F449783

General Info

Members Datasets Scaffolds Average Seq Length
467 297 934 164

Family's Representative Sequence

Representative Sequence 3300003659|JGI25404J52841_10021618|JGI25404J52841_100216182
Length 185
Sequence MILGMSLATFTMVHVFVSLIAIVTGLVVMFGMLSSRRMPGLTAIFLVFTILTSVTGFMFPFSGVTPGILIGILSLVLLAIACFARYGTKLDGAWRWIYALTALXSLYLNMFVLVIQSFLKVPALHALAPSXPPAEPPFAIAQGIVLVFFVLVIIAVIRRYRPVSAPEPVRRLSHPISFADQSTEL

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
91 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
151 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
152 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
163 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
164 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
165 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
166 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
178 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
184 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
188 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
189 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
190 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
191 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
192 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
198 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
199 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
200 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
224 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
251 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
252 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
253 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
263 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
264 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
265 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
266 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
267 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
268 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
269 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
270 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
271 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
272 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
273 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
274 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
275 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
276 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
277 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
278 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
279 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
280 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
281 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
282 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
283 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
284 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
285 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
286 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
287 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
288 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
289 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
290 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
291 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
292 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
293 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
294 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
295 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
296 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
297 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.72
Metatranscriptomes 0
Isolates 4.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.64
Nodule 1.28
Rhizoplane 5.35
Rhizosphere 77.09
Stem 0
Stem Tuber 0
Unclassified 3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10021618 3300003659 Bacteria 1392
2 JGI25404J52841_10001037 3300003659 Bacteria 4612
3 JGI25404J52841_10009351 3300003659 Bacteria 2096
4 Ga0070683_100079645 3300005329 Bacteria 3066
5 Ga0070683_100105814 3300005329 Bacteria 2652
6 Ga0070683_100178879 3300005329 Bacteria 2013
7 Ga0070670_100298825 3300005331 Bacteria 1408
8 Ga0070677_10100940 3300005333 Unclassified 1272
9 Ga0068869_100362633 3300005334 Bacteria 1184
10 Ga0070680_100183515 3300005336 Bacteria 1762
11 Ga0068868_100077402 3300005338 Bacteria 2660
12 Ga0068868_100513936 3300005338 Bacteria 1051
13 Ga0068868_100919739 3300005338 Bacteria 796
14 Ga0068868_100944761 3300005338 Bacteria 786
15 Ga0070660_100904184 3300005339 Unclassified 744
16 Ga0070687_100165343 3300005343 Bacteria 1312
17 Ga0070661_100241684 3300005344 Bacteria 1391
