932 Bacteria 829
71 Ga0207704_11275469 3300025938 Bacteria 628
72 Ga0207679_10096884 3300025945 Bacteria 2296
73 Ga0207667_10753886 3300025949 Bacteria 973
74 Ga0207712_11217542 3300025961 Bacteria 672
75 Ga0207668_10734692 3300025972 Bacteria 870
76 Ga0207678_10741321 3300026067 Bacteria 866
77 Ga0207708_11036294 3300026075 Unclassified 714
78 Ga0207702_11498383 3300026078 Bacteria 668
79 Ga0207641_10352576 3300026088 Bacteria 1403
80 Ga0209974_10043961 3300027876 Bacteria 1489
81 Ga0268266_11196233 3300028379 Bacteria 735
82 Ga0265337_1000205 3300028556 Bacteria 31699
83 Ga0265330_10154872 3300031235 Bacteria 974
84 Ga0265332_10028035 3300031238 Bacteria 2466
85 Ga0265316_10051768 3300031344 Bacteria 3224
86 Ga0265316_11309027 3300031344 Bacteria 500
87 Ga0316575_10106935 3300031665 Unclassified 1140
88 Ga0316579_10004686 3300031691 Bacteria 5452
89 Ga0307405_10863691 3300031731 Unclassified 763
90 Ga0307413_12003458 3300031824 Unclassified 522
91 Ga0316583_10005250 3300032133 Bacteria 4644
92 Ga0373958_0196494 3300034819 Bacteria 526
93 Ga0373926_0061220 3300035083 Bacteria 1373
94 Ga0373926_0470558 3300035083 Unclassified 500
95 Ga0373928_0175223 3300035084 Bacteria 607
96 Ga0373934_0287626 3300035086 Bacteria 681
97 Ga0373944_0062687 3300035089 Unclassified 1196
98 Ga0373923_0386465 3300035111 Bacteria 672
99 Ga0373936_0099572 3300035113 Bacteria 1225
100 Ga0373936_0239994 3300035113 Bacteria 808
101 Ga0373939_0001567 3300035114 Bacteria 5551
102 Ga0373945_0074201 3300035116 Bacteria 1293
103 Ga0373945_0076163 3300035116 Bacteria 1278
104 Ga0373954_0098219 3300035118 Bacteria 1411
105 Ga0373954_0267623 3300035118 Bacteria 842
106 Ga0373954_0628810 3300035118 Bacteria 532
107 Ga0373956_0418035 3300035119 Unclassified 640
108 Ga0373957_0140700 3300035120 Bacteria 986
109 Ga0373957_0244004 3300035120 Bacteria 755
110 Ga0373943_0001708 3300035170 Bacteria 9946
111 Ga0373943_0314744 3300035170 Bacteria 891
112 Ga0373943_0471155 3300035170 Bacteria 732
113 Ga0373946_0106179 3300035171 Bacteria 1265
114 Ga0373946_0116869 3300035171 Bacteria 1213
115 Ga0373946_0661003 3300035171 Bacteria 545
116 Ga0373955_0383409 3300035172 Bacteria 853
117 Ga0373955_0442691 3300035172 Bacteria 792
118 Ga0373955_0596793 3300035172 Unclassified 676
119 Ga0373931_0010750 3300035691 Bacteria 4406
120 Ga0373935_0063592 3300035692 Bacteria 2365
121 Ga0373935_0348423 3300035692 Bacteria 1055
122 Ga0373935_1066777 3300035692 Unclassified 601
123 Ga0373927_0004319 3300035695 Bacteria 9971
124 Ga0373927_0021399 3300035695 Bacteria 4239
125 Ga0373927_0063523 3300035695 Bacteria 2388
126 Ga0373927_0235023 3300035695 Unclassified 1204
127 Ga0373927_0815893 3300035695 Bacteria 616
128 Ga0373933_0023992 3300035724 Bacteria 3491
129 Ga0373933_0172021 3300035724 Bacteria 1379
130 Ga0373933_0228672 3300035724 Bacteria 1194
131 Ga0373933_0252688 3300035724 Unclassified 1135
132 Ga0373933_0253011 3300035724 Bacteria 1135
133 Ga0373947_0002490 3300035725 Bacteria 11076
134 Ga0373947_0048932 3300035725 Bacteria 2537
135 Ga0373947_0079779 3300035725 Bacteria 2023
136 Ga0373947_0085535 3300035725 Unclassified 1959
137 Ga0373947_0386028 3300035725 Bacteria 943
138 Ga0373937_0018289 3300036401 Bacteria 6255
139 Ga0373937_0120779 3300036401 Bacteria 2441
140 Ga0373937_0514135 3300036401 Bacteria 1138
141 Ga0373937_0621075 3300036401 Bacteria 1026
142 Ga0316582_0437464 3300036647 Bacteria 901
143 Ga0316582_0490090 3300036647 Bacteria 847
144 Ga0373925_0083471 3300037068 Bacteria 2433
145 Ga0373925_0151355 3300037068 Bacteria 1822
146 Ga0373925_0493018 3300037068 Bacteria 1005
147 Ga0439435_0243950 3300042436 Bacteria 603
148 Ga0495592_0048224 3300046454 Bacteria 3169
149 Ga0495592_0118026 3300046454 Bacteria 1870
150 Ga0495592_0670933 3300046454 Bacteria 626
151 Ga0495603_0038705 3300046455 Bacteria 2859
