F449838

General Info

Members Datasets Scaffolds Average Seq Length
467 218 934 404

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10277976|Ga0105240_102779762
Length 436
Sequence VKWADAAARRLPPPGHPEYRLAQRLDPVAEAPRMVNRSTVQAAIDAGSGVLRLEPAWVPRTFMLPGRRLKLHPDDLYALGAHRGGINERWFSSTTNADNGPGTPPDEGLSYVRLKNGNRLLLKEAVDAAGDLLIGSSVMQREGGWNLLCKFFDNMGPIPHHMHQNDADAARVGRRGKPEAYYFPPQYNQLDNDFPYTFMGLEPGTEKADVLRCLENWNKGDNGILFLSRAFRLQPGTGWQVNPGILHAPGSLVTYEPQVNSDVFAMFQSEVDGRIIDWSLLTKDVPPEHHRDLDYIVSMLDWDANVDPAFAKRNRVFPTPVRPVEETEAEGYRELWVCYGTPYYSAKELTVLPRRTVTVRDAAAYGLILTQGHGTFGPHHVSTPSMIRFGQMTEDELFVTDEAARAGVRIENASDSDPLVILKHFGPGNPDAPGRN

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
151 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
152 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
153 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
154 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
155 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
156 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
157 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
158 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
159 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
160 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
161 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
162 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
167 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
217 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.78
Nodule 0
Rhizoplane 2.78
Rhizosphere 94
Stem 0
Stem Tuber 0
Unclassified 4.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10277976 3300009093 Bacteria 1925
2 JGI24751J29686_10013630 3300002459 Unclassified 1677
3 JGI25406J46586_10004452 3300003203 Bacteria 6520
4 rootH2_10091272 3300003320 Bacteria 3369
5 Ga0065704_10097865 3300005289 Unclassified 2375
6 Ga0065712_10004085 3300005290 Bacteria 3643
7 Ga0065712_10069720 3300005290 Bacteria 6816
8 Ga0065712_10085241 3300005290 Bacteria 2709
9 Ga0065712_10119575 3300005290 Bacteria 1690
10 Ga0065715_10004954 3300005293 Bacteria 4972
11 Ga0065715_10006111 3300005293 Bacteria 5386
12 Ga0065715_10008144 3300005293 Bacteria 3063
13 Ga0065715_10126440 3300005293 Bacteria 2108
14 Ga0065715_10134347 3300005293 Bacteria 1956
15 Ga0065715_10170788 3300005293 Bacteria 1546
16 Ga0065707_10086701 3300005295 Bacteria 5345
17 Ga0065707_10102298 3300005295 Bacteria 2815
18 Ga0065707_10102434 3300005295 Bacteria 2806
19 Ga0065707_10105347 3300005295 Unclassified 2649
20 Ga0070676_10013585 3300005328 Bacteria 4464
21 Ga0070683_100049551 3300005329 Bacteria 3885
22 Ga0070683_100106636 3300005329 Bacteria 2642
23 Ga0070690_100004703 3300005330 Bacteria 7609
24 Ga0070690_100060356 3300005330 Bacteria 2440
25 Ga0070670_100001651 3300005331 Bacteria 18068
26 Ga0070670_100006651 3300005331 Bacteria 9797
27 Ga0070670_100020481 3300005331 Bacteria 5686
28 Ga0070670_100026832 3300005331 Bacteria 4955
29 Ga0070666_10037373 3300005335 Bacteria 3228
30 Ga0070680_100109080 3300005336 Bacteria 2303
31 Ga0068868_100002690 3300005338 Bacteria 12334
32 Ga0068868_100258399 3300005338 Bacteria 1468
33 Ga0070689_100038807 3300005340 Bacteria 3644
34 Ga0070689_100041158 3300005340 Bacteria 3546
35 Ga0070661_100012730 3300005344 Bacteria 5888
36 Ga0070669_100001018 3300005353 Bacteria 20415
37 Ga0070669_100088743 3300005353 Bacteria 2315
38 Ga0070675_100001252 3300005354 Bacteria 18549
39 Ga0070675_100013676 3300005354 Bacteria 6384
40 Ga0070671_100025047 3300005355 Bacteria 4891
41 Ga0070671_100050403 3300005355 Bacteria 3462
42 Ga0070674_100005200 3300005356 Bacteria 7482
43 Ga0070674_100027033 3300005356 Bacteria 3756
44 Ga0070673_100050738 3300005364 Bacteria 3245
45 Ga0070673_100067030 3300005364 Bacteria 2869
46 Ga0070688_100045010 3300005365 Bacteria 2725
47 Ga0070688_100069919 3300005365 Bacteria 2243
48 Ga0070659_100057109 3300005366 Bacteria 3077
49 Ga0070659_100267632 3300005366 Bacteria 1419
50 Ga0070667_100007773 3300005367 Bacteria 8888
51 Ga0070713_100102424 3300005436 Bacteria 2483
52 Ga0070710_10024341 3300005437 Bacteria 3193
53 Ga0070701_10001781 3300005438 Bacteria 8132
54 Ga0070701_10059699 3300005438 Bacteria 2006
55 Ga0070705_100023959 3300005440 Bacteria 3287
56 Ga0070705_100087346 3300005440 Bacteria 1933
57 Ga0070700_100018692 3300005441 Bacteria 3987
58 Ga0070700_100118570 3300005441 Bacteria 1770
59 Ga0070694_100015745 3300005444 Bacteria 4755
60 Ga0070694_100079916 3300005444 Bacteria 2271
61 Ga0070678_100117310 3300005456 Bacteria 2093
62 Ga0070662_100142625 3300005457 Bacteria 1858
63 Ga0070681_10132464 3300005458 Bacteria 2425
