F449745

General Info

Members Datasets Scaffolds Average Seq Length
466 172 932 361

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0057033|Ga0501033_0057033_814_1983
Length 389
Sequence MSQQRIRAVYMRGGTSRCLVFHEEDLPRSRTARDRILSAALGSPDPYGRQLDGLGGGISSLSKACIIGPPSHPDADVDYTFAQIDVKNPLVDYAGNCGNCSSAVGPFAIDEKLLVPSGNPAIVRIHNTNTHKRILAHVPVEDGEAAVTGEFELPGVAGRGARITLDFLEPGGAVTGRLLPTGRPRDIVGGLEASLVDATNPVVFVRARDLGLGGTETPSAIDADQDLAARLETIRVEAAARMGIADSPAVPKIALVAPAASFITLNGRAWGAETVDLLARVISMGNCHRAFALTSAMCLAVAARIEGTVVHECVTRDEEPRGATPYPGQAPHGLSRAGGSRSNDIRLGHPSGVLPIDASVVTQDGQPYAERVRVYRTARRLMEGFVRVP

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
124 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
125 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
126 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
132 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
133 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.43
Rhizosphere 99.57
Stem 0
Stem Tuber 0
Unclassified 6.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0057033 3300049570 Bacteria 2887
2 Ga0070676_10002899 3300005328 Bacteria 8856
3 Ga0070676_10032811 3300005328 Bacteria 2977
4 Ga0070690_100061065 3300005330 Bacteria 2427
5 Ga0070670_100010011 3300005331 Bacteria 8093
6 Ga0068869_100019058 3300005334 Bacteria 4681
7 Ga0068869_100027861 3300005334 Bacteria 3942
8 Ga0070680_100208076 3300005336 Bacteria 1650
9 Ga0070682_100003835 3300005337 Bacteria 8351
10 Ga0070660_100000428 3300005339 Bacteria 27846
11 Ga0070691_10003525 3300005341 Bacteria 7053
12 Ga0070691_10060224 3300005341 Bacteria 1825
13 Ga0070661_100026394 3300005344 Bacteria 4177
14 Ga0070692_10000843 3300005345 Bacteria 10308
15 Ga0070692_10143935 3300005345 Unclassified 1352
16 Ga0070668_100062913 3300005347 Bacteria 2876
17 Ga0070668_100271737 3300005347 Unclassified 1413
18 Ga0070669_100020620 3300005353 Bacteria 4707
19 Ga0070669_100039634 3300005353 Bacteria 3423
20 Ga0070673_100083514 3300005364 Bacteria 2595
21 Ga0070688_100149421 3300005365 Bacteria 1596
22 Ga0070667_100112542 3300005367 Bacteria 2361
23 Ga0070703_10012466 3300005406 Bacteria 2409
24 Ga0070701_10012465 3300005438 Bacteria 3836
25 Ga0070705_100000486 3300005440 Bacteria 22953
26 Ga0070705_100029702 3300005440 Bacteria 3011
27 Ga0070705_100064875 3300005440 Bacteria 2184
28 Ga0070700_100040809 3300005441 Bacteria 2843
29 Ga0070694_100003654 3300005444 Bacteria 9173
30 Ga0070694_100015749 3300005444 Bacteria 4755
31 Ga0070694_100021190 3300005444 Bacteria 4150
32 Ga0070694_100042331 3300005444 Bacteria 3042
33 Ga0070694_100046476 3300005444 Bacteria 2915
34 Ga0070708_100009667 3300005445 Bacteria 7781
35 Ga0070708_100010558 3300005445 Bacteria 7490
36 Ga0070708_100014716 3300005445 Bacteria 6445
37 Ga0070708_100025418 3300005445 Bacteria 5062
38 Ga0070708_100028884 3300005445 Bacteria 4776
39 Ga0070708_100056448 3300005445 Bacteria 3493
40 Ga0070708_100211383 3300005445 Bacteria 1818
41 Ga0070663_100005163 3300005455 Bacteria 7732
42 Ga0070662_100005109 3300005457 Bacteria 8364
43 Ga0070662_100174368 3300005457 Bacteria 1691
44 Ga0068867_100001647 3300005459 Bacteria 15517
45 Ga0070706_100011241 3300005467 Bacteria 8313
46 Ga0070706_100011578 3300005467 Bacteria 8196
47 Ga0070706_100012266 3300005467 Bacteria 7941
48 Ga0070706_100037304 3300005467 Bacteria 4489
49 Ga0070706_100046927 3300005467 Bacteria 3986
50 Ga0070706_100054580 3300005467 Bacteria 3688
51 Ga0070706_100102678 3300005467 Bacteria 2658
52 Ga0070707_100006174 3300005468 Bacteria 11160
53 Ga0070707_100012734 3300005468 Bacteria 7852
54 Ga0070707_100014949 3300005468 Bacteria 7284
55 Ga0070707_100088586 3300005468 Bacteria 2994
56 Ga0070707_100119596 3300005468 Bacteria 2557
57 Ga0070707_100196445 3300005468 Bacteria 1967
58 Ga0070707_100341480 3300005468 Bacteria 1455
59 Ga0070707_100348784 3300005468 Unclassified 1438
60 Ga0070698_100003277 3300005471 Bacteria 17785
61 Ga0070698_100008252 3300005471 Bacteria 11261
62 Ga0070698_100014432 3300005471 Bacteria 8343
63 Ga0070698_100334645 3300005471 Bacteria 1445
64 Ga0070699_100003409 3300005518 Bacteria 14064
65 Ga0070699_100012344 3300005518 Bacteria 7371
66 Ga0070699_100036864 3300005518 Bacteria 4230
67 Ga0070699_100056111 3300005518 Bacteria 3410
68 Ga0070699_100072249 3300005518 Bacteria 3001