152 Ga0495629_0053738 3300046459 Bacteria 2817
153 Ga0495629_0163386 3300046459 Bacteria 1546
154 Ga0495629_0295245 3300046459 Unclassified 1110
155 Ga0495629_0506993 3300046459 Bacteria 813
156 Ga0495629_0642925 3300046459 Bacteria 707
157 Ga0495641_0032780 3300046461 Bacteria 2470
158 Ga0495641_0389725 3300046461 Bacteria 632
159 Ga0495651_0019163 3300046462 Bacteria 5301
160 Ga0495651_0080797 3300046462 Bacteria 2455
161 Ga0495651_0228079 3300046462 Archaea 1285
162 Ga0495651_0341609 3300046462 Bacteria 992
163 Ga0495653_0073970 3300046463 Bacteria 2541
164 Ga0495653_0104418 3300046463 Bacteria 2048
165 Ga0495580_0224993 3300046472 Bacteria 1289
166 Ga0495580_0400343 3300046472 Bacteria 926
167 Ga0495582_0134789 3300046473 Bacteria 1397
168 Ga0495639_0037422 3300046475 Bacteria 2175
169 Ga0495639_0755838 3300046475 Unclassified 503
170 Ga0495662_0025703 3300046476 Bacteria 2843
171 Ga0495662_0216872 3300046476 Bacteria 943
172 Ga0495662_0229825 3300046476 Bacteria 914
173 Ga0495664_0015020 3300046477 Bacteria 4398
174 Ga0495594_0159927 3300046499 Bacteria 1280
175 Ga0495594_0362003 3300046499 Bacteria 826
176 Ga0495594_0434529 3300046499 Bacteria 746
177 Ga0495608_0094139 3300046511 Bacteria 1935
178 Ga0495608_0233826 3300046511 Bacteria 1150
179 Ga0495608_0611165 3300046511 Bacteria 654
180 Ga0495618_0060389 3300046514 Bacteria 2404
181 Ga0495618_0417237 3300046514 Unclassified 819
182 Ga0495628_0119073 3300046516 Unclassified 2027
183 Ga0495628_0733897 3300046516 Bacteria 695
184 Ga0495630_0020029 3300046517 Bacteria 4926
185 Ga0495630_0128192 3300046517 Bacteria 1926
186 Ga0495630_0234221 3300046517 Bacteria 1403
187 Ga0495630_0453396 3300046517 Bacteria 983
188 Ga0495666_0110723 3300046526 Bacteria 1290
189 Ga0495652_0036646 3300046529 Bacteria 4261
190 Ga0495652_0175508 3300046529 Bacteria 1650
191 Ga0495652_0256761 3300046529 Bacteria 1292
192 Ga0495652_0443096 3300046529 Bacteria 911
193 Ga0495665_0067222 3300046531 Bacteria 1891
194 Ga0495665_0102852 3300046531 Bacteria 1499
195 Ga0495665_0137872 3300046531 Bacteria 1276
196 Ga0495665_0239422 3300046531 Unclassified 936
197 Ga0495640_0139808 3300046533 Bacteria 1561
198 Ga0495640_0149074 3300046533 Bacteria 1504
199 Ga0495640_0165148 3300046533 Unclassified 1417
200 Ga0495640_0364930 3300046533 Bacteria 890
201 Ga0495640_0382557 3300046533 Bacteria 866
202 Ga0495587_0104654 3300046536 Bacteria 1628
203 Ga0495587_0155020 3300046536 Bacteria 1305
204 Ga0495645_0879963 3300046543 Bacteria 533
205 Ga0495667_0039403 3300046559 Bacteria 3142
206 Ga0495667_0048872 3300046559 Bacteria 2793
207 Ga0495667_0494915 3300046559 Bacteria 766
208 Ga0495634_0022183 3300046642 Bacteria 4475
209 Ga0495634_0133249 3300046642 Bacteria 1583
210 Ga0495634_0368342 3300046642 Bacteria 858
211 Ga0495634_0437445 3300046642 Bacteria 773
212 Ga0495635_0038459 3300046663 Bacteria 3313
213 Ga0495635_0116904 3300046663 Bacteria 1820
214 Ga0495635_0411818 3300046663 Bacteria 897
215 Ga0495635_0655410 3300046663 Bacteria 683
216 Ga0495588_0498460 3300046674 Unclassified 638
217 Ga0495657_0223310 3300046675 Bacteria 1141
218 Ga0495657_0297423 3300046675 Bacteria 963
219 Ga0495657_0443104 3300046675 Bacteria 761
220 Ga0495599_0463699 3300046678 Bacteria 749
221 Ga0495599_0636586 3300046678 Unclassified 619
222 Ga0495599_0892522 3300046678 Unclassified 504
223 Ga0495623_0210664 3300046679 Bacteria 1113
224 Ga0495647_0072586 3300046681 Bacteria 1381
225 Ga0495658_0575938 3300046683 Unclassified 721
226 Ga0495613_0134304 3300046689 Bacteria 1771
227 Ga0495613_0138066 3300046689 Bacteria 1743
228 Ga0495613_0219226 3300046689 Archaea 1336
229 Ga0495613_0373478 3300046689 Bacteria 976
230 Ga0495613_0465402 3300046689 Bacteria 855
231 Ga0495624_0007229 3300046690 Bacteria 7807
232 Ga0495624_0156243 3300046690 Bacteria 1394
233 Ga0495624_0175098 3300046690 Bacteria 1308