64 Ga0068867_100286111 3300005459 Bacteria 1353
65 Ga0070707_100058172 3300005468 Bacteria 3708
66 Ga0070707_100058667 3300005468 Bacteria 3691
67 Ga0070698_100078452 3300005471 Bacteria 3301
68 Ga0070699_100014189 3300005518 Bacteria 6855
69 Ga0070699_100024369 3300005518 Bacteria 5215
70 Ga0070699_100135782 3300005518 Bacteria 2170
71 Ga0070684_100001901 3300005535 Bacteria 15296
72 Ga0070684_100157843 3300005535 Bacteria 2057
73 Ga0070672_100036232 3300005543 Bacteria 3757
74 Ga0070686_100000920 3300005544 Bacteria 16994
75 Ga0070695_100002109 3300005545 Bacteria 11375
76 Ga0070695_100017200 3300005545 Bacteria 4384
77 Ga0070696_100031140 3300005546 Bacteria 3655
78 Ga0070693_100010279 3300005547 Bacteria 4685
79 Ga0070693_100015290 3300005547 Bacteria 3950
80 Ga0070693_100049004 3300005547 Bacteria 2408
81 Ga0070665_100003444 3300005548 Bacteria 16875
82 Ga0070665_100004736 3300005548 Bacteria 14161
83 Ga0070704_100002682 3300005549 Bacteria 10057
84 Ga0070704_100006254 3300005549 Bacteria 7005
85 Ga0068855_100021719 3300005563 Bacteria 7698
86 Ga0068855_100043268 3300005563 Bacteria 5335
87 Ga0070664_100038741 3300005564 Bacteria 4014
88 Ga0070664_100041340 3300005564 Bacteria 3890
89 Ga0070664_100107614 3300005564 Bacteria 2431
90 Ga0068857_100036724 3300005577 Bacteria 4341
91 Ga0068856_100124566 3300005614 Bacteria 2580
92 Ga0070702_100021973 3300005615 Bacteria 3366
93 Ga0068859_100000668 3300005617 Bacteria 34291
94 Ga0068859_100033269 3300005617 Bacteria 5177
95 Ga0068859_100108430 3300005617 Bacteria 2838
96 Ga0068859_100240928 3300005617 Bacteria 1898
97 Ga0068861_100010682 3300005719 Bacteria 6378
98 Ga0068861_100029713 3300005719 Bacteria 4000
99 Ga0068861_100194129 3300005719 Bacteria 1700
100 Ga0068863_100014096 3300005841 Bacteria 7700
101 Ga0068863_100268535 3300005841 Bacteria 1651
102 Ga0068858_100035150 3300005842 Bacteria 4648
103 Ga0068858_100252109 3300005842 Unclassified 1677
104 Ga0068862_100009293 3300005844 Bacteria 8137
105 Ga0068862_100023670 3300005844 Bacteria 5147
106 Ga0068862_100031911 3300005844 Bacteria 4450
107 Ga0068862_100047151 3300005844 Bacteria 3677
108 Ga0068862_100064361 3300005844 Bacteria 3156
109 Ga0081539_10004337 3300005985 Bacteria 15819
110 Ga0081539_10005197 3300005985 Bacteria 13506
111 Ga0081539_10007024 3300005985 Bacteria 10442
112 Ga0070717_10047863 3300006028 Bacteria 3505
113 Ga0075365_10028228 3300006038 Bacteria 3578
114 Ga0075365_10108666 3300006038 Bacteria 1904
115 Ga0075364_10004040 3300006051 Bacteria 8424
116 Ga0075362_10000899 3300006177 Bacteria 9022
117 Ga0075366_10041788 3300006195 Bacteria 2714
118 Ga0075366_10047755 3300006195 Bacteria 2538
119 Ga0097621_100000256 3300006237 Bacteria 35916
120 Ga0097621_100115296 3300006237 Bacteria 2274
121 Ga0075370_10004835 3300006353 Bacteria 6603
122 Ga0068871_100007588 3300006358 Bacteria 7755
123 Ga0068871_100085883 3300006358 Bacteria 2614
124 Ga0075428_100000769 3300006844 Bacteria 33377
125 Ga0075428_100018718 3300006844 Bacteria 7656
126 Ga0075428_100127659 3300006844 Bacteria 2767
127 Ga0075430_100003614 3300006846 Bacteria 12972
128 Ga0075430_100082008 3300006846 Bacteria 2702
129 Ga0075431_100013806 3300006847 Bacteria 8157
130 Ga0075431_100064795 3300006847 Bacteria 3773
131 Ga0075431_100124076 3300006847 Bacteria 2664
132 Ga0075433_10000693 3300006852 Bacteria 22964
133 Ga0075434_100000085 3300006871 Bacteria 50753
134 Ga0075434_100001816 3300006871 Bacteria 18436
135 Ga0075434_100002353 3300006871 Bacteria 16555
136 Ga0075434_100032983 3300006871 Bacteria 5108
137 Ga0075434_100057462 3300006871 Bacteria 3867
138 Ga0075434_100125005 3300006871 Bacteria 2590
139 Ga0075434_100132367 3300006871 Bacteria 2513
140 Ga0075429_100016903 3300006880 Bacteria 6313
141 Ga0075429_100158919 3300006880 Bacteria 1979
142 Ga0068865_100111240 3300006881 Bacteria 2021
143 Ga0075436_100000505 3300006914 Bacteria 25226
144 Ga0075436_100061947 3300006914 Bacteria 2585
145 Ga0097620_100000668 3300006931 Bacteria 34291
146 Ga0097620_100033269 3300006931 Bacteria 5177
147 Ga0097620_100108426 3300006931 Bacteria 2838
148 Ga0097620_100240930 3300006931 Bacteria 1898
149 Ga0075435_100000190 3300007076 Bacteria 36880
150 Ga0075435_100010951 3300007076 Bacteria 6647
151 Ga0075435_100020371 3300007076 Bacteria 5081
152 Ga0075435_100031731 3300007076 Bacteria 4166
153 Ga0075435_100150829 3300007076 Bacteria 1954
154 Ga0105240_10001297 3300009093 Bacteria 43202
155 Ga0105240_10077751 3300009093 Bacteria 4088
156 Ga0105240_10108665 3300009093 Bacteria 3360
157 Ga0105240_10110707 3300009093 Bacteria 3324
158 Ga0105240_10293069 3300009093 Bacteria 1864