69 Ga0070699_100153326 3300005518 Bacteria 2039
70 Ga0070699_100262740 3300005518 Unclassified 1544
71 Ga0070699_100272282 3300005518 Bacteria 1516
72 Ga0070699_100318929 3300005518 Bacteria 1396
73 Ga0070679_100000728 3300005530 Bacteria 28420
74 Ga0070684_100025347 3300005535 Bacteria 4984
75 Ga0070697_100009055 3300005536 Bacteria 7778
76 Ga0070697_100027744 3300005536 Bacteria 4531
77 Ga0070697_100043391 3300005536 Bacteria 3641
78 Ga0070697_100132518 3300005536 Bacteria 2091
79 Ga0070697_100139000 3300005536 Bacteria 2041
80 Ga0070697_100141743 3300005536 Bacteria 2022
81 Ga0068853_100001892 3300005539 Bacteria 15426
82 Ga0070672_100073580 3300005543 Bacteria 2723
83 Ga0070695_100000912 3300005545 Bacteria 15934
84 Ga0070695_100007176 3300005545 Bacteria 6606
85 Ga0070695_100010939 3300005545 Bacteria 5423
86 Ga0070695_100020693 3300005545 Bacteria 4018
87 Ga0070696_100000376 3300005546 Bacteria 27233
88 Ga0070696_100016944 3300005546 Bacteria 4915
89 Ga0070696_100020127 3300005546 Bacteria 4525
90 Ga0070693_100000088 3300005547 Bacteria 39090
91 Ga0070704_100037900 3300005549 Bacteria 3298
92 Ga0070704_100081045 3300005549 Bacteria 2389
93 Ga0070704_100145210 3300005549 Bacteria 1858
94 Ga0068855_100000612 3300005563 Bacteria 43896
95 Ga0068857_100066609 3300005577 Bacteria 3205
96 Ga0068857_100140967 3300005577 Bacteria 2179
97 Ga0068856_100000630 3300005614 Bacteria 38381
98 Ga0068859_100001750 3300005617 Bacteria 22092
99 Ga0068859_100107795 3300005617 Bacteria 2846
100 Ga0068864_100024718 3300005618 Bacteria 5054
101 Ga0068861_100024398 3300005719 Bacteria 4373
102 Ga0068861_100282688 3300005719 Bacteria 1429
103 Ga0068870_10000540 3300005840 Bacteria 14302
104 Ga0068863_100081800 3300005841 Bacteria 3059
105 Ga0068858_100046202 3300005842 Bacteria 4037
106 Ga0068860_100034948 3300005843 Bacteria 4822
107 Ga0068860_100146467 3300005843 Bacteria 2272
108 Ga0068860_100220581 3300005843 Unclassified 1841
109 Ga0068860_100222577 3300005843 Bacteria 1833
110 Ga0068862_100018411 3300005844 Bacteria 5816
111 Ga0068862_100087335 3300005844 Bacteria 2713
112 Ga0081455_10002129 3300005937 Bacteria 23609
113 Ga0081539_10000069 3300005985 Bacteria 236854
114 Ga0070716_100001751 3300006173 Bacteria 9807
115 Ga0075428_100000294 3300006844 Bacteria 48733
116 Ga0075428_100002417 3300006844 Bacteria 20296
117 Ga0075428_100015474 3300006844 Bacteria 8460
118 Ga0075428_100041037 3300006844 Bacteria 5089
119 Ga0075428_100060944 3300006844 Bacteria 4132
120 Ga0075428_100092527 3300006844 Bacteria 3297
121 Ga0075428_100101588 3300006844 Bacteria 3135
122 Ga0075430_100000221 3300006846 Bacteria 39261
123 Ga0075430_100000250 3300006846 Bacteria 37273
124 Ga0075430_100005329 3300006846 Bacteria 10857
125 Ga0075430_100013407 3300006846 Bacteria 6986
126 Ga0075430_100321830 3300006846 Bacteria 1278
127 Ga0075431_100000511 3300006847 Bacteria 32481
128 Ga0075431_100000900 3300006847 Bacteria 26186
129 Ga0075431_100001741 3300006847 Bacteria 20481
130 Ga0075431_100002819 3300006847 Bacteria 16825
131 Ga0075431_100004045 3300006847 Bacteria 14288
132 Ga0075431_100012028 3300006847 Bacteria 8733
133 Ga0075431_100018439 3300006847 Bacteria 7106
134 Ga0075431_100020181 3300006847 Bacteria 6806
135 Ga0075431_100081207 3300006847 Bacteria 3348
136 Ga0075431_100152544 3300006847 Unclassified 2379
137 Ga0075431_100279869 3300006847 Bacteria 1689
138 Ga0075431_100330676 3300006847 Bacteria 1535
139 Ga0075433_10000216 3300006852 Bacteria 32684
140 Ga0075433_10023114 3300006852 Bacteria 5229
141 Ga0075433_10030031 3300006852 Bacteria 4634
142 Ga0075433_10041773 3300006852 Bacteria 3975
143 Ga0075433_10075094 3300006852 Bacteria 2974
144 Ga0075434_100004497 3300006871 Bacteria 12579
145 Ga0075434_100010756 3300006871 Bacteria 8593
146 Ga0075434_100012251 3300006871 Bacteria 8126
147 Ga0075434_100037331 3300006871 Bacteria 4810
148 Ga0075434_100070672 3300006871 Bacteria 3481
149 Ga0075434_100083143 3300006871 Bacteria 3199
150 Ga0075434_100149551 3300006871 Bacteria 2355
151 Ga0075434_100194056 3300006871 Bacteria 2051
152 Ga0075429_100000021 3300006880 Bacteria 69066
153 Ga0075429_100002606 3300006880 Bacteria 15208
154 Ga0075429_100006862 3300006880 Bacteria 9882
155 Ga0075429_100007451 3300006880 Bacteria 9497
156 Ga0075429_100052258 3300006880 Bacteria 3555