18 Ga0070668_100001298 3300005347 Bacteria 17865
19 Ga0070668_100008492 3300005347 Bacteria 7629
20 Ga0070668_100010579 3300005347 Bacteria 6863
21 Ga0070668_100230970 3300005347 Bacteria 1529
22 Ga0070668_101258509 3300005347 Bacteria 672
23 Ga0070669_100644828 3300005353 Bacteria 890
24 Ga0070669_100817519 3300005353 Bacteria 793
25 Ga0070675_100956734 3300005354 Bacteria 786
26 Ga0070671_100260556 3300005355 Bacteria 1474
27 Ga0070674_100210800 3300005356 Bacteria 1505
28 Ga0070674_100431073 3300005356 Bacteria 1084
29 Ga0070673_100027105 3300005364 Bacteria 4243
30 Ga0070673_100524649 3300005364 Bacteria 1074
31 Ga0070688_100207992 3300005365 Bacteria 1372
32 Ga0070667_100000209 3300005367 Bacteria 68634
33 Ga0070703_10278726 3300005406 Bacteria 689
34 Ga0070663_100116277 3300005455 Bacteria 2015
35 Ga0070663_100122877 3300005455 Bacteria 1963
36 Ga0070663_100484437 3300005455 Bacteria 1025
37 Ga0070678_100122613 3300005456 Bacteria 2052
38 Ga0070678_100152095 3300005456 Bacteria 1865
39 Ga0070678_100396070 3300005456 Bacteria 1198
40 Ga0070662_100875501 3300005457 Bacteria 766
41 Ga0070662_101261729 3300005457 Bacteria 636
42 Ga0068867_100984684 3300005459 Bacteria 764
43 Ga0070685_10317517 3300005466 Bacteria 1055
44 Ga0070707_100670392 3300005468 Bacteria 1000
45 Ga0070698_100717129 3300005471 Bacteria 943
46 Ga0070684_100078493 3300005535 Bacteria 2917
47 Ga0068853_100082992 3300005539 Bacteria 2807
48 Ga0068853_101504170 3300005539 Bacteria 652
49 Ga0070672_100399239 3300005543 Bacteria 1178
50 Ga0070693_100370813 3300005547 Bacteria 985
51 Ga0070693_101213168 3300005547 Bacteria 580
52 Ga0070665_100034724 3300005548 Bacteria 5072
53 Ga0070665_100332914 3300005548 Bacteria 1523
54 Ga0070665_100454621 3300005548 Bacteria 1290
55 Ga0068855_100146445 3300005563 Bacteria 2688
56 Ga0068855_100589786 3300005563 Bacteria 1200
57 Ga0070664_100418106 3300005564 Bacteria 1227
58 Ga0068857_100099011 3300005577 Bacteria 2615
59 Ga0068857_100872819 3300005577 Bacteria 862
60 Ga0068854_100169062 3300005578 Bacteria 1700
61 Ga0068856_100146092 3300005614 Bacteria 2372
62 Ga0068856_100557937 3300005614 Bacteria 1167
63 Ga0068856_100608191 3300005614 Bacteria 1114
64 Ga0068852_100041150 3300005616 Bacteria 3903
65 Ga0068852_100341654 3300005616 Unclassified 1459
66 Ga0068859_100339071 3300005617 Bacteria 1597
67 Ga0068859_100610559 3300005617 Bacteria 1184
68 Ga0068859_100779340 3300005617 Bacteria 1044
69 Ga0068864_100104648 3300005618 Bacteria 2514
70 Ga0068864_100110635 3300005618 Bacteria 2446
71 Ga0068866_10286613 3300005718 Bacteria 1023
72 Ga0068861_100181918 3300005719 Bacteria 1750
73 Ga0068861_100665467 3300005719 Bacteria 963
74 Ga0068851_10133593 3300005834 Bacteria 1344
75 Ga0068851_10147752 3300005834 Bacteria 1283
76 Ga0068870_10367195 3300005840 Bacteria 928
77 Ga0068870_10502306 3300005840 Bacteria 808
78 Ga0068863_100096097 3300005841 Bacteria 2813
79 Ga0068863_100533595 3300005841 Bacteria 1158
80 Ga0068863_100824653 3300005841 Bacteria 926
81 Ga0068858_100155495 3300005842 Bacteria 2151
82 Ga0068858_100182935 3300005842 Bacteria 1979
83 Ga0068860_100222622 3300005843 Bacteria 1832
84 Ga0068860_100307343 3300005843 Bacteria 1554
85 Ga0068862_100079179 3300005844 Bacteria 2848
86 Ga0068862_100221364 3300005844 Bacteria 1713
87 Ga0068862_100352569 3300005844 Bacteria 1366
88 Ga0068862_100400130 3300005844 Bacteria 1284
89 Ga0081538_10020887 3300005981 Bacteria 4803
90 Ga0081540_1000466 3300005983 Bacteria 40082
91 Ga0081540_1000739 3300005983 Bacteria 30091
92 Ga0081540_1002508 3300005983 Bacteria 14918
93 Ga0081540_1005962 3300005983 Bacteria 8984
94 Ga0075365_10044982 3300006038 Bacteria 2895
95 Ga0075365_10191933 3300006038 Bacteria 1430
96 Ga0075368_10193399 3300006042 Bacteria 860
97 Ga0075363_100107186 3300006048 Bacteria 1550
98 Ga0075364_10042821 3300006051 Bacteria 2942
99 Ga0075362_10212397 3300006177 Bacteria 944
100 Ga0075367_10392585 3300006178 Bacteria 877
101 Ga0075367_10417105 3300006178 Bacteria 850
102 Ga0075367_10636738 3300006178 Unclassified 678
103 Ga0075367_10782292 3300006178 Bacteria 608
104 Ga0075369_10226124 3300006186 Bacteria 866
105 Ga0097621_100042370 3300006237 Bacteria 3666
106 Ga0097621_100056659 3300006237 Unclassified 3202
107 Ga0075434_100075869 3300006871 Bacteria 3356
108 Ga0097620_100339087 3300006931 Bacteria 1597
109 Ga0097620_100610569 3300006931 Bacteria 1184
110 Ga0097620_100779318 3300006931 Bacteria 1044
111 Ga0075435_100077105 3300007076 Bacteria 2732
112 Ga0099795_10041722 3300007788 Bacteria 1635
113 Ga0105240_10168241 3300009093 Bacteria 2598
114 Ga0105240_11582358 3300009093 Bacteria 686
115 Ga0111539_10688003 3300009094 Bacteria 1190
116 Ga0105245_10019058 3300009098 Bacteria 6006
117 Ga0105245_10020018 3300009098 Bacteria 5866