159 Ga0111539_10000002 3300009094 Bacteria 983359
160 Ga0111539_10000364 3300009094 Bacteria 55762
161 Ga0111539_10000638 3300009094 Bacteria 45252
162 Ga0111539_10000927 3300009094 Bacteria 38364
163 Ga0111539_10047023 3300009094 Bacteria 5159
164 Ga0111539_10047897 3300009094 Bacteria 5107
165 Ga0111539_10049980 3300009094 Bacteria 4983
166 Ga0111539_10061206 3300009094 Bacteria 4460
167 Ga0111539_10134317 3300009094 Bacteria 2897
168 Ga0111539_10231104 3300009094 Bacteria 2153
169 Ga0111539_10335793 3300009094 Bacteria 1759
170 Ga0105245_10000814 3300009098 Bacteria 28399
171 Ga0105245_10002725 3300009098 Bacteria 15906
172 Ga0105247_10006677 3300009101 Bacteria 7123
173 Ga0114129_10000241 3300009147 Bacteria 61333
174 Ga0114129_10005288 3300009147 Bacteria 18214
175 Ga0114129_10005633 3300009147 Bacteria 17719
176 Ga0114129_10006362 3300009147 Bacteria 16743
177 Ga0114129_10008040 3300009147 Bacteria 15029
178 Ga0114129_10014132 3300009147 Bacteria 11373
179 Ga0114129_10023247 3300009147 Bacteria 8793
180 Ga0114129_10031666 3300009147 Bacteria 7476
181 Ga0114129_10055987 3300009147 Bacteria 5526
182 Ga0114129_10071176 3300009147 Bacteria 4849
183 Ga0114129_10081265 3300009147 Bacteria 4505
184 Ga0114129_10095330 3300009147 Bacteria 4121
185 Ga0114129_10126945 3300009147 Bacteria 3507
186 Ga0114129_10163297 3300009147 Bacteria 3041
187 Ga0114129_10372354 3300009147 Bacteria 1887
188 Ga0114129_10434931 3300009147 Bacteria 1723
189 Ga0105241_10275317 3300009174 Bacteria 1435
190 Ga0105242_10003495 3300009176 Bacteria 12210
191 Ga0105248_10009425 3300009177 Bacteria 10749
192 Ga0105248_10061804 3300009177 Bacteria 4206
193 Ga0105248_10075816 3300009177 Bacteria 3780
194 Ga0105248_10116919 3300009177 Bacteria 3007
195 Ga0105248_10225591 3300009177 Bacteria 2109
196 Ga0105237_10033225 3300009545 Bacteria 5226
197 Ga0105237_10064133 3300009545 Bacteria 3671
198 Ga0105237_10120210 3300009545 Bacteria 2621
199 Ga0105238_10094097 3300009551 Bacteria 2984
200 Ga0105249_10009175 3300009553 Bacteria 8648
201 Ga0105249_10042040 3300009553 Bacteria 4156
202 Ga0105249_10065051 3300009553 Bacteria 3354
203 Ga0105249_10082464 3300009553 Bacteria 2992
204 Ga0105239_10083133 3300010375 Bacteria 3525
205 Ga0105239_10282693 3300010375 Bacteria 1868
206 Ga0157373_10047990 3300013100 Bacteria 3045
207 Ga0157373_10092758 3300013100 Bacteria 2127
208 Ga0157370_10057817 3300013104 Bacteria 3686
209 Ga0157370_10112489 3300013104 Bacteria 2545
210 Ga0157369_10013033 3300013105 Bacteria 9418
211 Ga0157374_10010950 3300013296 Bacteria 7830
212 Ga0157374_10015392 3300013296 Bacteria 6708
213 Ga0157374_10044864 3300013296 Bacteria 4088
214 Ga0157374_10233213 3300013296 Bacteria 1808
215 Ga0157378_10000409 3300013297 Bacteria 42352
216 Ga0157378_10079421 3300013297 Bacteria 2962
217 Ga0157378_10421272 3300013297 Bacteria 1320
218 Ga0163162_10037614 3300013306 Bacteria 4830
219 Ga0163162_10225551 3300013306 Bacteria 2003
220 Ga0157375_10086949 3300013308 Bacteria 3178
221 Ga0157375_10286812 3300013308 Bacteria 1809
222 Ga0157375_10438189 3300013308 Bacteria 1472
223 Ga0163163_10011918 3300014325 Bacteria 7909
224 Ga0163163_10016058 3300014325 Bacteria 6943
225 Ga0163163_10044254 3300014325 Bacteria 4367
226 Ga0163163_10045847 3300014325 Bacteria 4293
227 Ga0163163_10211755 3300014325 Bacteria 1987
228 Ga0157380_10077158 3300014326 Bacteria 2714
229 Ga0157380_10292876 3300014326 Unclassified 1495
230 Ga0157377_10027618 3300014745 Bacteria 3049
231 Ga0157379_10073623 3300014968 Bacteria 3058
232 Ga0157376_10004347 3300014969 Bacteria 9852
233 Ga0209233_1006643 3300025261 Bacteria 3710
234 Ga0207697_10034118 3300025315 Bacteria 2083
235 Ga0207692_10046128 3300025898 Bacteria 2184
236 Ga0207680_10018462 3300025903 Bacteria 3708
237 Ga0207680_10023911 3300025903 Bacteria 3345
238 Ga0207647_10028116 3300025904 Bacteria 3657
239 Ga0207699_10119945 3300025906 Bacteria 1699
240 Ga0207645_10006359 3300025907 Bacteria 8486
241 Ga0207695_10061918 3300025913 Bacteria 3866
242 Ga0207695_10212233 3300025913 Bacteria 1846
243 Ga0207663_10116718 3300025916 Unclassified 1820
244 Ga0207662_10081339 3300025918 Bacteria 1977
245 Ga0207649_10007602 3300025920 Bacteria 5893
246 Ga0207649_10045006 3300025920 Bacteria 2704
247 Ga0207646_10044549 3300025922 Bacteria 3982
248 Ga0207646_10116843 3300025922 Bacteria 2396
249 Ga0207646_10160944 3300025922 Bacteria 2026
250 Ga0207681_10029086 3300025923 Bacteria 3584
251 Ga0207681_10120338 3300025923 Unclassified 1924
252 Ga0207694_10261671 3300025924 Bacteria 1417
253 Ga0207650_10009349 3300025925 Bacteria 6699