157 Ga0075429_100208136 3300006880 Unclassified 1714
158 Ga0075436_100003935 3300006914 Bacteria 10182
159 Ga0075436_100028153 3300006914 Bacteria 3866
160 Ga0075436_100084231 3300006914 Bacteria 2207
161 Ga0097620_100001750 3300006931 Bacteria 22092
162 Ga0097620_100107791 3300006931 Bacteria 2846
163 Ga0075435_100001691 3300007076 Bacteria 14333
164 Ga0075435_100017999 3300007076 Bacteria 5359
165 Ga0075435_100032319 3300007076 Bacteria 4132
166 Ga0099794_10003381 3300007265 Bacteria 6079
167 Ga0099794_10019707 3300007265 Bacteria 3044
168 Ga0111539_10000916 3300009094 Bacteria 38556
169 Ga0111539_10002749 3300009094 Bacteria 23346
170 Ga0111539_10106358 3300009094 Bacteria 3291
171 Ga0111539_10149231 3300009094 Bacteria 2737
172 Ga0111539_10235848 3300009094 Unclassified 2130
173 Ga0105245_10108611 3300009098 Bacteria 2577
174 Ga0114129_10000002 3300009147 Bacteria 204413
175 Ga0114129_10000957 3300009147 Bacteria 37722
176 Ga0114129_10001066 3300009147 Bacteria 36022
177 Ga0114129_10003671 3300009147 Bacteria 21597
178 Ga0114129_10009027 3300009147 Bacteria 14213
179 Ga0114129_10011426 3300009147 Bacteria 12647
180 Ga0114129_10015342 3300009147 Bacteria 10901
181 Ga0114129_10032596 3300009147 Bacteria 7362
182 Ga0114129_10038991 3300009147 Bacteria 6697
183 Ga0114129_10052136 3300009147 Bacteria 5742
184 Ga0114129_10065647 3300009147 Bacteria 5064
185 Ga0114129_10071835 3300009147 Archaea 4825
186 Ga0114129_10075589 3300009147 Bacteria 4690
187 Ga0114129_10082878 3300009147 Bacteria 4456
188 Ga0114129_10223949 3300009147 Unclassified 2536
189 Ga0114129_10280178 3300009147 Bacteria 2228
190 Ga0114129_10372086 3300009147 Unclassified 1888
191 Ga0114129_10387142 3300009147 Bacteria 1845
192 Ga0114129_10521185 3300009147 Bacteria 1550
193 Ga0114129_10624607 3300009147 Unclassified 1393
194 Ga0105243_10069106 3300009148 Bacteria 2849
195 Ga0105243_10208208 3300009148 Bacteria 1720
196 Ga0105241_10002246 3300009174 Bacteria 14525
197 Ga0105242_10032083 3300009176 Bacteria 4199
198 Ga0105249_10053357 3300009553 Bacteria 3696
199 Ga0105249_10083166 3300009553 Bacteria 2979
200 Ga0105249_10122277 3300009553 Unclassified 2475
201 Ga0105249_10198863 3300009553 Bacteria 1960
202 Ga0157373_10000397 3300013100 Bacteria 34902
203 Ga0157369_10009860 3300013105 Bacteria 10913
204 Ga0157378_10177580 3300013297 Bacteria 2001
205 Ga0157378_10263910 3300013297 Bacteria 1654
206 Ga0163162_10075786 3300013306 Bacteria 3425
207 Ga0157372_10008050 3300013307 Bacteria 11210
208 Ga0163163_10040412 3300014325 Bacteria 4554
209 Ga0206353_11404692 3300020082 Bacteria 2012
210 Ga0207653_10014502 3300025885 Bacteria 2473
211 Ga0207642_10070141 3300025899 Unclassified 1664
212 Ga0207688_10017955 3300025901 Bacteria 3849
213 Ga0207645_10005940 3300025907 Bacteria 8796
214 Ga0207643_10000051 3300025908 Bacteria 77737
215 Ga0207684_10000931 3300025910 Bacteria 33094
216 Ga0207684_10002472 3300025910 Bacteria 18613
217 Ga0207684_10004324 3300025910 Bacteria 13433
218 Ga0207684_10005887 3300025910 Bacteria 11229
219 Ga0207684_10017534 3300025910 Bacteria 6141
220 Ga0207684_10031528 3300025910 Bacteria 4509
221 Ga0207684_10048866 3300025910 Bacteria 3589
222 Ga0207684_10067310 3300025910 Bacteria 3044
223 Ga0207684_10157362 3300025910 Unclassified 1956
224 Ga0207654_10001692 3300025911 Bacteria 11520
225 Ga0207707_10000078 3300025912 Bacteria 99871
226 Ga0207660_10001333 3300025917 Bacteria 16519
227 Ga0207660_10034696 3300025917 Bacteria 3497
228 Ga0207657_10000357 3300025919 Bacteria 48334
229 Ga0207652_10002085 3300025921 Bacteria 17189
230 Ga0207646_10001472 3300025922 Bacteria 29122
231 Ga0207646_10004024 3300025922 Bacteria 16253
232 Ga0207646_10021240 3300025922 Bacteria 6001
233 Ga0207646_10059148 3300025922 Bacteria 3423
234 Ga0207646_10093774 3300025922 Bacteria 2688
235 Ga0207646_10101344 3300025922 Bacteria 2581
236 Ga0207646_10184466 3300025922 Bacteria 1884
237 Ga0207650_10001516 3300025925 Bacteria 16604
238 Ga0207687_10067923 3300025927 Bacteria 2538
239 Ga0207690_10041537 3300025932 Bacteria 3014
240 Ga0207706_10010465 3300025933 Bacteria 8476
241 Ga0207706_10188841 3300025933 Bacteria 1809
242 Ga0207686_10038546 3300025934 Bacteria 2893
243 Ga0207709_10013765 3300025935 Bacteria 4464