118 Ga0105245_10783453 3300009098 Bacteria 991
119 Ga0105247_10078803 3300009101 Bacteria 2073
120 Ga0105247_10241361 3300009101 Bacteria 1231
121 Ga0105247_10302718 3300009101 Bacteria 1110
122 Ga0114129_10128927 3300009147 Bacteria 3476
123 Ga0105243_10265467 3300009148 Bacteria 1539
124 Ga0105243_10277931 3300009148 Bacteria 1507
125 Ga0105241_10085316 3300009174 Bacteria 2481
126 Ga0105242_10667678 3300009176 Bacteria 1013
127 Ga0105248_10332873 3300009177 Bacteria 1710
128 Ga0105248_10493564 3300009177 Unclassified 1380
129 Ga0105237_10094098 3300009545 Bacteria 2986
130 Ga0105237_10157814 3300009545 Bacteria 2266
131 Ga0105237_10270345 3300009545 Bacteria 1703
132 Ga0105237_10357751 3300009545 Bacteria 1464
133 Ga0105238_10032179 3300009551 Bacteria 5337
134 Ga0105238_10175108 3300009551 Bacteria 2122
135 Ga0105238_10238510 3300009551 Bacteria 1796
136 Ga0105249_10883257 3300009553 Bacteria 960
137 Ga0099796_10152698 3300010159 Bacteria 910
138 Ga0105239_10110145 3300010375 Bacteria 3052
139 Ga0105239_10142289 3300010375 Bacteria 2674
140 Ga0105239_10143443 3300010375 Bacteria 2662
141 Ga0105246_10125891 3300011119 Bacteria 1906
142 Ga0105246_10559677 3300011119 Bacteria 981
143 Ga0157347_1041621 3300012502 Bacteria 609
144 Ga0157369_10049954 3300013105 Bacteria 4532
145 Ga0157369_10070552 3300013105 Bacteria 3753
146 Ga0157374_10045886 3300013296 Bacteria 4045
147 Ga0157374_10105322 3300013296 Bacteria 2709
148 Ga0157374_10233043 3300013296 Bacteria 1809
149 Ga0157374_10298260 3300013296 Bacteria 1594
150 Ga0157374_11087576 3300013296 Bacteria 820
151 Ga0157378_10010713 3300013297 Bacteria 8015
152 Ga0157378_10068095 3300013297 Bacteria 3191
153 Ga0157378_10213447 3300013297 Bacteria 1831
154 Ga0157378_11435505 3300013297 Bacteria 734
155 Ga0163162_10000021 3300013306 Bacteria 214873
156 Ga0163162_10305442 3300013306 Bacteria 1723
157 Ga0163162_10491544 3300013306 Bacteria 1358
158 Ga0157372_10131446 3300013307 Bacteria 2880
159 Ga0157372_10711625 3300013307 Bacteria 1168
160 Ga0157375_10025217 3300013308 Bacteria 5520
161 Ga0157375_10143356 3300013308 Unclassified 2518
162 Ga0157375_10196063 3300013308 Bacteria 2175
163 Ga0163163_10432661 3300014325 Bacteria 1375
164 Ga0163163_12504520 3300014325 Bacteria 574
165 Ga0157380_10237343 3300014326 Bacteria 1641
166 Ga0157377_10136469 3300014745 Bacteria 1504
167 Ga0157379_10078706 3300014968 Bacteria 2953
168 Ga0157379_10273382 3300014968 Bacteria 1536
169 Ga0163161_10486647 3300017792 Bacteria 1003
170 Ga0213876_10055231 3300021384 Bacteria 2097
171 Ga0228598_1009226 3300024227 Bacteria 1981
172 Ga0209675_1000706 3300025291 Bacteria 22940
173 Ga0209758_1005449 3300025297 Bacteria 9793
174 Ga0207656_10099467 3300025321 Bacteria 1331
175 Ga0207710_10243363 3300025900 Bacteria 898
176 Ga0207688_10092468 3300025901 Bacteria 1738
177 Ga0207680_10189824 3300025903 Bacteria 1394
178 Ga0207685_10018341 3300025905 Bacteria 2283
179 Ga0207645_10192991 3300025907 Bacteria 1339
180 Ga0207643_10031142 3300025908 Bacteria 2972
181 Ga0207654_10005457 3300025911 Bacteria 6431
182 Ga0207654_10255824 3300025911 Bacteria 1175
183 Ga0207707_10032816 3300025912 Bacteria 4544
184 Ga0207695_10066747 3300025913 Bacteria 3693
185 Ga0207671_10189898 3300025914 Bacteria 1602
186 Ga0207671_10312779 3300025914 Bacteria 1242
187 Ga0207693_10023829 3300025915 Bacteria 4859
188 Ga0207663_11367184 3300025916 Bacteria 570
189 Ga0207662_10456494 3300025918 Bacteria 874
190 Ga0207657_10268298 3300025919 Bacteria 1357
191 Ga0207652_10198985 3300025921 Bacteria 1803
192 Ga0207681_10386200 3300025923 Bacteria 1128
193 Ga0207694_10001323 3300025924 Bacteria 21316
194 Ga0207694_10045344 3300025924 Bacteria 3396
195 Ga0207650_10318425 3300025925 Bacteria 1273
196 Ga0207650_10574445 3300025925 Bacteria 946
197 Ga0207659_10056940 3300025926 Bacteria 2801
198 Ga0207687_10009048 3300025927 Bacteria 6510
199 Ga0207687_10470624 3300025927 Bacteria 1045
200 Ga0207644_10134810 3300025931 Bacteria 1895
201 Ga0207706_10837542 3300025933 Bacteria 780
202 Ga0207709_10191397 3300025935 Bacteria 1453
203 Ga0207709_10207700 3300025935 Bacteria 1403
204 Ga0207669_10276078 3300025937 Bacteria 1265
205 Ga0207669_10291759 3300025937 Bacteria 1235
206 Ga0207691_10288871 3300025940 Bacteria 1410
207 Ga0207691_10343244 3300025940 Bacteria 1278
208 Ga0207711_10378681 3300025941 Bacteria 1313
209 Ga0207711_10602688 3300025941 Unclassified 1025
210 Ga0207689_10059806 3300025942 Bacteria 3134
211 Ga0207689_10144885 3300025942 Bacteria 1957
212 Ga0207689_10158925 3300025942 Bacteria 1863
213 Ga0207689_10196459 3300025942 Bacteria 1665
214 Ga0207689_10288204 3300025942 Bacteria 1360
215 Ga0207661_10000920 3300025944 Bacteria 19332
216 Ga0207661_10041585 3300025944 Bacteria 3619