234 Ga0495624_0721107 3300046690 Unclassified 591
235 Ga0495600_0119561 3300046809 Archaea 1714
236 Ga0495600_0253299 3300046809 Bacteria 1119
237 Ga0495600_0601841 3300046809 Bacteria 668
238 Ga0495581_0021594 3300047315 Bacteria 3730
239 Ga0495581_0145749 3300047315 Bacteria 1382
240 Ga0495581_0405883 3300047315 Unclassified 795
241 Ga0495581_0503806 3300047315 Unclassified 704
242 Ga0495604_0028662 3300047317 Bacteria 4430
243 Ga0495604_0242403 3300047317 Bacteria 1232
244 Ga0495604_0745424 3300047317 Bacteria 620
245 Ga0495674_0018648 3300047319 Bacteria 6457
246 Ga0495674_0090749 3300047319 Bacteria 2610
247 Ga0495674_0791270 3300047319 Bacteria 738
248 Ga0495676_0118195 3300047321 Unclassified 1933
249 Ga0495676_0229424 3300047321 Bacteria 1276
250 Ga0495676_0874333 3300047321 Bacteria 576
251 Ga0495680_0125200 3300047322 Archaea 1894
252 Ga0495680_0392133 3300047322 Bacteria 960
253 Ga0495680_1018402 3300047322 Bacteria 528
254 Ga0495675_0290058 3300047444 Bacteria 974
255 Ga0495675_0835189 3300047444 Bacteria 508
256 Ga0495684_0010024 3300047471 Bacteria 7326
257 Ga0495684_0047799 3300047471 Bacteria 3272
258 Ga0495684_0169229 3300047471 Bacteria 1626
259 Ga0495684_0240930 3300047471 Bacteria 1319
260 Ga0495684_0249567 3300047471 Bacteria 1292
261 Ga0495593_0163043 3300047673 Bacteria 1125
262 Ga0495593_0211505 3300047673 Archaea 974
263 Ga0495593_0408125 3300047673 Bacteria 679
264 Ga0495593_0633265 3300047673 Unclassified 537
265 Ga0495602_0005304 3300048088 Bacteria 13527
266 Ga0495602_0061925 3300048088 Bacteria 3249
267 Ga0495602_0279920 3300048088 Bacteria 1229
268 Ga0495602_0429069 3300048088 Bacteria 937
269 Ga0495602_0737247 3300048088 Bacteria 666
270 Ga0496100_0646557 3300048903 Bacteria 823
271 Ga0496101_0215412 3300048904 Bacteria 1489
272 Ga0496101_0832476 3300048904 Bacteria 727
273 Ga0496101_0955389 3300048904 Bacteria 674
274 Ga0496102_0061657 3300048905 Bacteria 3432
275 Ga0496104_0000466 3300048907 Bacteria 34882
276 Ga0496104_0012115 3300048907 Bacteria 7742
277 Ga0496104_0690768 3300048907 Bacteria 928
278 Ga0496105_0006501 3300048908 Bacteria 8987
279 Ga0496105_0019767 3300048908 Bacteria 5434
280 Ga0496106_0045664 3300048909 Bacteria 3291
281 Ga0496106_0624370 3300048909 Bacteria 862
282 Ga0496107_0017606 3300048910 Bacteria 5027
283 Ga0496107_0061054 3300048910 Bacteria 2729
284 Ga0496107_0211397 3300048910 Bacteria 1442
285 Ga0496108_0049070 3300048911 Bacteria 3530
286 Ga0496108_0703062 3300048911 Bacteria 876
287 Ga0496109_0001375 3300048912 Bacteria 20176
288 Ga0496109_1117263 3300048912 Bacteria 725
289 Ga0496110_0005932 3300048913 Bacteria 9614
290 Ga0496111_0007035 3300048914 Bacteria 7351
291 Ga0496111_0751666 3300048914 Bacteria 707
292 Ga0496112_0009659 3300048915 Bacteria 8705
293 Ga0496112_0402799 3300048915 Bacteria 1308
294 Ga0496113_0000087 3300048916 Bacteria 40247
295 Ga0496114_0391248 3300048917 Bacteria 1231
296 Ga0496115_0011519 3300048918 Bacteria 6630
297 Ga0496115_1112000 3300048918 Bacteria 598
298 Ga0501031_0010954 3300049568 Bacteria 5908
299 Ga0501031_0125531 3300049568 Unclassified 1677
300 Ga0501032_0302366 3300049569 Bacteria 1034
301 Ga0501033_0006033 3300049570 Bacteria 9501
302 Ga0501033_0162942 3300049570 Bacteria 1605
303 Ga0501033_0242173 3300049570 Bacteria 1279
304 Ga0501034_0587070 3300049571 Bacteria 1021
305 Ga0501034_1552604 3300049571 Unclassified 535
306 Ga0501036_0012230 3300049572 Bacteria 7109
307 Ga0501036_0405430 3300049572 Unclassified 1137
308 Ga0501037_0306311 3300049573 Bacteria 1102
309 Ga0501037_0710372 3300049573 Unclassified 668
310 Ga0501038_0057075 3300049574 Bacteria 3353
311 Ga0501038_0182509 3300049574 Bacteria 1692
312 Ga0501039_0041467 3300049575 Bacteria 3555
313 Ga0501039_0055468 3300049575 Bacteria 3069
314 Ga0501039_0202249 3300049575 Bacteria 1562
315 Ga0501039_0365174 3300049575 Bacteria 1134