244 Ga0207709_10081843 3300025935 Bacteria 2083
245 Ga0207709_10230644 3300025935 Unclassified 1341
246 Ga0207704_10158512 3300025938 Bacteria 1607
247 Ga0207665_10019415 3300025939 Bacteria 4468
248 Ga0207689_10000145 3300025942 Bacteria 61402
249 Ga0207689_10025450 3300025942 Bacteria 4960
250 Ga0207679_10004085 3300025945 Bacteria 9055
251 Ga0207667_10017407 3300025949 Bacteria 8089
252 Ga0207651_10107786 3300025960 Bacteria 2083
253 Ga0207712_10033477 3300025961 Bacteria 3475
254 Ga0207712_10036530 3300025961 Bacteria 3347
255 Ga0207712_10081457 3300025961 Bacteria 2357
256 Ga0207668_10040805 3300025972 Bacteria 3134
257 Ga0207640_10048983 3300025981 Bacteria 2734
258 Ga0207658_10082509 3300025986 Bacteria 2469
259 Ga0207639_10002065 3300026041 Bacteria 13547
260 Ga0207678_10002514 3300026067 Bacteria 16698
261 Ga0207708_10051878 3300026075 Bacteria 3124
262 Ga0207641_10163017 3300026088 Bacteria 2028
263 Ga0207648_10004325 3300026089 Bacteria 14627
264 Ga0207648_10026370 3300026089 Bacteria 5164
265 Ga0207648_10151868 3300026089 Bacteria 2043
266 Ga0207674_10000650 3300026116 Bacteria 45189
267 Ga0207674_10091692 3300026116 Bacteria 3028
268 Ga0207674_10150177 3300026116 Bacteria 2287
269 Ga0207674_10158561 3300026116 Unclassified 2218
270 Ga0207675_100040621 3300026118 Bacteria 4344
271 Ga0207675_100351611 3300026118 Bacteria 1444
272 Ga0209970_1002632 3300027614 Bacteria 3035
273 Ga0209588_1055385 3300027671 Bacteria 1282
274 Ga0209971_1000106 3300027682 Bacteria 24568
275 Ga0209966_1000237 3300027695 Bacteria 20663
276 Ga0209998_10000006 3300027717 Bacteria 101038
277 Ga0207428_10000068 3300027907 Bacteria 150215
278 Ga0207428_10078954 3300027907 Bacteria 2574
279 Ga0268265_10006651 3300028380 Bacteria 7822
280 Ga0268265_10095919 3300028380 Bacteria 2382
281 Ga0268264_10007605 3300028381 Bacteria 9033
282 Ga0268264_10159459 3300028381 Bacteria 2030
283 Ga0307408_100039465 3300031548 Bacteria 3338
284 Ga0307408_100060300 3300031548 Bacteria 2765
285 Ga0307408_100118498 3300031548 Unclassified 2047
286 Ga0307410_10119203 3300031852 Bacteria 1922
287 Ga0307416_100210211 3300032002 Bacteria 1855
288 Ga0373948_0010995 3300034817 Bacteria 1591
289 Ga0373959_0028483 3300034820 Bacteria 1115
290 Ga0373940_0004256 3300035088 Bacteria 3012
291 Ga0373940_0048577 3300035088 Bacteria 1186
292 Ga0373939_0011057 3300035114 Bacteria 2269
293 Ga0373931_0001875 3300035691 Bacteria 9181
294 Ga0373931_0003518 3300035691 Bacteria 7057
295 Ga0395900_0040813 3300037418 Bacteria 4783
296 Ga0395898_0005279 3300037466 Bacteria 13967
297 Ga0395901_0000511 3300038443 Bacteria 45007
298 Ga0395901_0055597 3300038443 Archaea 4117
299 Ga0439439_0012132 3300041406 Bacteria 2081
300 Ga0439464_0003588 3300042439 Bacteria 3931
301 Ga0439460_0000677 3300042461 Bacteria 7528
302 Ga0451577_0002547 3300042876 Bacteria 21528
303 Ga0451577_0017868 3300042876 Bacteria 6543
304 Ga0451577_0050159 3300042876 Bacteria 3726
305 Ga0451577_0055186 3300042876 Bacteria 3546
306 Ga0453683_0004001 3300044673 Bacteria 10650
307 Ga0453684_0002981 3300044712 Bacteria 39484
308 Ga0451576_0020243 3300045051 Bacteria 7247
309 Ga0451576_0026828 3300045051 Bacteria 6189
310 Ga0451576_0036177 3300045051 Bacteria 5235
311 Ga0451576_0078097 3300045051 Bacteria 3445
312 Ga0451576_0134199 3300045051 Bacteria 2581
313 Ga0451576_0196225 3300045051 Bacteria 2109
314 Ga0451576_0240886 3300045051 Bacteria 1890
315 Ga0495580_0000018 3300046472 Bacteria 92458
316 Ga0495584_0075767 3300046491 Bacteria 1692
317 Ga0495659_0038009 3300046664 Bacteria 1708
318 Ga0496102_0073351 3300048905 Bacteria 3146
319 Ga0496102_0132801 3300048905 Bacteria 2331
320 Ga0501036_0267730 3300049572 Unclassified 1431
321 Ga0501039_0207763 3300049575 Unclassified 1539
322 Ga0501039_0244562 3300049575 Bacteria 1411
323 Ga0501040_0003923 3300049576 Bacteria 9655
324 Ga0501040_0010043 3300049576 Bacteria 6183
325 Ga0501040_0024098 3300049576 Bacteria 4083
326 Ga0501040_0053428 3300049576 Bacteria 2767
327 Ga0501040_0163760 3300049576 Bacteria 1573
328 Ga0501041_0035595 3300049577 Bacteria 3017
329 Ga0501041_0149207 3300049577 Unclassified 1459
330 Ga0501041_0229889 3300049577 Unclassified 1164
331 Ga0501042_0004291 3300049578 Bacteria 9079
332 Ga0501042_0147385 3300049578 Bacteria 1697
333 Ga0501042_0246855 3300049578 Unclassified 1288