217 Ga0207661_10053435 3300025944 Bacteria 3232
218 Ga0207679_11148411 3300025945 Bacteria 713
219 Ga0207667_10275988 3300025949 Bacteria 1718
220 Ga0207651_10062348 3300025960 Bacteria 2598
221 Ga0207651_10553810 3300025960 Bacteria 1000
222 Ga0207668_10164763 3300025972 Bacteria 1731
223 Ga0207668_10218633 3300025972 Bacteria 1528
224 Ga0207668_10676111 3300025972 Bacteria 905
225 Ga0207677_10022329 3300026023 Bacteria 3888
226 Ga0207677_10090278 3300026023 Bacteria 2226
227 Ga0207677_10192359 3300026023 Bacteria 1615
228 Ga0207677_10906782 3300026023 Bacteria 795
229 Ga0207703_10395342 3300026035 Bacteria 1281
230 Ga0207703_10745106 3300026035 Bacteria 933
231 Ga0207639_10029221 3300026041 Bacteria 4033
232 Ga0207639_10171500 3300026041 Bacteria 1838
233 Ga0207639_10342106 3300026041 Bacteria 1334
234 Ga0207639_11555307 3300026041 Bacteria 621
235 Ga0207678_10030019 3300026067 Bacteria 4746
236 Ga0207678_10041246 3300026067 Bacteria 4002
237 Ga0207678_10174628 3300026067 Bacteria 1835
238 Ga0207708_10389138 3300026075 Bacteria 1151
239 Ga0207702_10289098 3300026078 Bacteria 1552
240 Ga0207641_10014709 3300026088 Bacteria 6416
241 Ga0207641_10592742 3300026088 Bacteria 1084
242 Ga0207641_11644765 3300026088 Bacteria 644
243 Ga0207648_10279367 3300026089 Bacteria 1493
244 Ga0207676_10467714 3300026095 Bacteria 1192
245 Ga0207674_10543736 3300026116 Bacteria 1122
246 Ga0207675_100321312 3300026118 Bacteria 1511
247 Ga0207675_100603794 3300026118 Bacteria 1100
248 Ga0207675_100742259 3300026118 Bacteria 993
249 Ga0207683_10010223 3300026121 Bacteria 8003
250 Ga0207683_10213562 3300026121 Bacteria 1756
251 Ga0207683_10230301 3300026121 Bacteria 1690
252 Ga0207683_10426769 3300026121 Bacteria 1221
253 Ga0207698_10277811 3300026142 Bacteria 1547
254 Ga0207698_10421540 3300026142 Bacteria 1281
255 Ga0268266_10003810 3300028379 Bacteria 14752
256 Ga0268266_10008136 3300028379 Bacteria 9365
257 Ga0268265_10185703 3300028380 Bacteria 1790
258 Ga0268265_11190002 3300028380 Unclassified 759
259 Ga0268264_10045532 3300028381 Bacteria 3642
260 Ga0307515_10593185 3300028794 Bacteria 718
261 Ga0265338_10275573 3300028800 Unclassified 1231
262 Ga0307511_10135465 3300030521 Bacteria 1468
263 Ga0307509_10073298 3300031507 Bacteria 3565
264 Ga0307509_10644314 3300031507 Bacteria 729
265 Ga0265314_10194670 3300031711 Bacteria 1203
266 Ga0307416_100193824 3300032002 Bacteria 1920
267 Ga0307411_10358721 3300032005 Bacteria 1191
268 Ga0307415_100272598 3300032126 Bacteria 1387
269 Ga0373938_0061035 3300034957 Bacteria 882
270 Ga0373940_0190333 3300035088 Bacteria 671
271 Ga0373944_0019748 3300035089 Bacteria 1936
272 Ga0373923_0145007 3300035111 Bacteria 1075
273 Ga0373957_0260422 3300035120 Bacteria 731
274 Ga0373946_0035285 3300035171 Bacteria 2023
275 Ga0373935_0331436 3300035692 Bacteria 1082
276 Ga0373947_0041612 3300035725 Bacteria 2740
277 Ga0373937_1010619 3300036401 Bacteria 780
278 Ga0373925_0249819 3300037068 Bacteria 1422
279 Ga0436364_0756878 3300037853 Bacteria 630
280 Ga0436365_0001262 3300039437 Bacteria 2566
281 Ga0436365_0817421 3300039437 Bacteria 6063
282 Ga0451802_0218771 3300041460 Bacteria 1106
283 Ga0451837_0808043 3300041494 Bacteria 639
284 Ga0451839_0987747 3300041496 Bacteria 542
285 Ga0450916_006246 3300042530 Unclassified 1399
286 Ga0495617_082376 3300046452 Bacteria 1053
287 Ga0495617_155267 3300046452 Bacteria 727
288 Ga0495603_0010458 3300046455 Bacteria 5621
289 Ga0495603_0019598 3300046455 Bacteria 4095
290 Ga0495590_0082961 3300046457 Bacteria 1129
291 Ga0495629_0000835 3300046459 Bacteria 24987
292 Ga0495629_0051484 3300046459 Bacteria 2882
293 Ga0495638_0151688 3300046460 Bacteria 1344
294 Ga0495651_0264481 3300046462 Bacteria 1169
295 Ga0495653_0136358 3300046463 Bacteria 1731
296 Ga0495580_0424557 3300046472 Bacteria 894
297 Ga0495580_0453586 3300046472 Bacteria 860
298 Ga0495582_0003528 3300046473 Bacteria 8813
299 Ga0495605_0165918 3300046474 Bacteria 978
300 Ga0495605_0189000 3300046474 Bacteria 902
301 Ga0495639_0031790 3300046475 Bacteria 2351
302 Ga0495639_0040595 3300046475 Bacteria 2094
303 Ga0495584_0015503 3300046491 Bacteria 3883
304 Ga0495585_0048186 3300046492 Bacteria 2370
305 Ga0495585_0136302 3300046492 Bacteria 1288
306 Ga0495594_0077574 3300046499 Bacteria 1853
307 Ga0495594_0145971 3300046499 Bacteria 1342
308 Ga0495607_0344484 3300046501 Bacteria 689
309 Ga0495583_0194019 3300046506 Bacteria 827
310 Ga0495606_0318828 3300046507 Bacteria 836
311 Ga0495616_0257628 3300046513 Bacteria 747
312 Ga0495618_0315139 3300046514 Bacteria 970
313 Ga0495628_0098057 3300046516 Bacteria 2264
314 Ga0495630_0028890 3300046517 Bacteria 4121
315 Ga0495632_0301134 3300046519 Bacteria 711
316 Ga0495637_0046528 3300046520 Bacteria 1835