254 Ga0207650_10020838 3300025925 Bacteria 4629
255 Ga0207650_10075238 3300025925 Bacteria 2548
256 Ga0207650_10157174 3300025925 Bacteria 1799
257 Ga0207659_10001387 3300025926 Bacteria 14459
258 Ga0207659_10014613 3300025926 Bacteria 5068
259 Ga0207659_10020360 3300025926 Bacteria 4384
260 Ga0207659_10224326 3300025926 Bacteria 1513
261 Ga0207700_10055014 3300025928 Bacteria 2990
262 Ga0207700_10081580 3300025928 Bacteria 2526
263 Ga0207644_10056618 3300025931 Bacteria 2829
264 Ga0207690_10052198 3300025932 Bacteria 2738
265 Ga0207706_10126431 3300025933 Bacteria 2248
266 Ga0207706_10200842 3300025933 Bacteria 1748
267 Ga0207670_10027657 3300025936 Bacteria 3589
268 Ga0207670_10040258 3300025936 Bacteria 3067
269 Ga0207670_10139760 3300025936 Bacteria 1785
270 Ga0207669_10133701 3300025937 Unclassified 1709
271 Ga0207691_10011664 3300025940 Bacteria 8438
272 Ga0207691_10030423 3300025940 Bacteria 5044
273 Ga0207691_10051520 3300025940 Bacteria 3763
274 Ga0207711_10119202 3300025941 Bacteria 2354
275 Ga0207711_10146651 3300025941 Bacteria 2127
276 Ga0207711_10227196 3300025941 Bacteria 1709
277 Ga0207689_10055623 3300025942 Bacteria 3257
278 Ga0207689_10073775 3300025942 Bacteria 2804
279 Ga0207661_10139616 3300025944 Bacteria 2084
280 Ga0207679_10026258 3300025945 Bacteria 4014
281 Ga0207667_10018897 3300025949 Bacteria 7709
282 Ga0207667_10052549 3300025949 Bacteria 4291
283 Ga0207651_10017080 3300025960 Bacteria 4275
284 Ga0207712_10292559 3300025961 Bacteria 1333
285 Ga0207658_10246265 3300025986 Bacteria 1517
286 Ga0207677_10075427 3300026023 Bacteria 2397
287 Ga0207703_10086317 3300026035 Bacteria 2628
288 Ga0207678_10001280 3300026067 Bacteria 23216
289 Ga0207708_10023605 3300026075 Bacteria 4650
290 Ga0207708_10034763 3300026075 Bacteria 3834
291 Ga0207702_10209626 3300026078 Bacteria 1811
292 Ga0207641_10013659 3300026088 Bacteria 6662
293 Ga0207641_10050072 3300026088 Bacteria 3533
294 Ga0207648_10005314 3300026089 Bacteria 12990
295 Ga0207648_10075042 3300026089 Bacteria 2948
296 Ga0207676_10211336 3300026095 Bacteria 1721
297 Ga0207674_10396217 3300026116 Unclassified 1334
298 Ga0207675_100001571 3300026118 Bacteria 22840
299 Ga0207675_100028823 3300026118 Bacteria 5172
300 Ga0207675_100120699 3300026118 Bacteria 2480
301 Ga0207675_100127810 3300026118 Bacteria 2408
302 Ga0207675_100287273 3300026118 Bacteria 1599
303 Ga0207683_10139644 3300026121 Bacteria 2183
304 Ga0207428_10000026 3300027907 Bacteria 255539
305 Ga0207428_10000719 3300027907 Bacteria 38178
306 Ga0207428_10005738 3300027907 Bacteria 11528
307 Ga0207428_10016890 3300027907 Bacteria 6272
308 Ga0207428_10022492 3300027907 Bacteria 5319
309 Ga0268266_10016827 3300028379 Bacteria 6249
310 Ga0268266_10055790 3300028379 Bacteria 3397
311 Ga0268265_10132124 3300028380 Bacteria 2076
312 Ga0268264_10284079 3300028381 Unclassified 1551
313 Ga0268264_10353820 3300028381 Bacteria 1399
314 Ga0307408_100032661 3300031548 Bacteria 3630
315 Ga0265313_10004346 3300031595 Bacteria 10960
316 Ga0307413_10027377 3300031824 Bacteria 3158
317 Ga0307412_10126549 3300031911 Unclassified 1849
318 Ga0307416_100024029 3300032002 Bacteria 4438
319 Ga0307416_100063056 3300032002 Bacteria 3033
320 Ga0373930_0001743 3300034816 Bacteria 3297
321 Ga0373950_0003131 3300034818 Bacteria 2339
322 Ga0373958_0001989 3300034819 Bacteria 2815
323 Ga0373959_0001934 3300034820 Bacteria 3304
324 Ga0373929_0000638 3300035085 Bacteria 6766
325 Ga0373940_0000771 3300035088 Bacteria 5247
326 Ga0373951_0006075 3300035091 Bacteria 2775
327 Ga0373932_0000187 3300035112 Bacteria 17867
328 Ga0373939_0001435 3300035114 Bacteria 5773
329 Ga0373941_0000856 3300035115 Bacteria 6270
330 Ga0373957_0054269 3300035120 Bacteria 1539
331 Ga0373942_0001787 3300035207 Bacteria 5454
332 Ga0373961_0000779 3300035241 Bacteria 10942
333 Ga0373931_0008273 3300035691 Bacteria 4927
334 Ga0373935_0072627 3300035692 Bacteria 2222
335 Ga0373927_0012049 3300035695 Bacteria 5753
336 Ga0439445_0040620 3300042004 Bacteria 1235
337 Ga0439435_0009482 3300042436 Bacteria 2285
338 Ga0453684_0052487 3300044712 Bacteria 5330
339 Ga0453684_0288606 3300044712 Bacteria 1869
340 Ga0453684_0289428 3300044712 Bacteria 1866
341 Ga0451576_0010777 3300045051 Bacteria 10464
342 Ga0451576_0220555 3300045051 Bacteria 1980
343 Ga0495580_0055941 3300046472 Bacteria 2779
344 Ga0495628_0306006 3300046516 Unclassified 1176
345 Ga0495649_0047400 3300046694 Bacteria 2337
346 Ga0495674_0018600 3300047319 Bacteria 6467
347 Ga0495687_027082 3300047443 Bacteria 2687
348 Ga0495602_0167303 3300048088 Unclassified 1710
349 Ga0496101_0190671 3300048904 Bacteria 1582