334 Ga0501042_0258889 3300049578 Unclassified 1256
335 Ga0501043_0058810 3300049579 Bacteria 3017
336 Ga0501046_0015493 3300049580 Bacteria 6403
337 Ga0501046_0016913 3300049580 Bacteria 6100
338 Ga0501046_0173179 3300049580 Unclassified 1618
339 Ga0501047_0079697 3300049581 Bacteria 3148
340 Ga0501048_0022367 3300049582 Bacteria 4624
341 Ga0501048_0139851 3300049582 Bacteria 1712
342 Ga0501048_0179576 3300049582 Bacteria 1500
343 Ga0501067_0008542 3300049583 Bacteria 5680
344 Ga0501072_0015447 3300049588 Bacteria 5853
345 Ga0501072_0088554 3300049588 Bacteria 2456
346 Ga0501072_0094003 3300049588 Bacteria 2382
347 Ga0501072_0260075 3300049588 Bacteria 1381
348 Ga0501072_0312730 3300049588 Bacteria 1248
349 Ga0501074_0130054 3300049590 Unclassified 1801
350 Ga0501075_0004416 3300049591 Bacteria 9513
351 Ga0501075_0012775 3300049591 Bacteria 5977
352 Ga0501075_0076186 3300049591 Bacteria 2537
353 Ga0501075_0147492 3300049591 Bacteria 1793
354 Ga0501076_0025358 3300049592 Bacteria 4588
355 Ga0501076_0063211 3300049592 Bacteria 2949
356 Ga0501076_0067499 3300049592 Bacteria 2856
357 Ga0501076_0105148 3300049592 Bacteria 2278
358 Ga0501076_0204039 3300049592 Bacteria 1615
359 Ga0501076_0278222 3300049592 Bacteria 1371
360 Ga0501077_0005642 3300049593 Bacteria 7627
361 Ga0501077_0020228 3300049593 Bacteria 4213
362 Ga0501077_0033466 3300049593 Bacteria 3271
363 Ga0501079_0009334 3300049741 Bacteria 7435
364 Ga0501079_0017208 3300049741 Bacteria 5519
365 Ga0501079_0054354 3300049741 Bacteria 3088
366 Ga0501080_0046214 3300049742 Bacteria 4055
367 Ga0501080_0120304 3300049742 Bacteria 2434
368 Ga0501081_0003512 3300049743 Bacteria 10026
369 Ga0501081_0034157 3300049743 Bacteria 3458
370 Ga0501081_0045633 3300049743 Bacteria 3009
371 Ga0501081_0071765 3300049743 Bacteria 2414
372 Ga0501081_0106942 3300049743 Bacteria 1984
373 Ga0501081_0214972 3300049743 Bacteria 1397
374 Ga0501045_0009969 3300049824 Bacteria 6646
375 Ga0501045_0044001 3300049824 Bacteria 3251
376 Ga0501045_0140076 3300049824 Bacteria 1799
377 Ga0501045_0149133 3300049824 Bacteria 1740
378 nmdc:mga05p37_11111_c1 3300050507 Bacteria 10700
379 nmdc:mga05p37_13766_c1 3300050507 Bacteria 9692
380 nmdc:mga05p37_14163_c1 3300050507 Bacteria 9572
381 nmdc:mga05p37_149117_c1 3300050507 Bacteria 2862
382 nmdc:mga05p37_15401_c1 3300050507 Bacteria 9187
383 nmdc:mga05p37_26463_c1 3300050507 Bacteria 7057
384 nmdc:mga05p37_29967_c1 3300050507 Bacteria 6640
385 nmdc:mga05p37_2_c1 3300050507 Bacteria 173421
386 nmdc:mga05p37_3218_c1 3300050507 Bacteria 19019
387 nmdc:mga05p37_359565_c1 3300050507 Unclassified 1712
388 nmdc:mga05p37_48362_c1 3300050507 Bacteria 5232
389 nmdc:mga05p37_5088_c1 3300050507 Bacteria 6691
390 nmdc:mga05p37_71315_c1 3300050507 Bacteria 4273
391 nmdc:mga05p37_73845_c1 3300050507 Bacteria 4197
392 nmdc:mga05p37_80481_c1 3300050507 Bacteria 4013
393 nmdc:mga05p37_85452_c1 3300050507 Bacteria 3888
394 nmdc:mga09592_114067_c1 3300050508 Bacteria 2319
395 nmdc:mga09592_13763_c1 3300050508 Bacteria 6610
396 nmdc:mga09592_20990_c1 3300050508 Bacteria 5378
397 nmdc:mga09592_2188_c1 3300050508 Bacteria 15752
398 nmdc:mga09592_3286_c1 3300050508 Bacteria 13092
399 nmdc:mga09592_5835_c1 3300050508 Bacteria 10041
400 nmdc:mga09592_651_c1 3300050508 Bacteria 26444
401 nmdc:mga09592_66576_c1 3300050508 Bacteria 3053
402 nmdc:mga09592_93428_c1 3300050508 Bacteria 2572
403 nmdc:mga0qj67_16852_c1 3300050509 Bacteria 5549
404 nmdc:mga0qj67_2210_c1 3300050509 Bacteria 13828
405 nmdc:mga0qj67_302840_c1 3300050509 Bacteria 1295
406 nmdc:mga0qj67_35187_c1 3300050509 Bacteria 3915
407 nmdc:mga0qj67_3681_c1 3300050509 Bacteria 11067
408 nmdc:mga0qj67_533_c1 3300050509 Bacteria 25864
409 nmdc:mga06r32_109_c1 3300050510 Bacteria 58480
410 nmdc:mga06r32_117664_c1 3300050510 Bacteria 2619
411 nmdc:mga06r32_120392_c1 3300050510 Bacteria 2588
412 nmdc:mga06r32_120_c1 3300050510 Bacteria 56649
413 nmdc:mga06r32_244289_c1 3300050510 Bacteria 1783
414 nmdc:mga06r32_406809_c1 3300050510 Bacteria 1343
415 nmdc:mga06r32_695_c1 3300050510 Bacteria 29349
416 nmdc:mga06r32_825_c1 3300050510 Bacteria 27452
417 nmdc:mga06r32_8609_c1 3300050510 Bacteria 9198
418 nmdc:mga06r32_88653_c1 3300050510 Bacteria 3020
419 nmdc:mga06r32_90947_c1 3300050510 Bacteria 2982