317 Ga0495643_0138039 3300046522 Bacteria 1218
318 Ga0495644_0007261 3300046523 Bacteria 4283
319 Ga0495663_0083289 3300046525 Bacteria 1033
320 Ga0495663_0207793 3300046525 Bacteria 685
321 Ga0495642_0039226 3300046528 Bacteria 1921
322 Ga0495642_0367547 3300046528 Bacteria 633
323 Ga0495652_0231190 3300046529 Bacteria 1383
324 Ga0495652_0320525 3300046529 Bacteria 1120
325 Ga0495665_0055922 3300046531 Bacteria 2083
326 Ga0495640_0092905 3300046533 Bacteria 1989
327 Ga0495587_0018875 3300046536 Bacteria 4275
328 Ga0495598_0061021 3300046537 Bacteria 1163
329 Ga0495609_0110692 3300046538 Bacteria 1185
330 Ga0495621_0009132 3300046539 Bacteria 3000
331 Ga0495622_0020237 3300046557 Bacteria 3099
332 Ga0495633_0109986 3300046558 Bacteria 1277
333 Ga0495633_0249231 3300046558 Bacteria 810
334 Ga0495667_0132092 3300046559 Bacteria 1610
335 Ga0495656_0000458 3300046615 Bacteria 13288
336 Ga0495656_0000521 3300046615 Bacteria 12544
337 Ga0495656_0125904 3300046615 Bacteria 1214
338 Ga0495668_0093180 3300046616 Bacteria 1650
339 Ga0495668_0726623 3300046616 Bacteria 549
340 Ga0495634_0020096 3300046642 Bacteria 4737
341 Ga0495611_0025905 3300046648 Bacteria 2557
342 Ga0495611_0278667 3300046648 Bacteria 772
343 Ga0495625_0126508 3300046660 Bacteria 1734
344 Ga0495635_0025649 3300046663 Bacteria 4107
345 Ga0495659_0025951 3300046664 Bacteria 2009
346 Ga0495659_0074205 3300046664 Bacteria 1279
347 Ga0495661_0161626 3300046665 Bacteria 1202
348 Ga0495588_0020268 3300046674 Bacteria 3265
349 Ga0495588_0116229 3300046674 Bacteria 1410
350 Ga0495599_0413664 3300046678 Bacteria 802
351 Ga0495647_0004946 3300046681 Bacteria 4364
352 Ga0495658_0005371 3300046683 Bacteria 6301
353 Ga0495658_0198558 3300046683 Bacteria 1249
354 Ga0495669_0037279 3300046684 Bacteria 2151
355 Ga0495670_0028632 3300046691 Bacteria 2761
356 Ga0495670_0032088 3300046691 Bacteria 2611
357 Ga0495660_0074516 3300046810 Bacteria 1793
358 Ga0495581_0002496 3300047315 Bacteria 10430
359 Ga0495581_0101467 3300047315 Bacteria 1672
360 Ga0495581_0411079 3300047315 Bacteria 789
361 Ga0495604_0278935 3300047317 Bacteria 1130
362 Ga0495604_0562599 3300047317 Unclassified 734
363 Ga0495636_0005223 3300047318 Bacteria 5094
364 Ga0495636_0017552 3300047318 Bacteria 2866
365 Ga0495636_0196228 3300047318 Bacteria 920
366 Ga0495674_0003648 3300047319 Bacteria 14985
367 Ga0495674_0837636 3300047319 Bacteria 713
368 Ga0495676_0086253 3300047321 Bacteria 2363
369 Ga0495676_0222975 3300047321 Bacteria 1298
370 Ga0495677_0114701 3300047445 Bacteria 1025
371 Ga0495673_0223025 3300047469 Bacteria 697
372 Ga0495673_0257915 3300047469 Bacteria 635
373 Ga0495684_0033226 3300047471 Bacteria 3959
374 Ga0495602_0519595 3300048088 Bacteria 829
375 Ga0495614_0035045 3300048089 Bacteria 2157
376 Ga0495614_0067735 3300048089 Bacteria 1537
377 Ga0496101_0700043 3300048904 Bacteria 800
378 Ga0496102_0075859 3300048905 Bacteria 3091
379 Ga0496102_1291763 3300048905 Bacteria 649
380 Ga0496103_0304620 3300048906 Unclassified 1025
381 Ga0496105_0139870 3300048908 Bacteria 1993
382 Ga0496106_0031484 3300048909 Bacteria 3953
383 Ga0496107_0243612 3300048910 Bacteria 1338
384 Ga0496108_0046571 3300048911 Bacteria 3623
385 Ga0496108_0110636 3300048911 Bacteria 2349
386 Ga0496108_0212783 3300048911 Bacteria 1678
387 Ga0496108_0560314 3300048911 Bacteria 997
388 Ga0496109_0076628 3300048912 Bacteria 3076
389 Ga0496109_0258761 3300048912 Bacteria 1639
390 Ga0496109_0354802 3300048912 Bacteria 1385
391 Ga0496110_0140122 3300048913 Bacteria 2186
392 Ga0496111_0035652 3300048914 Bacteria 3557
393 Ga0496111_0136310 3300048914 Bacteria 1818
394 Ga0496112_0206760 3300048915 Bacteria 1921
395 Ga0496112_0282886 3300048915 Bacteria 1605
396 Ga0496113_0098664 3300048916 Bacteria 2261
397 Ga0496113_0497975 3300048916 Bacteria 978
398 Ga0496114_0676407 3300048917 Bacteria 906
399 Ga0496115_0118226 3300048918 Bacteria 2180
400 Ga0496115_0415239 3300048918 Bacteria 1091
401 Ga0496118_0010350 3300048921 Bacteria 9242
402 Ga0496119_0081846 3300048922 Bacteria 1858
403 Ga0496121_0033120 3300048924 Bacteria 4683
404 Ga0496124_0117241 3300048927 Bacteria 2133
405 Ga0496125_0052445 3300048928 Bacteria 3354
406 Ga0496125_0407101 3300048928 Bacteria 793
407 Ga0496126_0340198 3300048929 Bacteria 1229
408 Ga0495682_0236471 3300049460 Bacteria 646
409 Ga0501046_0864382 3300049580 Bacteria 632
410 Ga0501076_0291226 3300049592 Bacteria 1338
411 Ga0501077_0089760 3300049593 Bacteria 1948
412 nmdc:mga03683_373803_c1 3300050489 Bacteria 677
413 nmdc:mga03n38_141411_c1 3300050490 Bacteria 1202
414 nmdc:mga03n38_198440_c1 3300050490 Bacteria 1037
415 nmdc:mga0yw44_63098_c1 3300050492 Bacteria 2277
416 nmdc:mga0yw44_952107_c1 3300050492 Bacteria 582
417 nmdc:mga0k408_411515_c1 3300050493 Bacteria 804