316 Ga0501039_0696686 3300049575 Bacteria 794
317 Ga0501039_0718831 3300049575 Unclassified 781
318 Ga0501040_0028716 3300049576 Bacteria 3750
319 Ga0501040_0204831 3300049576 Bacteria 1401
320 Ga0501040_1298804 3300049576 Unclassified 528
321 Ga0501041_0014392 3300049577 Bacteria 4697
322 Ga0501041_0539550 3300049577 Unclassified 743
323 Ga0501041_0611462 3300049577 Bacteria 696
324 Ga0501042_0012249 3300049578 Bacteria 5804
325 Ga0501042_0079951 3300049578 Bacteria 2342
326 Ga0501042_0275992 3300049578 Bacteria 1214
327 Ga0501042_0290428 3300049578 Bacteria 1181
328 Ga0501042_0500616 3300049578 Bacteria 882
329 Ga0501042_1061697 3300049578 Unclassified 590
330 Ga0501043_0007750 3300049579 Bacteria 8496
331 Ga0501043_0169816 3300049579 Bacteria 1702
332 Ga0501043_0275683 3300049579 Bacteria 1290
333 Ga0501046_0027336 3300049580 Bacteria 4654
334 Ga0501046_0181195 3300049580 Bacteria 1575
335 Ga0501046_0219208 3300049580 Bacteria 1409
336 Ga0501046_0820482 3300049580 Unclassified 651
337 Ga0501047_0106827 3300049581 Bacteria 2680
338 Ga0501047_0981052 3300049581 Unclassified 658
339 Ga0501048_0020290 3300049582 Bacteria 4871
340 Ga0501048_0101630 3300049582 Bacteria 2028
341 Ga0501048_0874352 3300049582 Bacteria 646
342 Ga0501068_0074046 3300049584 Bacteria 2081
343 Ga0501068_0074653 3300049584 Bacteria 2073
344 Ga0501068_0105788 3300049584 Bacteria 1747
345 Ga0501068_0330627 3300049584 Bacteria 978
346 Ga0501068_0736640 3300049584 Unclassified 645
347 Ga0501068_1100854 3300049584 Unclassified 525
348 Ga0501069_0244014 3300049585 Bacteria 1047
349 Ga0501070_0675177 3300049586 Bacteria 819
350 Ga0501070_0961880 3300049586 Unclassified 664
351 Ga0501070_1134694 3300049586 Unclassified 602
352 Ga0501070_1429049 3300049586 Unclassified 525
353 Ga0501071_0016727 3300049587 Bacteria 5044
354 Ga0501072_0131321 3300049588 Bacteria 1996
355 Ga0501072_0198802 3300049588 Unclassified 1598
356 Ga0501072_0335395 3300049588 Bacteria 1201
357 Ga0501073_0003629 3300049589 Bacteria 11605
358 Ga0501073_0474653 3300049589 Unclassified 865
359 Ga0501073_0491866 3300049589 Bacteria 848
360 Ga0501074_0051875 3300049590 Bacteria 2960
361 Ga0501074_0075527 3300049590 Bacteria 2419
362 Ga0501074_0123719 3300049590 Unclassified 1850
363 Ga0501074_0349713 3300049590 Unclassified 1049
364 Ga0501074_0622225 3300049590 Bacteria 763
365 Ga0501074_0874948 3300049590 Bacteria 632
366 Ga0501075_0007031 3300049591 Bacteria 7774
367 Ga0501075_0167509 3300049591 Bacteria 1676
368 Ga0501075_0186931 3300049591 Bacteria 1580
369 Ga0501075_0705586 3300049591 Bacteria 768
370 Ga0501075_1071489 3300049591 Unclassified 612
371 Ga0501075_1087667 3300049591 Unclassified 607
372 Ga0501075_1457304 3300049591 Bacteria 518
373 Ga0501076_0046634 3300049592 Bacteria 3424
374 Ga0501076_0050852 3300049592 Bacteria 3279
375 Ga0501076_0056449 3300049592 Bacteria 3117
376 Ga0501076_0120752 3300049592 Bacteria 2122
377 Ga0501076_0124783 3300049592 Bacteria 2086
378 Ga0501076_0131880 3300049592 Bacteria 2027
379 Ga0501076_1783796 3300049592 Bacteria 504
380 Ga0501077_0012914 3300049593 Bacteria 5231
381 Ga0501077_0053920 3300049593 Bacteria 2553
382 Ga0501077_0100234 3300049593 Unclassified 1835
383 Ga0501077_0129741 3300049593 Unclassified 1598
384 Ga0501077_0180860 3300049593 Bacteria 1340
385 Ga0501077_0306082 3300049593 Bacteria 1013
386 Ga0501079_0049777 3300049741 Bacteria 3234
387 Ga0501079_0057839 3300049741 Bacteria 2992
388 Ga0501079_0197860 3300049741 Bacteria 1569
389 Ga0501079_0217998 3300049741 Bacteria 1490
390 Ga0501079_0280757 3300049741 Bacteria 1302
391 Ga0501079_0688588 3300049741 Bacteria 805
392 Ga0501080_0122071 3300049742 Bacteria 2414
393 Ga0501080_0237903 3300049742 Bacteria 1663
394 Ga0501080_0466282 3300049742 Bacteria 1131
395 Ga0501080_0977496 3300049742 Bacteria 735
396 Ga0501080_1104610 3300049742 Unclassified 684