420 nmdc:mga08y16_1150_c1 3300050511 Bacteria 26070
421 nmdc:mga08y16_22729_c1 3300050511 Bacteria 6621
422 nmdc:mga08y16_93669_c1 3300050511 Bacteria 3129
423 nmdc:mga0n895_132072_c1 3300050512 Bacteria 2522
424 nmdc:mga0n895_156761_c1 3300050512 Bacteria 2308
425 nmdc:mga0n895_17981_c1 3300050512 Bacteria 6532
426 nmdc:mga0n895_249057_c1 3300050512 Bacteria 1803
427 nmdc:mga0n895_25287_c1 3300050512 Bacteria 5608
428 nmdc:mga0n895_25622_c1 3300050512 Bacteria 5575
429 nmdc:mga0n895_3061_c1 3300050512 Bacteria 13291
430 nmdc:mga0n895_53615_c1 3300050512 Bacteria 3963
431 nmdc:mga0n895_7285_c1 3300050512 Bacteria 9480
432 nmdc:mga0n895_74004_c1 3300050512 Bacteria 3383
433 nmdc:mga0rr50_212688_c1 3300050513 Bacteria 1594
434 nmdc:mga0rr50_319405_c1 3300050513 Bacteria 1302
435 nmdc:mga0rr50_5057_c1 3300050513 Bacteria 7820
436 nmdc:mga0rr50_81770_c1 3300050513 Bacteria 2494
437 nmdc:mga08x19_119603_c1 3300050514 Bacteria 1765
438 nmdc:mga08x19_156539_c1 3300050514 Unclassified 1546
439 nmdc:mga08x19_54737_c1 3300050514 Bacteria 2569
440 nmdc:mga0a205_106764_c1 3300050515 Bacteria 2698
441 nmdc:mga0a205_12361_c1 3300050515 Bacteria 7897
442 nmdc:mga0a205_210_c1 3300050515 Bacteria 40986
443 nmdc:mga0a205_253519_c1 3300050515 Bacteria 1639
444 nmdc:mga0a205_28683_c1 3300050515 Bacteria 5323
445 nmdc:mga0a205_56665_c1 3300050515 Bacteria 3783
446 nmdc:mga0a205_83834_c1 3300050515 Bacteria 3079
447 nmdc:mga0a205_99294_c1 3300050515 Bacteria 2809
448 Ga0501084_0013198 3300054114 Bacteria 6835
449 Ga0501084_0025671 3300054114 Bacteria 4913
450 Ga0501084_0070387 3300054114 Bacteria 2929
451 Ga0501084_0084416 3300054114 Bacteria 2666
452 Ga0501084_0147318 3300054114 Bacteria 1983
453 Ga0501084_0210990 3300054114 Unclassified 1638
454 Ga0501084_0237079 3300054114 Bacteria 1540
455 Ga0501082_0008877 3300060353 Bacteria 8670
456 Ga0501082_0021287 3300060353 Bacteria 5594
457 Ga0501082_0218472 3300060353 Bacteria 1658
458 Ga0501082_0255905 3300060353 Bacteria 1523
459 Ga0530510_0002225 3300061734 Bacteria 13310
460 Ga0530510_0009680 3300061734 Bacteria 6762
461 Ga0530510_0013367 3300061734 Bacteria 5771
462 Ga0530510_0025702 3300061734 Bacteria 4211
463 Ga0530510_0033841 3300061734 Bacteria 3679
464 Ga0530510_0088123 3300061734 Bacteria 2262
465 Ga0530510_0111517 3300061734 Unclassified 2004
466 Ga0530510_0134259 3300061734 Unclassified 1821
467 Ga0501033_0057033
468 Ga0070676_10002899
469 Ga0070676_10032811
470 Ga0070690_100061065
471 Ga0070670_100010011
472 Ga0068869_100019058
473 Ga0068869_100027861
474 Ga0070680_100208076
475 Ga0070682_100003835
476 Ga0070660_100000428
477 Ga0070691_10003525
478 Ga0070691_10060224
479 Ga0070661_100026394
480 Ga0070692_10000843
481 Ga0070692_10143935
482 Ga0070668_100062913
483 Ga0070668_100271737
484 Ga0070669_100020620
485 Ga0070669_100039634
486 Ga0070673_100083514
487 Ga0070688_100149421
488 Ga0070667_100112542
489 Ga0070703_10012466
490 Ga0070701_10012465
491 Ga0070705_100000486
492 Ga0070705_100029702
493 Ga0070705_100064875
494 Ga0070700_100040809
495 Ga0070694_100003654
496 Ga0070694_100015749
497 Ga0070694_100021190
498 Ga0070694_100042331
499 Ga0070694_100046476
500 Ga0070708_100009667
501 Ga0070708_100010558
502 Ga0070708_100014716
503 Ga0070708_100025418
504 Ga0070708_100028884
505 Ga0070708_100056448
506 Ga0070708_100211383
507 Ga0070663_100005163
508 Ga0070662_100005109
509 Ga0070662_100174368
510 Ga0068867_100001647
511 Ga0070706_100011241
512 Ga0070706_100011578
513 Ga0070706_100012266
514 Ga0070706_100037304
515 Ga0070706_100046927
516 Ga0070706_100054580
517 Ga0070706_100102678
518 Ga0070707_100006174
519 Ga0070707_100012734
520 Ga0070707_100014949
521 Ga0070707_100088586
522 Ga0070707_100119596
523 Ga0070707_100196445
524 Ga0070707_100341480
525 Ga0070707_100348784
526 Ga0070698_100003277
527 Ga0070698_100008252
528 Ga0070698_100014432
529 Ga0070698_100334645
530 Ga0070699_100003409
531 Ga0070699_100012344
532 Ga0070699_100036864
533 Ga0070699_100056111
534 Ga0070699_100072249
535 Ga0070699_100153326
536 Ga0070699_100262740
537 Ga0070699_100272282
538 Ga0070699_100318929
539 Ga0070679_100000728
540 Ga0070684_100025347
541 Ga0070697_100009055
542 Ga0070697_100027744
543 Ga0070697_100043391
544 Ga0070697_100132518
545 Ga0070697_100139000
546 Ga0070697_100141743
547 Ga0068853_100001892