418 nmdc:mga0k408_616803_c1 3300050493 Bacteria 639
419 nmdc:mga06z11_273040_c1 3300050494 Bacteria 1000
420 nmdc:mga04h51_147149_c1 3300050495 Bacteria 898
421 nmdc:mga08y16_486819_c1 3300050511 Bacteria 1255
422 nmdc:mga0rr50_43291_c1 3300050513 Bacteria 3293
423 Ga0495655_0046628 3300053083 Bacteria 1130
424 Ga0495619_0006090 3300053085 Bacteria 7638
425 Ga0500578_0420598 3300053086 Bacteria 766
426 Ga0500581_209543 3300053089 Bacteria 857
427 Ga0500583_0059992 3300053092 Bacteria 1792
428 Ga0500583_0070209 3300053092 Bacteria 1674
429 Ga0500651_0011558 3300053093 Bacteria 5327
430 Ga0500651_0089171 3300053093 Bacteria 1901
431 Ga0500651_0469710 3300053093 Bacteria 697
432 Ga0500650_0263285 3300053098 Bacteria 770
433 Ga0500555_006889 3300053103 Unclassified 3231
434 Ga0500562_055654 3300053108 Bacteria 1060
435 Ga0500595_026663 3300053119 Bacteria 1989
436 Ga0500595_035320 3300053119 Bacteria 1646
437 Ga0500617_090001 3300053124 Bacteria 1315
438 Ga0500642_0073755 3300053130 Bacteria 1556
439 Ga0500658_0116388 3300053134 Bacteria 1181
440 Ga0500568_0056645 3300053139 Bacteria 1527
441 Ga0500588_0094662 3300053146 Bacteria 1021
442 Ga0500588_0112834 3300053146 Bacteria 950
443 Ga0500589_074720 3300053147 Bacteria 1526
444 Ga0500590_080959 3300053148 Bacteria 1595
445 Ga0500633_0139493 3300053160 Bacteria 907
446 Ga0500609_007666 3300053731 Bacteria 1458
447 Ga0500609_019451 3300053731 Bacteria 925
448 2513699367 2513237102 Bacteria 7703324
449 2513722493 2513237104 Bacteria 10034502
450 2723849038 2721755755 Bacteria 8322773
451 2824619525 2824617872 Bacteria 8814715
452 2824627980 2824626560 Bacteria 8813858
453 2824635976 2824635225 Bacteria 8785348
454 2824646272 2824644064 Bacteria 8743947
455 2824719758 2824714736 Bacteria 8717648
456 2824727582 2824723954 Bacteria 8758240
457 2824736883 2824732956 Bacteria 7810675
458 2857525238 2857524615 Bacteria 6615449
459 2876765867 2876761206 Bacteria 10111113
460 2881369790 2881364244 Bacteria 7710352
461 2881667129 2881665667 Bacteria 8175609
462 2893066572 2893066018 Bacteria 6158120
463 2919075100 2919073203 Bacteria 6531949
464 2919076639 2919073203 Bacteria 6531949
465 2922364733 2922361189 Bacteria 7436256
466 8006929492 8006926726 Bacteria 6749210
467 8056679194 8056673599 Bacteria 7871253
468 JGI25404J52841_10021618
469 JGI25404J52841_10001037
470 JGI25404J52841_10009351
471 Ga0070683_100079645
472 Ga0070683_100105814
473 Ga0070683_100178879
474 Ga0070670_100298825
475 Ga0070677_10100940
476 Ga0068869_100362633
477 Ga0070680_100183515
478 Ga0068868_100077402
479 Ga0068868_100513936
480 Ga0068868_100919739
481 Ga0068868_100944761
482 Ga0070660_100904184
483 Ga0070687_100165343
484 Ga0070661_100241684
485 Ga0070668_100001298
486 Ga0070668_100008492
487 Ga0070668_100010579
488 Ga0070668_100230970
489 Ga0070668_101258509
490 Ga0070669_100644828
491 Ga0070669_100817519
492 Ga0070675_100956734
493 Ga0070671_100260556
494 Ga0070674_100210800
495 Ga0070674_100431073
496 Ga0070673_100027105
497 Ga0070673_100524649
498 Ga0070688_100207992
499 Ga0070667_100000209
500 Ga0070703_10278726
501 Ga0070663_100116277
502 Ga0070663_100122877
503 Ga0070663_100484437
504 Ga0070678_100122613
505 Ga0070678_100152095
506 Ga0070678_100396070
507 Ga0070662_100875501
508 Ga0070662_101261729
509 Ga0068867_100984684
510 Ga0070685_10317517
511 Ga0070707_100670392
512 Ga0070698_100717129
513 Ga0070684_100078493
514 Ga0068853_100082992
515 Ga0068853_101504170
516 Ga0070672_100399239
517 Ga0070693_100370813
518 Ga0070693_101213168
519 Ga0070665_100034724
520 Ga0070665_100332914
521 Ga0070665_100454621
522 Ga0068855_100146445
523 Ga0068855_100589786
524 Ga0070664_100418106
525 Ga0068857_100099011
526 Ga0068857_100872819
527 Ga0068854_100169062
528 Ga0068856_100146092
529 Ga0068856_100557937
530 Ga0068856_100608191
531 Ga0068852_100041150
532 Ga0068852_100341654
533 Ga0068859_100339071
534 Ga0068859_100610559
535 Ga0068859_100779340
536 Ga0068864_100104648
537 Ga0068864_100110635
538 Ga0068866_10286613
539 Ga0068861_100181918
540 Ga0068861_100665467
541 Ga0068851_10133593
542 Ga0068851_10147752
543 Ga0068870_10367195
544 Ga0068870_10502306
545 Ga0068863_100096097
546 Ga0068863_100533595
547 Ga0068863_100824653
548 Ga0068858_100155495
549 Ga0068858_100182935
550 Ga0068860_100222622
551 Ga0068860_100307343
552 Ga0068862_100079179
553 Ga0068862_100221364
554 Ga0068862_100352569
555 Ga0068862_100400130
556 Ga0081538_10020887
557 Ga0081540_1000466
558 Ga0081540_1000739
559 Ga0081540_1002508
560 Ga0081540_1005962
561 Ga0075365_10044982
562 Ga0075365_10191933
563 Ga0075368_10193399
564 Ga0075363_100107186
565 Ga0075364_10042821
566 Ga0075362_10212397
567 Ga0075367_10392585
568 Ga0075367_10417105
569 Ga0075367_10636738
570 Ga0075367_10782292
571 Ga0075369_10226124