350 Ga0496102_0013174 3300048905 Bacteria 7155
351 Ga0496102_0075201 3300048905 Bacteria 3105
352 Ga0496106_0042195 3300048909 Bacteria 3421
353 Ga0496106_0075205 3300048909 Bacteria 2587
354 Ga0496110_0001983 3300048913 Bacteria 15224
355 Ga0496112_0004686 3300048915 Bacteria 11637
356 Ga0496112_0046474 3300048915 Bacteria 4258
357 Ga0496112_0198407 3300048915 Bacteria 1967
358 Ga0496112_0232145 3300048915 Bacteria 1799
359 Ga0496114_0015764 3300048917 Bacteria 6082
360 Ga0496115_0043285 3300048918 Bacteria 3590
361 Ga0496115_0123373 3300048918 Bacteria 2132
362 Ga0496126_0000029 3300048929 Bacteria 389370
363 Ga0501297_004027 3300049520 Bacteria 1486
364 Ga0501033_0081152 3300049570 Bacteria 2379
365 Ga0501034_0057283 3300049571 Bacteria 3918
366 Ga0501034_0132443 3300049571 Unclassified 2476
367 Ga0501036_0128342 3300049572 Bacteria 2141
368 Ga0501038_0210242 3300049574 Bacteria 1557
369 Ga0501042_0020248 3300049578 Bacteria 4629
370 Ga0501047_0063442 3300049581 Bacteria 3564
371 Ga0501047_0145390 3300049581 Bacteria 2248
372 Ga0501070_0049908 3300049586 Bacteria 3474
373 Ga0501070_0090986 3300049586 Bacteria 2525
374 Ga0501071_0003748 3300049587 Bacteria 9541
375 Ga0501071_0016605 3300049587 Bacteria 5065
376 Ga0501071_0107587 3300049587 Bacteria 2059
377 Ga0501072_0006958 3300049588 Bacteria 8585
378 Ga0501072_0095380 3300049588 Bacteria 2364
379 Ga0501074_0070236 3300049590 Bacteria 2518
380 Ga0501075_0001896 3300049591 Bacteria 13800
381 Ga0501075_0014221 3300049591 Bacteria 5702
382 Ga0501075_0039050 3300049591 Bacteria 3552
383 Ga0501076_0002357 3300049592 Bacteria 12930
384 Ga0501076_0326740 3300049592 Bacteria 1258
385 Ga0501081_0109097 3300049743 Bacteria 1963
386 Ga0501035_0033732 3300049822 Bacteria 4653
387 Ga0501035_0143568 3300049822 Unclassified 2074
388 Ga0501044_0001343 3300049823 Bacteria 28914
389 Ga0501044_0002453 3300049823 Bacteria 21140
390 Ga0501044_0099061 3300049823 Unclassified 2934
391 Ga0501045_0110242 3300049824 Unclassified 2041
392 Ga0501045_0135552 3300049824 Unclassified 1830
393 nmdc:mga03683_3406_c1 3300050489 Bacteria 5125
394 nmdc:mga00v17_17869_c1 3300050491 Bacteria 4022
395 nmdc:mga0k408_45030_c1 3300050493 Bacteria 2546
396 nmdc:mga0k408_4848_c1 3300050493 Bacteria 7138
397 nmdc:mga06z11_33070_c1 3300050494 Bacteria 2527
398 nmdc:mga05p37_11698_c1 3300050507 Bacteria 10457
399 nmdc:mga05p37_17111_c1 3300050507 Bacteria 8747
400 nmdc:mga05p37_17625_c1 3300050507 Bacteria 8619
401 nmdc:mga05p37_18987_c1 3300050507 Bacteria 8313
402 nmdc:mga05p37_191168_c1 3300050507 Bacteria 2485
403 nmdc:mga05p37_28194_c1 3300050507 Bacteria 6846
404 nmdc:mga05p37_3269_c1 3300050507 Bacteria 17504
405 nmdc:mga05p37_3817_c1 3300050507 Bacteria 17624
406 nmdc:mga05p37_4431_c1 3300050507 Bacteria 16408
407 nmdc:mga05p37_46710_c1 3300050507 Bacteria 5323
408 nmdc:mga05p37_49905_c1 3300050507 Bacteria 5147
409 nmdc:mga05p37_533_c2 3300050507 Bacteria 23842
410 nmdc:mga05p37_55832_c1 3300050507 Bacteria 4862
411 nmdc:mga05p37_59376_c1 3300050507 Bacteria 4710
412 nmdc:mga09592_166169_c1 3300050508 Bacteria 1907
413 nmdc:mga09592_3715_c1 3300050508 Bacteria 12300
414 nmdc:mga09592_68022_c1 3300050508 Bacteria 3021
415 nmdc:mga09592_87179_c1 3300050508 Bacteria 2664
416 nmdc:mga0qj67_21380_c1 3300050509 Bacteria 4964
417 nmdc:mga0qj67_73208_c1 3300050509 Bacteria 2736
418 nmdc:mga0qj67_78094_c1 3300050509 Bacteria 2649
419 nmdc:mga06r32_153744_c1 3300050510 Bacteria 2280
420 nmdc:mga06r32_186594_c1 3300050510 Bacteria 2061
421 nmdc:mga06r32_188273_c1 3300050510 Bacteria 2051
422 nmdc:mga06r32_258536_c1 3300050510 Bacteria 1729
423 nmdc:mga06r32_394454_c1 3300050510 Bacteria 1366
424 nmdc:mga08y16_104970_c1 3300050511 Bacteria 2942
425 nmdc:mga08y16_212535_c1 3300050511 Unclassified 2003
426 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
427 nmdc:mga08y16_32913_c1 3300050511 Bacteria 5449
428 nmdc:mga08y16_331249_c1 3300050511 Bacteria 1566
429 nmdc:mga08y16_33217_c1 3300050511 Bacteria 5420
430 nmdc:mga08y16_5963_c1 3300050511 Bacteria 12779
431 nmdc:mga08y16_63907_c1 3300050511 Bacteria 3844
432 nmdc:mga08y16_72562_c1 3300050511 Bacteria 3587
433 nmdc:mga08y16_9538_c1 3300050511 Bacteria 10187
434 nmdc:mga0n895_113562_c1 3300050512 Bacteria 2726
435 nmdc:mga0n895_131307_c1 3300050512 Bacteria 2530
436 nmdc:mga0n895_142653_c1 3300050512 Bacteria 2424
437 nmdc:mga0n895_160571_c1 3300050512 Bacteria 2279
438 nmdc:mga0n895_203909_c1 3300050512 Bacteria 2008
439 nmdc:mga0n895_495_c1 3300050512 Bacteria 26696
440 nmdc:mga0n895_49_c1 3300050512 Bacteria 73512
441 nmdc:mga0n895_51659_c1 3300050512 Bacteria 4033