548 Ga0070672_100073580
549 Ga0070695_100000912
550 Ga0070695_100007176
551 Ga0070695_100010939
552 Ga0070695_100020693
553 Ga0070696_100000376
554 Ga0070696_100016944
555 Ga0070696_100020127
556 Ga0070693_100000088
557 Ga0070704_100037900
558 Ga0070704_100081045
559 Ga0070704_100145210
560 Ga0068855_100000612
561 Ga0068857_100066609
562 Ga0068857_100140967
563 Ga0068856_100000630
564 Ga0068859_100001750
565 Ga0068859_100107795
566 Ga0068864_100024718
567 Ga0068861_100024398
568 Ga0068861_100282688
569 Ga0068870_10000540
570 Ga0068863_100081800
571 Ga0068858_100046202
572 Ga0068860_100034948
573 Ga0068860_100146467
574 Ga0068860_100220581
575 Ga0068860_100222577
576 Ga0068862_100018411
577 Ga0068862_100087335
578 Ga0081455_10002129
579 Ga0081539_10000069
580 Ga0070716_100001751
581 Ga0075428_100000294
582 Ga0075428_100002417
583 Ga0075428_100015474
584 Ga0075428_100041037
585 Ga0075428_100060944
586 Ga0075428_100092527
587 Ga0075428_100101588
588 Ga0075430_100000221
589 Ga0075430_100000250
590 Ga0075430_100005329
591 Ga0075430_100013407
592 Ga0075430_100321830
593 Ga0075431_100000511
594 Ga0075431_100000900
595 Ga0075431_100001741
596 Ga0075431_100002819
597 Ga0075431_100004045
598 Ga0075431_100012028
599 Ga0075431_100018439
600 Ga0075431_100020181
601 Ga0075431_100081207
602 Ga0075431_100152544
603 Ga0075431_100279869
604 Ga0075431_100330676
605 Ga0075433_10000216
606 Ga0075433_10023114
607 Ga0075433_10030031
608 Ga0075433_10041773
609 Ga0075433_10075094
610 Ga0075434_100004497
611 Ga0075434_100010756
612 Ga0075434_100012251
613 Ga0075434_100037331
614 Ga0075434_100070672
615 Ga0075434_100083143
616 Ga0075434_100149551
617 Ga0075434_100194056
618 Ga0075429_100000021
619 Ga0075429_100002606
620 Ga0075429_100006862
621 Ga0075429_100007451
622 Ga0075429_100052258
623 Ga0075429_100208136
624 Ga0075436_100003935
625 Ga0075436_100028153
626 Ga0075436_100084231
627 Ga0097620_100001750
628 Ga0097620_100107791
629 Ga0075435_100001691
630 Ga0075435_100017999
631 Ga0075435_100032319
632 Ga0099794_10003381
633 Ga0099794_10019707
634 Ga0111539_10000916
635 Ga0111539_10002749
636 Ga0111539_10106358
637 Ga0111539_10149231
638 Ga0111539_10235848
639 Ga0105245_10108611
640 Ga0114129_10000002
641 Ga0114129_10000957
642 Ga0114129_10001066
643 Ga0114129_10003671
644 Ga0114129_10009027
645 Ga0114129_10011426
646 Ga0114129_10015342
647 Ga0114129_10032596
648 Ga0114129_10038991
649 Ga0114129_10052136
650 Ga0114129_10065647
651 Ga0114129_10071835
652 Ga0114129_10075589
653 Ga0114129_10082878
654 Ga0114129_10223949
655 Ga0114129_10280178
656 Ga0114129_10372086
657 Ga0114129_10387142
658 Ga0114129_10521185
659 Ga0114129_10624607
660 Ga0105243_10069106
661 Ga0105243_10208208
662 Ga0105241_10002246
663 Ga0105242_10032083
664 Ga0105249_10053357
665 Ga0105249_10083166
666 Ga0105249_10122277
667 Ga0105249_10198863
668 Ga0157373_10000397
669 Ga0157369_10009860
670 Ga0157378_10177580
671 Ga0157378_10263910
672 Ga0163162_10075786
673 Ga0157372_10008050
674 Ga0163163_10040412
675 Ga0206353_11404692
676 Ga0207653_10014502
677 Ga0207642_10070141
678 Ga0207688_10017955
679 Ga0207645_10005940
680 Ga0207643_10000051
681 Ga0207684_10000931
682 Ga0207684_10002472
683 Ga0207684_10004324
684 Ga0207684_10005887
685 Ga0207684_10017534
686 Ga0207684_10031528
687 Ga0207684_10048866
688 Ga0207684_10067310
689 Ga0207684_10157362
690 Ga0207654_10001692
691 Ga0207707_10000078
692 Ga0207660_10001333
693 Ga0207660_10034696
694 Ga0207657_10000357
695 Ga0207652_10002085
696 Ga0207646_10001472
697 Ga0207646_10004024
698 Ga0207646_10021240
699 Ga0207646_10059148
700 Ga0207646_10093774
701 Ga0207646_10101344
702 Ga0207646_10184466
703 Ga0207650_10001516
704 Ga0207687_10067923
705 Ga0207690_10041537
706 Ga0207706_10010465
707 Ga0207706_10188841
708 Ga0207686_10038546
709 Ga0207709_10013765
710 Ga0207709_10081843
711 Ga0207709_10230644
712 Ga0207704_10158512
713 Ga0207665_10019415
714 Ga0207689_10000145
715 Ga0207689_10025450
716 Ga0207679_10004085
717 Ga0207667_10017407
718 Ga0207651_10107786
719 Ga0207712_10033477
720 Ga0207712_10036530
721 Ga0207712_10081457
722 Ga0207668_10040805
723 Ga0207640_10048983
724 Ga0207658_10082509
725 Ga0207639_10002065
726 Ga0207678_10002514
727 Ga0207708_10051878
728 Ga0207641_10163017
729 Ga0207648_10004325
730 Ga0207648_10026370