572 Ga0097621_100042370
573 Ga0097621_100056659
574 Ga0075434_100075869
575 Ga0097620_100339087
576 Ga0097620_100610569
577 Ga0097620_100779318
578 Ga0075435_100077105
579 Ga0099795_10041722
580 Ga0105240_10168241
581 Ga0105240_11582358
582 Ga0111539_10688003
583 Ga0105245_10019058
584 Ga0105245_10020018
585 Ga0105245_10783453
586 Ga0105247_10078803
587 Ga0105247_10241361
588 Ga0105247_10302718
589 Ga0114129_10128927
590 Ga0105243_10265467
591 Ga0105243_10277931
592 Ga0105241_10085316
593 Ga0105242_10667678
594 Ga0105248_10332873
595 Ga0105248_10493564
596 Ga0105237_10094098
597 Ga0105237_10157814
598 Ga0105237_10270345
599 Ga0105237_10357751
600 Ga0105238_10032179
601 Ga0105238_10175108
602 Ga0105238_10238510
603 Ga0105249_10883257
604 Ga0099796_10152698
605 Ga0105239_10110145
606 Ga0105239_10142289
607 Ga0105239_10143443
608 Ga0105246_10125891
609 Ga0105246_10559677
610 Ga0157347_1041621
611 Ga0157369_10049954
612 Ga0157369_10070552
613 Ga0157374_10045886
614 Ga0157374_10105322
615 Ga0157374_10233043
616 Ga0157374_10298260
617 Ga0157374_11087576
618 Ga0157378_10010713
619 Ga0157378_10068095
620 Ga0157378_10213447
621 Ga0157378_11435505
622 Ga0163162_10000021
623 Ga0163162_10305442
624 Ga0163162_10491544
625 Ga0157372_10131446
626 Ga0157372_10711625
627 Ga0157375_10025217
628 Ga0157375_10143356
629 Ga0157375_10196063
630 Ga0163163_10432661
631 Ga0163163_12504520
632 Ga0157380_10237343
633 Ga0157377_10136469
634 Ga0157379_10078706
635 Ga0157379_10273382
636 Ga0163161_10486647
637 Ga0213876_10055231
638 Ga0228598_1009226
639 Ga0209675_1000706
640 Ga0209758_1005449
641 Ga0207656_10099467
642 Ga0207710_10243363
643 Ga0207688_10092468
644 Ga0207680_10189824
645 Ga0207685_10018341
646 Ga0207645_10192991
647 Ga0207643_10031142
648 Ga0207654_10005457
649 Ga0207654_10255824
650 Ga0207707_10032816
651 Ga0207695_10066747
652 Ga0207671_10189898
653 Ga0207671_10312779
654 Ga0207693_10023829
655 Ga0207663_11367184
656 Ga0207662_10456494
657 Ga0207657_10268298
658 Ga0207652_10198985
659 Ga0207681_10386200
660 Ga0207694_10001323
661 Ga0207694_10045344
662 Ga0207650_10318425
663 Ga0207650_10574445
664 Ga0207659_10056940
665 Ga0207687_10009048
666 Ga0207687_10470624
667 Ga0207644_10134810
668 Ga0207706_10837542
669 Ga0207709_10191397
670 Ga0207709_10207700
671 Ga0207669_10276078
672 Ga0207669_10291759
673 Ga0207691_10288871
674 Ga0207691_10343244
675 Ga0207711_10378681
676 Ga0207711_10602688
677 Ga0207689_10059806
678 Ga0207689_10144885
679 Ga0207689_10158925
680 Ga0207689_10196459
681 Ga0207689_10288204
682 Ga0207661_10000920
683 Ga0207661_10041585
684 Ga0207661_10053435
685 Ga0207679_11148411
686 Ga0207667_10275988
687 Ga0207651_10062348
688 Ga0207651_10553810
689 Ga0207668_10164763
690 Ga0207668_10218633
691 Ga0207668_10676111
692 Ga0207677_10022329
693 Ga0207677_10090278
694 Ga0207677_10192359
695 Ga0207677_10906782
696 Ga0207703_10395342
697 Ga0207703_10745106
698 Ga0207639_10029221
699 Ga0207639_10171500
700 Ga0207639_10342106
701 Ga0207639_11555307
702 Ga0207678_10030019
703 Ga0207678_10041246
704 Ga0207678_10174628
705 Ga0207708_10389138
706 Ga0207702_10289098
707 Ga0207641_10014709
708 Ga0207641_10592742
709 Ga0207641_11644765
710 Ga0207648_10279367
711 Ga0207676_10467714
712 Ga0207674_10543736
713 Ga0207675_100321312
714 Ga0207675_100603794
715 Ga0207675_100742259
716 Ga0207683_10010223
717 Ga0207683_10213562
718 Ga0207683_10230301
719 Ga0207683_10426769
720 Ga0207698_10277811
721 Ga0207698_10421540
722 Ga0268266_10003810
723 Ga0268266_10008136
724 Ga0268265_10185703
725 Ga0268265_11190002
726 Ga0268264_10045532
727 Ga0307515_10593185
728 Ga0265338_10275573
729 Ga0307511_10135465
730 Ga0307509_10073298
731 Ga0307509_10644314
732 Ga0265314_10194670
733 Ga0307416_100193824
734 Ga0307411_10358721
735 Ga0307415_100272598
736 Ga0373938_0061035
737 Ga0373940_0190333
738 Ga0373944_0019748
739 Ga0373923_0145007
740 Ga0373957_0260422
741 Ga0373946_0035285
742 Ga0373935_0331436
743 Ga0373947_0041612
744 Ga0373937_1010619
745 Ga0373925_0249819
746 Ga0436364_0756878
747 Ga0436365_0001262
748 Ga0436365_0817421
749 Ga0451802_0218771
750 Ga0451837_0808043
751 Ga0451839_0987747
752 Ga0450916_006246
753 Ga0495617_082376
754 Ga0495617_155267
755 Ga0495603_0010458
756 Ga0495603_0019598
757 Ga0495590_0082961
758 Ga0495629_0000835
759 Ga0495629_0051484
760 Ga0495638_0151688
761 Ga0495651_0264481
762 Ga0495653_0136358
763 Ga0495580_0424557
764 Ga0495580_0453586
765 Ga0495582_0003528
766 Ga0495605_0165918
767 Ga0495605_0189000
768 Ga0495639_0031790
769 Ga0495639_0040595
770 Ga0495584_0015503
771 Ga0495585_0048186
772 Ga0495585_0136302
773 Ga0495594_0077574
774 Ga0495594_0145971
775 Ga0495607_0344484
776 Ga0495583_0194019
777 Ga0495606_0318828
778 Ga0495616_0257628
779 Ga0495618_0315139