397 Ga0501081_0029546 3300049743 Bacteria 3704
398 Ga0501081_0142053 3300049743 Unclassified 1721
399 Ga0501081_0200101 3300049743 Bacteria 1448
400 Ga0501081_0235104 3300049743 Bacteria 1335
401 Ga0501081_0631474 3300049743 Bacteria 802
402 Ga0501081_0635910 3300049743 Bacteria 799
403 Ga0501083_0014151 3300049744 Bacteria 5580
404 Ga0501083_0319308 3300049744 Unclassified 1010
405 Ga0501083_0566729 3300049744 Unclassified 739
406 Ga0501083_0869404 3300049744 Unclassified 587
407 Ga0501083_1074606 3300049744 Unclassified 524
408 Ga0501035_0084672 3300049822 Bacteria 2796
409 Ga0501035_1016442 3300049822 Bacteria 651
410 Ga0501044_0058673 3300049823 Bacteria 3946
411 Ga0501044_0639522 3300049823 Bacteria 954
412 Ga0501045_0185471 3300049824 Bacteria 1550
413 Ga0501045_0196309 3300049824 Bacteria 1504
414 Ga0501045_0314853 3300049824 Unclassified 1164
415 Ga0501045_0357823 3300049824 Bacteria 1086
416 Ga0501045_1254771 3300049824 Bacteria 540
417 nmdc:mga09592_261661_c1 3300050508 Bacteria 1500
418 nmdc:mga0qj67_384966_c1 3300050509 Bacteria 1132
419 nmdc:mga06r32_870143_c1 3300050510 Unclassified 859
420 nmdc:mga06r32_873659_c1 3300050510 Bacteria 857
421 nmdc:mga08y16_24388_c1 3300050511 Bacteria 5002
422 nmdc:mga0n895_365827_c1 3300050512 Bacteria 1460
423 nmdc:mga0n895_438158_c1 3300050512 Bacteria 1320
424 Ga0495601_0082249 3300053077 Bacteria 2067
425 Ga0495601_0106749 3300053077 Unclassified 1811
426 Ga0495601_0199016 3300053077 Unclassified 1309
427 Ga0495601_0204669 3300053077 Bacteria 1289
428 Ga0495601_0213435 3300053077 Bacteria 1261
429 Ga0495601_0248985 3300053077 Unclassified 1160
430 Ga0495601_0333369 3300053077 Bacteria 987
431 Ga0495601_0499264 3300053077 Bacteria 785
432 Ga0495612_0039586 3300053078 Bacteria 1918
433 Ga0495612_0343471 3300053078 Unclassified 673
434 Ga0495595_0009621 3300053084 Bacteria 4005
435 Ga0495595_0021844 3300053084 Bacteria 2801
436 Ga0495595_0114534 3300053084 Unclassified 1310
437 Ga0495619_0000917 3300053085 Bacteria 19345
438 Ga0495619_0040733 3300053085 Bacteria 3036
439 Ga0495619_0118979 3300053085 Archaea 1810
440 Ga0495619_0141252 3300053085 Bacteria 1658
441 Ga0495619_0244394 3300053085 Bacteria 1244
442 Ga0495619_0538461 3300053085 Unclassified 802
443 Ga0495619_0578783 3300053085 Bacteria 769
444 Ga0495619_1005030 3300053085 Bacteria 558
445 Ga0501084_0020693 3300054114 Bacteria 5487
446 Ga0501084_0188014 3300054114 Bacteria 1743
447 Ga0501084_0262418 3300054114 Bacteria 1458
448 Ga0501084_0274781 3300054114 Bacteria 1422
449 Ga0501084_0374580 3300054114 Bacteria 1203
450 Ga0501084_0808418 3300054114 Unclassified 789
451 Ga0501082_0013216 3300060353 Bacteria 7100
452 Ga0501082_0194457 3300060353 Bacteria 1764
453 Ga0501082_0236004 3300060353 Bacteria 1591
454 Ga0501082_0487697 3300060353 Bacteria 1077
455 Ga0501082_0549601 3300060353 Bacteria 1010
456 Ga0501082_1081101 3300060353 Bacteria 701
457 Ga0501082_1100840 3300060353 Bacteria 694
458 Ga0501082_1268204 3300060353 Bacteria 644
459 Ga0501082_1424778 3300060353 Unclassified 605
460 Ga0501082_1861395 3300060353 Bacteria 525
461 Ga0530510_0032806 3300061734 Bacteria 3737
462 Ga0530510_0153973 3300061734 Bacteria 1698
463 Ga0530510_0205269 3300061734 Bacteria 1464
464 Ga0530510_0402042 3300061734 Bacteria 1032
465 Ga0530510_0422285 3300061734 Bacteria 1006
466 Ga0530510_1599910 3300061734 Unclassified 500
467 2842337938 2842333319 Bacteria 8899485
468 Ga0501035_0973818
469 Ga0070670_100065375
470 Ga0070660_101617264
471 Ga0070689_102166446
472 Ga0070661_101809770
473 Ga0070668_100399179
474 Ga0070671_101101631
475 Ga0070659_100928371
476 Ga0070701_10938643
477 Ga0070663_100501105
478 Ga0070681_10244957
479 Ga0070681_10284458
480 Ga0070679_100010322
481 Ga0070684_100115230
482 Ga0068853_101435458
483 Ga0070665_101186169
484 Ga0068855_100961434
485 Ga0070664_100126861