442 nmdc:mga0rr50_11455_c1 3300050513 Bacteria 5679
443 nmdc:mga0rr50_133787_c1 3300050513 Bacteria 1988
444 nmdc:mga0rr50_138645_c1 3300050513 Bacteria 1955
445 nmdc:mga0rr50_154205_c1 3300050513 Bacteria 1859
446 nmdc:mga0rr50_16_c1 3300050513 Bacteria 175739
447 nmdc:mga0rr50_5104_c1 3300050513 Bacteria 7791
448 nmdc:mga0rr50_63524_c1 3300050513 Bacteria 2789
449 nmdc:mga0rr50_74478_c1 3300050513 Bacteria 2599
450 nmdc:mga08x19_166917_c1 3300050514 Bacteria 1497
451 nmdc:mga08x19_20683_c1 3300050514 Bacteria 4054
452 nmdc:mga08x19_4241_c1 3300050514 Bacteria 8493
453 nmdc:mga08x19_435_c1 3300050514 Bacteria 28614
454 nmdc:mga08x19_7924_c1 3300050514 Bacteria 6312
455 nmdc:mga0a205_103082_c1 3300050515 Bacteria 2390
456 nmdc:mga0a205_210224_c1 3300050515 Bacteria 1834
457 nmdc:mga0a205_223795_c1 3300050515 Bacteria 1431
458 nmdc:mga0a205_2470_c1 3300050515 Bacteria 16295
459 nmdc:mga0a205_33526_c1 3300050515 Bacteria 3974
460 nmdc:mga0a205_54_c1 3300050515 Bacteria 62054
461 nmdc:mga0a205_79096_c1 3300050515 Bacteria 3177
462 nmdc:mga0a205_96784_c1 3300050515 Bacteria 2850
463 Ga0495619_0024484 3300053085 Bacteria 3872
464 Ga0501084_0041463 3300054114 Bacteria 3851
465 Ga0590071_000483 3300059421 Bacteria 11637
466 Ga0590075_001045 3300059424 Bacteria 7142
467 Ga0590077_000078 3300059426 Bacteria 24810
468 Ga0105240_10277976
469 JGI24751J29686_10013630
470 JGI25406J46586_10004452
471 rootH2_10091272
472 Ga0065704_10097865
473 Ga0065712_10004085
474 Ga0065712_10069720
475 Ga0065712_10085241
476 Ga0065712_10119575
477 Ga0065715_10004954
478 Ga0065715_10006111
479 Ga0065715_10008144
480 Ga0065715_10126440
481 Ga0065715_10134347
482 Ga0065715_10170788
483 Ga0065707_10086701
484 Ga0065707_10102298
485 Ga0065707_10102434
486 Ga0065707_10105347
487 Ga0070676_10013585
488 Ga0070683_100049551
489 Ga0070683_100106636
490 Ga0070690_100004703
491 Ga0070690_100060356
492 Ga0070670_100001651
493 Ga0070670_100006651
494 Ga0070670_100020481
495 Ga0070670_100026832
496 Ga0070666_10037373
497 Ga0070680_100109080
498 Ga0068868_100002690
499 Ga0068868_100258399
500 Ga0070689_100038807
501 Ga0070689_100041158
502 Ga0070661_100012730
503 Ga0070669_100001018
504 Ga0070669_100088743
505 Ga0070675_100001252
506 Ga0070675_100013676
507 Ga0070671_100025047
508 Ga0070671_100050403
509 Ga0070674_100005200
510 Ga0070674_100027033
511 Ga0070673_100050738
512 Ga0070673_100067030
513 Ga0070688_100045010
514 Ga0070688_100069919
515 Ga0070659_100057109
516 Ga0070659_100267632
517 Ga0070667_100007773
518 Ga0070713_100102424
519 Ga0070710_10024341
520 Ga0070701_10001781
521 Ga0070701_10059699
522 Ga0070705_100023959
523 Ga0070705_100087346
524 Ga0070700_100018692
525 Ga0070700_100118570
526 Ga0070694_100015745
527 Ga0070694_100079916
528 Ga0070678_100117310
529 Ga0070662_100142625
530 Ga0070681_10132464
531 Ga0068867_100286111
532 Ga0070707_100058172
533 Ga0070707_100058667
534 Ga0070698_100078452
535 Ga0070699_100014189
536 Ga0070699_100024369
537 Ga0070699_100135782
538 Ga0070684_100001901
539 Ga0070684_100157843
540 Ga0070672_100036232
541 Ga0070686_100000920
542 Ga0070695_100002109
543 Ga0070695_100017200
544 Ga0070696_100031140
545 Ga0070693_100010279
546 Ga0070693_100015290
547 Ga0070693_100049004
548 Ga0070665_100003444
549 Ga0070665_100004736
550 Ga0070704_100002682
551 Ga0070704_100006254
552 Ga0068855_100021719
553 Ga0068855_100043268
554 Ga0070664_100038741
555 Ga0070664_100041340
556 Ga0070664_100107614
557 Ga0068857_100036724
558 Ga0068856_100124566
559 Ga0070702_100021973
560 Ga0068859_100000668
561 Ga0068859_100033269
562 Ga0068859_100108430
563 Ga0068859_100240928
564 Ga0068861_100010682
565 Ga0068861_100029713
566 Ga0068861_100194129
567 Ga0068863_100014096
568 Ga0068863_100268535
569 Ga0068858_100035150
570 Ga0068858_100252109
571 Ga0068862_100009293
572 Ga0068862_100023670
573 Ga0068862_100031911
574 Ga0068862_100047151
575 Ga0068862_100064361
576 Ga0081539_10004337
577 Ga0081539_10005197
578 Ga0081539_10007024
579 Ga0070717_10047863
580 Ga0075365_10028228
581 Ga0075365_10108666
582 Ga0075364_10004040
583 Ga0075362_10000899
584 Ga0075366_10041788
585 Ga0075366_10047755
586 Ga0097621_100000256
587 Ga0097621_100115296
588 Ga0075370_10004835
589 Ga0068871_100007588
590 Ga0068871_100085883
591 Ga0075428_100000769
592 Ga0075428_100018718
593 Ga0075428_100127659
594 Ga0075430_100003614
595 Ga0075430_100082008
596 Ga0075431_100013806
597 Ga0075431_100064795
598 Ga0075431_100124076
599 Ga0075433_10000693
600 Ga0075434_100000085
601 Ga0075434_100001816
602 Ga0075434_100002353
603 Ga0075434_100032983
604 Ga0075434_100057462
605 Ga0075434_100125005
606 Ga0075434_100132367