780 Ga0495628_0098057
781 Ga0495630_0028890
782 Ga0495632_0301134
783 Ga0495637_0046528
784 Ga0495643_0138039
785 Ga0495644_0007261
786 Ga0495663_0083289
787 Ga0495663_0207793
788 Ga0495642_0039226
789 Ga0495642_0367547
790 Ga0495652_0231190
791 Ga0495652_0320525
792 Ga0495665_0055922
793 Ga0495640_0092905
794 Ga0495587_0018875
795 Ga0495598_0061021
796 Ga0495609_0110692
797 Ga0495621_0009132
798 Ga0495622_0020237
799 Ga0495633_0109986
800 Ga0495633_0249231
801 Ga0495667_0132092
802 Ga0495656_0000458
803 Ga0495656_0000521
804 Ga0495656_0125904
805 Ga0495668_0093180
806 Ga0495668_0726623
807 Ga0495634_0020096
808 Ga0495611_0025905
809 Ga0495611_0278667
810 Ga0495625_0126508
811 Ga0495635_0025649
812 Ga0495659_0025951
813 Ga0495659_0074205
814 Ga0495661_0161626
815 Ga0495588_0020268
816 Ga0495588_0116229
817 Ga0495599_0413664
818 Ga0495647_0004946
819 Ga0495658_0005371
820 Ga0495658_0198558
821 Ga0495669_0037279
822 Ga0495670_0028632
823 Ga0495670_0032088
824 Ga0495660_0074516
825 Ga0495581_0002496
826 Ga0495581_0101467
827 Ga0495581_0411079
828 Ga0495604_0278935
829 Ga0495604_0562599
830 Ga0495636_0005223
831 Ga0495636_0017552
832 Ga0495636_0196228
833 Ga0495674_0003648
834 Ga0495674_0837636
835 Ga0495676_0086253
836 Ga0495676_0222975
837 Ga0495677_0114701
838 Ga0495673_0223025
839 Ga0495673_0257915
840 Ga0495684_0033226
841 Ga0495602_0519595
842 Ga0495614_0035045
843 Ga0495614_0067735
844 Ga0496101_0700043
845 Ga0496102_0075859
846 Ga0496102_1291763
847 Ga0496103_0304620
848 Ga0496105_0139870
849 Ga0496106_0031484
850 Ga0496107_0243612
851 Ga0496108_0046571
852 Ga0496108_0110636
853 Ga0496108_0212783
854 Ga0496108_0560314
855 Ga0496109_0076628
856 Ga0496109_0258761
857 Ga0496109_0354802
858 Ga0496110_0140122
859 Ga0496111_0035652
860 Ga0496111_0136310
861 Ga0496112_0206760
862 Ga0496112_0282886
863 Ga0496113_0098664
864 Ga0496113_0497975
865 Ga0496114_0676407
866 Ga0496115_0118226
867 Ga0496115_0415239
868 Ga0496118_0010350
869 Ga0496119_0081846
870 Ga0496121_0033120
871 Ga0496124_0117241
872 Ga0496125_0052445
873 Ga0496125_0407101
874 Ga0496126_0340198
875 Ga0495682_0236471
876 Ga0501046_0864382
877 Ga0501076_0291226
878 Ga0501077_0089760
879 nmdc:mga03683_373803_c1
880 nmdc:mga03n38_141411_c1
881 nmdc:mga03n38_198440_c1
882 nmdc:mga0yw44_63098_c1
883 nmdc:mga0yw44_952107_c1
884 nmdc:mga0k408_411515_c1
885 nmdc:mga0k408_616803_c1
886 nmdc:mga06z11_273040_c1
887 nmdc:mga04h51_147149_c1
888 nmdc:mga08y16_486819_c1
889 nmdc:mga0rr50_43291_c1
890 Ga0495655_0046628
891 Ga0495619_0006090
892 Ga0500578_0420598
893 Ga0500581_209543
894 Ga0500583_0059992
895 Ga0500583_0070209
896 Ga0500651_0011558
897 Ga0500651_0089171
898 Ga0500651_0469710
899 Ga0500650_0263285
900 Ga0500555_006889
901 Ga0500562_055654
902 Ga0500595_026663
903 Ga0500595_035320
904 Ga0500617_090001
905 Ga0500642_0073755
906 Ga0500658_0116388
907 Ga0500568_0056645
908 Ga0500588_0094662
909 Ga0500588_0112834
910 Ga0500589_074720
911 Ga0500590_080959
912 Ga0500633_0139493
913 Ga0500609_007666
914 Ga0500609_019451
915 2513699367
916 2513722493
917 2723849038
918 2824619525
919 2824627980
920 2824635976
921 2824646272
922 2824719758
923 2824727582
924 2824736883
925 2857525238
926 2876765867
927 2881369790
928 2881667129
929 2893066572
930 2919075100
931 2919076639
932 2922364733
933 8006929492
934 8056679194

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xsj-assembly1.cif.gz_L xylfii-lytsn complex 0.5296 6 123
7ah0-assembly1.cif.gz_A crystal structure of the de novo designed two-heme binding protein, 4d2 0.5237 8 123
7ah0-assembly1.cif.gz_A crystal structure of the de novo designed two-heme binding protein, 4d2 0.5173 8 123
5xsj-assembly1.cif.gz_L xylfii-lytsn complex 0.5152 6 123
7w9l-assembly1.cif.gz_A cryo-em structure of human nav1.7(e406k)-beta1-beta2 complex 0.5068 16 130
ID Description Score Start End Superfamily
af_Q550K4_59_193_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5636 4 123 1.20.1070.10
af_Q9M363_194_379_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5547 3 159 1.20.120.1770
af_Q9M363_194_379_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.516 3 159 1.20.120.1770
af_Q5SSN7_36_155_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5154 18 129 1.20.1250.20
af_Q550K4_59_193_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5149 4 123 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A1Q8BAH7-F1-model_v4 Cupin type-1 domain-containing protein 0.9831 9 168 GO:0016020
AF-A0A1Q5SAN2-F1-model_v4 Membrane protein 0.9823 1 161 GO:0016020
AF-A0A437ME15-F1-model_v4 DUF2306 domain-containing protein 0.9762 1 163 GO:0016020
AF-A0A1Q5SAN2-F1-model_v4 Membrane protein 0.9762 1 161 GO:0016020
AF-A0A536WJN4-F1-model_v4 DUF2306 domain-containing protein 0.9758 1 168 GO:0016020

Map