486 Ga0068856_101062353
487 Ga0070702_100126075
488 Ga0068852_102492183
489 Ga0068859_101639635
490 Ga0068863_100227296
491 Ga0068863_100343980
492 Ga0068858_100231487
493 Ga0070717_10326435
494 Ga0075364_10534712
495 Ga0097621_100595039
496 Ga0068871_100464736
497 Ga0075428_100098391
498 Ga0075430_100530395
499 Ga0075431_100891675
500 Ga0075431_100911377
501 Ga0075434_100218283
502 Ga0075434_100657326
503 Ga0075429_100269128
504 Ga0068865_100841414
505 Ga0075435_100557748
506 Ga0111539_10122040
507 Ga0111539_11549081
508 Ga0105245_11402365
509 Ga0105247_10116790
510 Ga0114129_10009810
511 Ga0105243_11644050
512 Ga0105248_11690994
513 Ga0105238_11242990
514 Ga0105238_11461026
515 Ga0105249_10705511
516 Ga0105249_11380532
517 Ga0105239_10677402
518 Ga0105246_10468628
519 Ga0105246_10851569
520 Ga0157378_10764943
521 Ga0157378_12553482
522 Ga0163162_11394760
523 Ga0157375_10936449
524 Ga0163163_10026784
525 Ga0157380_11077545
526 Ga0182008_10201836
527 Ga0157379_10202496
528 Ga0157379_10389253
529 Ga0157376_10940335
530 Ga0207707_10239342
531 Ga0207707_10665864
532 Ga0207660_10232829
533 Ga0207649_11475797
534 Ga0207652_10484206
535 Ga0207650_10037763
536 Ga0207659_11687848
537 Ga0207690_10706691
538 Ga0207704_11275469
539 Ga0207679_10096884
540 Ga0207667_10753886
541 Ga0207712_11217542
542 Ga0207668_10734692
543 Ga0207678_10741321
544 Ga0207708_11036294
545 Ga0207702_11498383
546 Ga0207641_10352576
547 Ga0209974_10043961
548 Ga0268266_11196233
549 Ga0265337_1000205
550 Ga0265330_10154872
551 Ga0265332_10028035
552 Ga0265316_10051768
553 Ga0265316_11309027
554 Ga0316575_10106935
555 Ga0316579_10004686
556 Ga0307405_10863691
557 Ga0307413_12003458
558 Ga0316583_10005250
559 Ga0373958_0196494
560 Ga0373926_0061220
561 Ga0373926_0470558
562 Ga0373928_0175223
563 Ga0373934_0287626
564 Ga0373944_0062687
565 Ga0373923_0386465
566 Ga0373936_0099572
567 Ga0373936_0239994
568 Ga0373939_0001567
569 Ga0373945_0074201
570 Ga0373945_0076163
571 Ga0373954_0098219
572 Ga0373954_0267623
573 Ga0373954_0628810
574 Ga0373956_0418035
575 Ga0373957_0140700
576 Ga0373957_0244004
577 Ga0373943_0001708
578 Ga0373943_0314744
579 Ga0373943_0471155
580 Ga0373946_0106179
581 Ga0373946_0116869
582 Ga0373946_0661003
583 Ga0373955_0383409
584 Ga0373955_0442691
585 Ga0373955_0596793
586 Ga0373931_0010750
587 Ga0373935_0063592
588 Ga0373935_0348423
589 Ga0373935_1066777
590 Ga0373927_0004319
591 Ga0373927_0021399
592 Ga0373927_0063523
593 Ga0373927_0235023
594 Ga0373927_0815893
595 Ga0373933_0023992
596 Ga0373933_0172021
597 Ga0373933_0228672
598 Ga0373933_0252688
599 Ga0373933_0253011
600 Ga0373947_0002490
601 Ga0373947_0048932
602 Ga0373947_0079779
603 Ga0373947_0085535
604 Ga0373947_0386028
605 Ga0373937_0018289
606 Ga0373937_0120779
607 Ga0373937_0514135
608 Ga0373937_0621075
609 Ga0316582_0437464
610 Ga0316582_0490090
611 Ga0373925_0083471
612 Ga0373925_0151355
613 Ga0373925_0493018
614 Ga0439435_0243950
615 Ga0495592_0048224
616 Ga0495592_0118026
617 Ga0495592_0670933
618 Ga0495603_0038705
619 Ga0495629_0053738
620 Ga0495629_0163386
621 Ga0495629_0295245
622 Ga0495629_0506993
623 Ga0495629_0642925
624 Ga0495641_0032780
625 Ga0495641_0389725
626 Ga0495651_0019163
627 Ga0495651_0080797
628 Ga0495651_0228079
629 Ga0495651_0341609
630 Ga0495653_0073970
631 Ga0495653_0104418
632 Ga0495580_0224993
633 Ga0495580_0400343
634 Ga0495582_0134789
635 Ga0495639_0037422
636 Ga0495639_0755838
637 Ga0495662_0025703
638 Ga0495662_0216872
639 Ga0495662_0229825
640 Ga0495664_0015020
641 Ga0495594_0159927
642 Ga0495594_0362003
643 Ga0495594_0434529
644 Ga0495608_0094139
645 Ga0495608_0233826
646 Ga0495608_0611165
647 Ga0495618_0060389
648 Ga0495618_0417237
649 Ga0495628_0119073
650 Ga0495628_0733897
651 Ga0495630_0020029
652 Ga0495630_0128192
653 Ga0495630_0234221
654 Ga0495630_0453396
655 Ga0495666_0110723
656 Ga0495652_0036646