607 Ga0075429_100016903
608 Ga0075429_100158919
609 Ga0068865_100111240
610 Ga0075436_100000505
611 Ga0075436_100061947
612 Ga0097620_100000668
613 Ga0097620_100033269
614 Ga0097620_100108426
615 Ga0097620_100240930
616 Ga0075435_100000190
617 Ga0075435_100010951
618 Ga0075435_100020371
619 Ga0075435_100031731
620 Ga0075435_100150829
621 Ga0105240_10001297
622 Ga0105240_10077751
623 Ga0105240_10108665
624 Ga0105240_10110707
625 Ga0105240_10293069
626 Ga0111539_10000002
627 Ga0111539_10000364
628 Ga0111539_10000638
629 Ga0111539_10000927
630 Ga0111539_10047023
631 Ga0111539_10047897
632 Ga0111539_10049980
633 Ga0111539_10061206
634 Ga0111539_10134317
635 Ga0111539_10231104
636 Ga0111539_10335793
637 Ga0105245_10000814
638 Ga0105245_10002725
639 Ga0105247_10006677
640 Ga0114129_10000241
641 Ga0114129_10005288
642 Ga0114129_10005633
643 Ga0114129_10006362
644 Ga0114129_10008040
645 Ga0114129_10014132
646 Ga0114129_10023247
647 Ga0114129_10031666
648 Ga0114129_10055987
649 Ga0114129_10071176
650 Ga0114129_10081265
651 Ga0114129_10095330
652 Ga0114129_10126945
653 Ga0114129_10163297
654 Ga0114129_10372354
655 Ga0114129_10434931
656 Ga0105241_10275317
657 Ga0105242_10003495
658 Ga0105248_10009425
659 Ga0105248_10061804
660 Ga0105248_10075816
661 Ga0105248_10116919
662 Ga0105248_10225591
663 Ga0105237_10033225
664 Ga0105237_10064133
665 Ga0105237_10120210
666 Ga0105238_10094097
667 Ga0105249_10009175
668 Ga0105249_10042040
669 Ga0105249_10065051
670 Ga0105249_10082464
671 Ga0105239_10083133
672 Ga0105239_10282693
673 Ga0157373_10047990
674 Ga0157373_10092758
675 Ga0157370_10057817
676 Ga0157370_10112489
677 Ga0157369_10013033
678 Ga0157374_10010950
679 Ga0157374_10015392
680 Ga0157374_10044864
681 Ga0157374_10233213
682 Ga0157378_10000409
683 Ga0157378_10079421
684 Ga0157378_10421272
685 Ga0163162_10037614
686 Ga0163162_10225551
687 Ga0157375_10086949
688 Ga0157375_10286812
689 Ga0157375_10438189
690 Ga0163163_10011918
691 Ga0163163_10016058
692 Ga0163163_10044254
693 Ga0163163_10045847
694 Ga0163163_10211755
695 Ga0157380_10077158
696 Ga0157380_10292876
697 Ga0157377_10027618
698 Ga0157379_10073623
699 Ga0157376_10004347
700 Ga0209233_1006643
701 Ga0207697_10034118
702 Ga0207692_10046128
703 Ga0207680_10018462
704 Ga0207680_10023911
705 Ga0207647_10028116
706 Ga0207699_10119945
707 Ga0207645_10006359
708 Ga0207695_10061918
709 Ga0207695_10212233
710 Ga0207663_10116718
711 Ga0207662_10081339
712 Ga0207649_10007602
713 Ga0207649_10045006
714 Ga0207646_10044549
715 Ga0207646_10116843
716 Ga0207646_10160944
717 Ga0207681_10029086
718 Ga0207681_10120338
719 Ga0207694_10261671
720 Ga0207650_10009349
721 Ga0207650_10020838
722 Ga0207650_10075238
723 Ga0207650_10157174
724 Ga0207659_10001387
725 Ga0207659_10014613
726 Ga0207659_10020360
727 Ga0207659_10224326
728 Ga0207700_10055014
729 Ga0207700_10081580
730 Ga0207644_10056618
731 Ga0207690_10052198
732 Ga0207706_10126431
733 Ga0207706_10200842
734 Ga0207670_10027657
735 Ga0207670_10040258
736 Ga0207670_10139760
737 Ga0207669_10133701
738 Ga0207691_10011664
739 Ga0207691_10030423
740 Ga0207691_10051520
741 Ga0207711_10119202
742 Ga0207711_10146651
743 Ga0207711_10227196
744 Ga0207689_10055623
745 Ga0207689_10073775
746 Ga0207661_10139616
747 Ga0207679_10026258
748 Ga0207667_10018897
749 Ga0207667_10052549
750 Ga0207651_10017080
751 Ga0207712_10292559
752 Ga0207658_10246265
753 Ga0207677_10075427
754 Ga0207703_10086317
755 Ga0207678_10001280
756 Ga0207708_10023605
757 Ga0207708_10034763
758 Ga0207702_10209626
759 Ga0207641_10013659
760 Ga0207641_10050072
761 Ga0207648_10005314
762 Ga0207648_10075042
763 Ga0207676_10211336
764 Ga0207674_10396217
765 Ga0207675_100001571
766 Ga0207675_100028823
767 Ga0207675_100120699
768 Ga0207675_100127810
769 Ga0207675_100287273
770 Ga0207683_10139644
771 Ga0207428_10000026
772 Ga0207428_10000719
773 Ga0207428_10005738
774 Ga0207428_10016890
775 Ga0207428_10022492
776 Ga0268266_10016827
777 Ga0268266_10055790
778 Ga0268265_10132124
779 Ga0268264_10284079
780 Ga0268264_10353820
781 Ga0307408_100032661
782 Ga0265313_10004346
783 Ga0307413_10027377
784 Ga0307412_10126549
785 Ga0307416_100024029
786 Ga0307416_100063056
787 Ga0373930_0001743
788 Ga0373950_0003131
789 Ga0373958_0001989
790 Ga0373959_0001934
791 Ga0373929_0000638
792 Ga0373940_0000771
793 Ga0373951_0006075
794 Ga0373932_0000187
795 Ga0373939_0001435
796 Ga0373941_0000856
797 Ga0373957_0054269
798 Ga0373942_0001787
799 Ga0373961_0000779
800 Ga0373931_0008273
801 Ga0373935_0072627
802 Ga0373927_0012049
803 Ga0439445_0040620
804 Ga0439435_0009482
805 Ga0453684_0052487
806 Ga0453684_0288606
807 Ga0453684_0289428