657 Ga0495652_0175508
658 Ga0495652_0256761
659 Ga0495652_0443096
660 Ga0495665_0067222
661 Ga0495665_0102852
662 Ga0495665_0137872
663 Ga0495665_0239422
664 Ga0495640_0139808
665 Ga0495640_0149074
666 Ga0495640_0165148
667 Ga0495640_0364930
668 Ga0495640_0382557
669 Ga0495587_0104654
670 Ga0495587_0155020
671 Ga0495645_0879963
672 Ga0495667_0039403
673 Ga0495667_0048872
674 Ga0495667_0494915
675 Ga0495634_0022183
676 Ga0495634_0133249
677 Ga0495634_0368342
678 Ga0495634_0437445
679 Ga0495635_0038459
680 Ga0495635_0116904
681 Ga0495635_0411818
682 Ga0495635_0655410
683 Ga0495588_0498460
684 Ga0495657_0223310
685 Ga0495657_0297423
686 Ga0495657_0443104
687 Ga0495599_0463699
688 Ga0495599_0636586
689 Ga0495599_0892522
690 Ga0495623_0210664
691 Ga0495647_0072586
692 Ga0495658_0575938
693 Ga0495613_0134304
694 Ga0495613_0138066
695 Ga0495613_0219226
696 Ga0495613_0373478
697 Ga0495613_0465402
698 Ga0495624_0007229
699 Ga0495624_0156243
700 Ga0495624_0175098
701 Ga0495624_0721107
702 Ga0495600_0119561
703 Ga0495600_0253299
704 Ga0495600_0601841
705 Ga0495581_0021594
706 Ga0495581_0145749
707 Ga0495581_0405883
708 Ga0495581_0503806
709 Ga0495604_0028662
710 Ga0495604_0242403
711 Ga0495604_0745424
712 Ga0495674_0018648
713 Ga0495674_0090749
714 Ga0495674_0791270
715 Ga0495676_0118195
716 Ga0495676_0229424
717 Ga0495676_0874333
718 Ga0495680_0125200
719 Ga0495680_0392133
720 Ga0495680_1018402
721 Ga0495675_0290058
722 Ga0495675_0835189
723 Ga0495684_0010024
724 Ga0495684_0047799
725 Ga0495684_0169229
726 Ga0495684_0240930
727 Ga0495684_0249567
728 Ga0495593_0163043
729 Ga0495593_0211505
730 Ga0495593_0408125
731 Ga0495593_0633265
732 Ga0495602_0005304
733 Ga0495602_0061925
734 Ga0495602_0279920
735 Ga0495602_0429069
736 Ga0495602_0737247
737 Ga0496100_0646557
738 Ga0496101_0215412
739 Ga0496101_0832476
740 Ga0496101_0955389
741 Ga0496102_0061657
742 Ga0496104_0000466
743 Ga0496104_0012115
744 Ga0496104_0690768
745 Ga0496105_0006501
746 Ga0496105_0019767
747 Ga0496106_0045664
748 Ga0496106_0624370
749 Ga0496107_0017606
750 Ga0496107_0061054
751 Ga0496107_0211397
752 Ga0496108_0049070
753 Ga0496108_0703062
754 Ga0496109_0001375
755 Ga0496109_1117263
756 Ga0496110_0005932
757 Ga0496111_0007035
758 Ga0496111_0751666
759 Ga0496112_0009659
760 Ga0496112_0402799
761 Ga0496113_0000087
762 Ga0496114_0391248
763 Ga0496115_0011519
764 Ga0496115_1112000
765 Ga0501031_0010954
766 Ga0501031_0125531
767 Ga0501032_0302366
768 Ga0501033_0006033
769 Ga0501033_0162942
770 Ga0501033_0242173
771 Ga0501034_0587070
772 Ga0501034_1552604
773 Ga0501036_0012230
774 Ga0501036_0405430
775 Ga0501037_0306311
776 Ga0501037_0710372
777 Ga0501038_0057075
778 Ga0501038_0182509
779 Ga0501039_0041467
780 Ga0501039_0055468
781 Ga0501039_0202249
782 Ga0501039_0365174
783 Ga0501039_0696686
784 Ga0501039_0718831
785 Ga0501040_0028716
786 Ga0501040_0204831
787 Ga0501040_1298804
788 Ga0501041_0014392
789 Ga0501041_0539550
790 Ga0501041_0611462
791 Ga0501042_0012249
792 Ga0501042_0079951
793 Ga0501042_0275992
794 Ga0501042_0290428
795 Ga0501042_0500616
796 Ga0501042_1061697
797 Ga0501043_0007750
798 Ga0501043_0169816
799 Ga0501043_0275683
800 Ga0501046_0027336
801 Ga0501046_0181195
802 Ga0501046_0219208
803 Ga0501046_0820482
804 Ga0501047_0106827
805 Ga0501047_0981052
806 Ga0501048_0020290
807 Ga0501048_0101630
808 Ga0501048_0874352
809 Ga0501068_0074046
810 Ga0501068_0074653
811 Ga0501068_0105788
812 Ga0501068_0330627
813 Ga0501068_0736640
814 Ga0501068_1100854
815 Ga0501069_0244014
816 Ga0501070_0675177
817 Ga0501070_0961880
818 Ga0501070_1134694
819 Ga0501070_1429049
820 Ga0501071_0016727
821 Ga0501072_0131321
822 Ga0501072_0198802
823 Ga0501072_0335395
824 Ga0501073_0003629
825 Ga0501073_0474653
826 Ga0501073_0491866
827 Ga0501074_0051875
828 Ga0501074_0075527
829 Ga0501074_0123719
830 Ga0501074_0349713
831 Ga0501074_0622225