808 Ga0451576_0010777
809 Ga0451576_0220555
810 Ga0495580_0055941
811 Ga0495628_0306006
812 Ga0495649_0047400
813 Ga0495674_0018600
814 Ga0495687_027082
815 Ga0495602_0167303
816 Ga0496101_0190671
817 Ga0496102_0013174
818 Ga0496102_0075201
819 Ga0496106_0042195
820 Ga0496106_0075205
821 Ga0496110_0001983
822 Ga0496112_0004686
823 Ga0496112_0046474
824 Ga0496112_0198407
825 Ga0496112_0232145
826 Ga0496114_0015764
827 Ga0496115_0043285
828 Ga0496115_0123373
829 Ga0496126_0000029
830 Ga0501297_004027
831 Ga0501033_0081152
832 Ga0501034_0057283
833 Ga0501034_0132443
834 Ga0501036_0128342
835 Ga0501038_0210242
836 Ga0501042_0020248
837 Ga0501047_0063442
838 Ga0501047_0145390
839 Ga0501070_0049908
840 Ga0501070_0090986
841 Ga0501071_0003748
842 Ga0501071_0016605
843 Ga0501071_0107587
844 Ga0501072_0006958
845 Ga0501072_0095380
846 Ga0501074_0070236
847 Ga0501075_0001896
848 Ga0501075_0014221
849 Ga0501075_0039050
850 Ga0501076_0002357
851 Ga0501076_0326740
852 Ga0501081_0109097
853 Ga0501035_0033732
854 Ga0501035_0143568
855 Ga0501044_0001343
856 Ga0501044_0002453
857 Ga0501044_0099061
858 Ga0501045_0110242
859 Ga0501045_0135552
860 nmdc:mga03683_3406_c1
861 nmdc:mga00v17_17869_c1
862 nmdc:mga0k408_45030_c1
863 nmdc:mga0k408_4848_c1
864 nmdc:mga06z11_33070_c1
865 nmdc:mga05p37_11698_c1
866 nmdc:mga05p37_17111_c1
867 nmdc:mga05p37_17625_c1
868 nmdc:mga05p37_18987_c1
869 nmdc:mga05p37_191168_c1
870 nmdc:mga05p37_28194_c1
871 nmdc:mga05p37_3269_c1
872 nmdc:mga05p37_3817_c1
873 nmdc:mga05p37_4431_c1
874 nmdc:mga05p37_46710_c1
875 nmdc:mga05p37_49905_c1
876 nmdc:mga05p37_533_c2
877 nmdc:mga05p37_55832_c1
878 nmdc:mga05p37_59376_c1
879 nmdc:mga09592_166169_c1
880 nmdc:mga09592_3715_c1
881 nmdc:mga09592_68022_c1
882 nmdc:mga09592_87179_c1
883 nmdc:mga0qj67_21380_c1
884 nmdc:mga0qj67_73208_c1
885 nmdc:mga0qj67_78094_c1
886 nmdc:mga06r32_153744_c1
887 nmdc:mga06r32_186594_c1
888 nmdc:mga06r32_188273_c1
889 nmdc:mga06r32_258536_c1
890 nmdc:mga06r32_394454_c1
891 nmdc:mga08y16_104970_c1
892 nmdc:mga08y16_212535_c1
893 nmdc:mga08y16_2_c1
894 nmdc:mga08y16_32913_c1
895 nmdc:mga08y16_331249_c1
896 nmdc:mga08y16_33217_c1
897 nmdc:mga08y16_5963_c1
898 nmdc:mga08y16_63907_c1
899 nmdc:mga08y16_72562_c1
900 nmdc:mga08y16_9538_c1
901 nmdc:mga0n895_113562_c1
902 nmdc:mga0n895_131307_c1
903 nmdc:mga0n895_142653_c1
904 nmdc:mga0n895_160571_c1
905 nmdc:mga0n895_203909_c1
906 nmdc:mga0n895_495_c1
907 nmdc:mga0n895_49_c1
908 nmdc:mga0n895_51659_c1
909 nmdc:mga0rr50_11455_c1
910 nmdc:mga0rr50_133787_c1
911 nmdc:mga0rr50_138645_c1
912 nmdc:mga0rr50_154205_c1
913 nmdc:mga0rr50_16_c1
914 nmdc:mga0rr50_5104_c1
915 nmdc:mga0rr50_63524_c1
916 nmdc:mga0rr50_74478_c1
917 nmdc:mga08x19_166917_c1
918 nmdc:mga08x19_20683_c1
919 nmdc:mga08x19_4241_c1
920 nmdc:mga08x19_435_c1
921 nmdc:mga08x19_7924_c1
922 nmdc:mga0a205_103082_c1
923 nmdc:mga0a205_210224_c1
924 nmdc:mga0a205_223795_c1
925 nmdc:mga0a205_2470_c1
926 nmdc:mga0a205_33526_c1
927 nmdc:mga0a205_54_c1
928 nmdc:mga0a205_79096_c1
929 nmdc:mga0a205_96784_c1
930 Ga0495619_0024484
931 Ga0501084_0041463
932 Ga0590071_000483
933 Ga0590075_001045
934 Ga0590077_000078

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zx5-assembly1.cif.gz_A the structure of a putative mannosephosphate isomerase from archaeoglobus fulgidus 0.8171 17 394
1zx5-assembly1.cif.gz_A the structure of a putative mannosephosphate isomerase from archaeoglobus fulgidus 0.7948 17 394
2q1z-assembly1.cif.gz_B crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr 0.7923 297 391
1qwr-assembly2.cif.gz_B crystal structure analysis of the mannose 6-phosphate isomerase from bacillus subtilis 0.773 16 392
1qwr-assembly2.cif.gz_B crystal structure analysis of the mannose 6-phosphate isomerase from bacillus subtilis 0.7663 16 392
ID Description Score Start End Superfamily
1qwrB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8005 285 392 2.60.120.10
af_O43014_313_412_2.60.110.10 Mainly Beta;Sandwich;Thaumatin;Thaumatin 0.7808 299 394 2.60.110.10
1zx5A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7802 17 234 2.60.120.10
1qwrB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7761 285 392 2.60.120.10
af_Q4DN69_1_81_2.60.120.1030 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.7676 308 394 2.60.120.1030
ID Description Score Start End GO Terms
AF-A0A7C6DDU5-F1-model_v4 Uncharacterized protein 1.003 323 392
AF-A0A3N5X380-F1-model_v4 Uncharacterized protein 0.9914 308 397
AF-X1AHP1-F1-model_v4 Mannose-6-phosphate isomerase 0.9896 180 395
AF-X1J9C6-F1-model_v4 Mannose-6-phosphate isomerase 0.9836 144 268
AF-A0A359IVP9-F1-model_v4 deleted 0.9832 320 401

Map