832 Ga0501074_0874948
833 Ga0501075_0007031
834 Ga0501075_0167509
835 Ga0501075_0186931
836 Ga0501075_0705586
837 Ga0501075_1071489
838 Ga0501075_1087667
839 Ga0501075_1457304
840 Ga0501076_0046634
841 Ga0501076_0050852
842 Ga0501076_0056449
843 Ga0501076_0120752
844 Ga0501076_0124783
845 Ga0501076_0131880
846 Ga0501076_1783796
847 Ga0501077_0012914
848 Ga0501077_0053920
849 Ga0501077_0100234
850 Ga0501077_0129741
851 Ga0501077_0180860
852 Ga0501077_0306082
853 Ga0501079_0049777
854 Ga0501079_0057839
855 Ga0501079_0197860
856 Ga0501079_0217998
857 Ga0501079_0280757
858 Ga0501079_0688588
859 Ga0501080_0122071
860 Ga0501080_0237903
861 Ga0501080_0466282
862 Ga0501080_0977496
863 Ga0501080_1104610
864 Ga0501081_0029546
865 Ga0501081_0142053
866 Ga0501081_0200101
867 Ga0501081_0235104
868 Ga0501081_0631474
869 Ga0501081_0635910
870 Ga0501083_0014151
871 Ga0501083_0319308
872 Ga0501083_0566729
873 Ga0501083_0869404
874 Ga0501083_1074606
875 Ga0501035_0084672
876 Ga0501035_1016442
877 Ga0501044_0058673
878 Ga0501044_0639522
879 Ga0501045_0185471
880 Ga0501045_0196309
881 Ga0501045_0314853
882 Ga0501045_0357823
883 Ga0501045_1254771
884 nmdc:mga09592_261661_c1
885 nmdc:mga0qj67_384966_c1
886 nmdc:mga06r32_870143_c1
887 nmdc:mga06r32_873659_c1
888 nmdc:mga08y16_24388_c1
889 nmdc:mga0n895_365827_c1
890 nmdc:mga0n895_438158_c1
891 Ga0495601_0082249
892 Ga0495601_0106749
893 Ga0495601_0199016
894 Ga0495601_0204669
895 Ga0495601_0213435
896 Ga0495601_0248985
897 Ga0495601_0333369
898 Ga0495601_0499264
899 Ga0495612_0039586
900 Ga0495612_0343471
901 Ga0495595_0009621
902 Ga0495595_0021844
903 Ga0495595_0114534
904 Ga0495619_0000917
905 Ga0495619_0040733
906 Ga0495619_0118979
907 Ga0495619_0141252
908 Ga0495619_0244394
909 Ga0495619_0538461
910 Ga0495619_0578783
911 Ga0495619_1005030
912 Ga0501084_0020693
913 Ga0501084_0188014
914 Ga0501084_0262418
915 Ga0501084_0274781
916 Ga0501084_0374580
917 Ga0501084_0808418
918 Ga0501082_0013216
919 Ga0501082_0194457
920 Ga0501082_0236004
921 Ga0501082_0487697
922 Ga0501082_0549601
923 Ga0501082_1081101
924 Ga0501082_1100840
925 Ga0501082_1268204
926 Ga0501082_1424778
927 Ga0501082_1861395
928 Ga0530510_0032806
929 Ga0530510_0153973
930 Ga0530510_0205269
931 Ga0530510_0402042
932 Ga0530510_0422285
933 Ga0530510_1599910
934 2842337938

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00550

PP-binding

Phosphopantetheine attachment site

4

76

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lvt-assembly1.cif.gz_A solution structure of holo acyl carrier protein from thermotoga maritima 0.9162 5 81
2ehs-assembly1.cif.gz_A crystal structure of acyl carrier protein from aquifex aeolicus (form 1) 0.9137 5 79
4ihg-assembly1.cif.gz_G chasing acyl carrier protein through a catalytic cycle of lipid a production 0.9018 4 76
2x2b-assembly1.cif.gz_A-2 crystal structure of malonyl-acp (acyl carrier protein) from bacillus subtilis 0.898 4 77
2ehs-assembly1.cif.gz_A crystal structure of acyl carrier protein from aquifex aeolicus (form 1) 0.8916 5 79
ID Description Score Start End Superfamily
3gzmA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8946 6 77 1.10.1200.10
1f80E00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8859 4 77 1.10.1200.10
af_P0A6A8_1_78_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.883 4 78 1.10.1200.10
af_P9WQF3_1_115_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8816 5 78 1.10.1200.10
1f80D00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8751 3 76 1.10.1200.10
ID Description Score Start End GO Terms
AF-A0A3A0BR81-F1-model_v4 Phosphopantetheine-binding protein 0.9716 6 76
AF-A0A0Q7JTY2-F1-model_v4 Carrier domain-containing protein 0.968 6 78
AF-A0A4P7C653-F1-model_v4 deleted 0.966 6 76
AF-A0A349EEM1-F1-model_v4 Acyl carrier protein 0.9648 6 83
AF-A0A7C2Z0U5-F1-model_v4 Acyl carrier protein 0.9641 5 80

Map