731 Ga0207648_10151868
732 Ga0207674_10000650
733 Ga0207674_10091692
734 Ga0207674_10150177
735 Ga0207674_10158561
736 Ga0207675_100040621
737 Ga0207675_100351611
738 Ga0209970_1002632
739 Ga0209588_1055385
740 Ga0209971_1000106
741 Ga0209966_1000237
742 Ga0209998_10000006
743 Ga0207428_10000068
744 Ga0207428_10078954
745 Ga0268265_10006651
746 Ga0268265_10095919
747 Ga0268264_10007605
748 Ga0268264_10159459
749 Ga0307408_100039465
750 Ga0307408_100060300
751 Ga0307408_100118498
752 Ga0307410_10119203
753 Ga0307416_100210211
754 Ga0373948_0010995
755 Ga0373959_0028483
756 Ga0373940_0004256
757 Ga0373940_0048577
758 Ga0373939_0011057
759 Ga0373931_0001875
760 Ga0373931_0003518
761 Ga0395900_0040813
762 Ga0395898_0005279
763 Ga0395901_0000511
764 Ga0395901_0055597
765 Ga0439439_0012132
766 Ga0439464_0003588
767 Ga0439460_0000677
768 Ga0451577_0002547
769 Ga0451577_0017868
770 Ga0451577_0050159
771 Ga0451577_0055186
772 Ga0453683_0004001
773 Ga0453684_0002981
774 Ga0451576_0020243
775 Ga0451576_0026828
776 Ga0451576_0036177
777 Ga0451576_0078097
778 Ga0451576_0134199
779 Ga0451576_0196225
780 Ga0451576_0240886
781 Ga0495580_0000018
782 Ga0495584_0075767
783 Ga0495659_0038009
784 Ga0496102_0073351
785 Ga0496102_0132801
786 Ga0501036_0267730
787 Ga0501039_0207763
788 Ga0501039_0244562
789 Ga0501040_0003923
790 Ga0501040_0010043
791 Ga0501040_0024098
792 Ga0501040_0053428
793 Ga0501040_0163760
794 Ga0501041_0035595
795 Ga0501041_0149207
796 Ga0501041_0229889
797 Ga0501042_0004291
798 Ga0501042_0147385
799 Ga0501042_0246855
800 Ga0501042_0258889
801 Ga0501043_0058810
802 Ga0501046_0015493
803 Ga0501046_0016913
804 Ga0501046_0173179
805 Ga0501047_0079697
806 Ga0501048_0022367
807 Ga0501048_0139851
808 Ga0501048_0179576
809 Ga0501067_0008542
810 Ga0501072_0015447
811 Ga0501072_0088554
812 Ga0501072_0094003
813 Ga0501072_0260075
814 Ga0501072_0312730
815 Ga0501074_0130054
816 Ga0501075_0004416
817 Ga0501075_0012775
818 Ga0501075_0076186
819 Ga0501075_0147492
820 Ga0501076_0025358
821 Ga0501076_0063211
822 Ga0501076_0067499
823 Ga0501076_0105148
824 Ga0501076_0204039
825 Ga0501076_0278222
826 Ga0501077_0005642
827 Ga0501077_0020228
828 Ga0501077_0033466
829 Ga0501079_0009334
830 Ga0501079_0017208
831 Ga0501079_0054354
832 Ga0501080_0046214
833 Ga0501080_0120304
834 Ga0501081_0003512
835 Ga0501081_0034157
836 Ga0501081_0045633
837 Ga0501081_0071765
838 Ga0501081_0106942
839 Ga0501081_0214972
840 Ga0501045_0009969
841 Ga0501045_0044001
842 Ga0501045_0140076
843 Ga0501045_0149133
844 nmdc:mga05p37_11111_c1
845 nmdc:mga05p37_13766_c1
846 nmdc:mga05p37_14163_c1
847 nmdc:mga05p37_149117_c1
848 nmdc:mga05p37_15401_c1
849 nmdc:mga05p37_26463_c1
850 nmdc:mga05p37_29967_c1
851 nmdc:mga05p37_2_c1
852 nmdc:mga05p37_3218_c1
853 nmdc:mga05p37_359565_c1
854 nmdc:mga05p37_48362_c1
855 nmdc:mga05p37_5088_c1
856 nmdc:mga05p37_71315_c1
857 nmdc:mga05p37_73845_c1
858 nmdc:mga05p37_80481_c1
859 nmdc:mga05p37_85452_c1
860 nmdc:mga09592_114067_c1
861 nmdc:mga09592_13763_c1
862 nmdc:mga09592_20990_c1
863 nmdc:mga09592_2188_c1
864 nmdc:mga09592_3286_c1
865 nmdc:mga09592_5835_c1
866 nmdc:mga09592_651_c1
867 nmdc:mga09592_66576_c1
868 nmdc:mga09592_93428_c1
869 nmdc:mga0qj67_16852_c1
870 nmdc:mga0qj67_2210_c1
871 nmdc:mga0qj67_302840_c1
872 nmdc:mga0qj67_35187_c1
873 nmdc:mga0qj67_3681_c1
874 nmdc:mga0qj67_533_c1
875 nmdc:mga06r32_109_c1
876 nmdc:mga06r32_117664_c1
877 nmdc:mga06r32_120392_c1
878 nmdc:mga06r32_120_c1
879 nmdc:mga06r32_244289_c1
880 nmdc:mga06r32_406809_c1
881 nmdc:mga06r32_695_c1
882 nmdc:mga06r32_825_c1
883 nmdc:mga06r32_8609_c1
884 nmdc:mga06r32_88653_c1
885 nmdc:mga06r32_90947_c1
886 nmdc:mga08y16_1150_c1
887 nmdc:mga08y16_22729_c1
888 nmdc:mga08y16_93669_c1
889 nmdc:mga0n895_132072_c1
890 nmdc:mga0n895_156761_c1
891 nmdc:mga0n895_17981_c1
892 nmdc:mga0n895_249057_c1
893 nmdc:mga0n895_25287_c1
894 nmdc:mga0n895_25622_c1
895 nmdc:mga0n895_3061_c1
896 nmdc:mga0n895_53615_c1
897 nmdc:mga0n895_7285_c1
898 nmdc:mga0n895_74004_c1
899 nmdc:mga0rr50_212688_c1
900 nmdc:mga0rr50_319405_c1
901 nmdc:mga0rr50_5057_c1
902 nmdc:mga0rr50_81770_c1
903 nmdc:mga08x19_119603_c1
904 nmdc:mga08x19_156539_c1
905 nmdc:mga08x19_54737_c1
906 nmdc:mga0a205_106764_c1
907 nmdc:mga0a205_12361_c1
908 nmdc:mga0a205_210_c1
909 nmdc:mga0a205_253519_c1
910 nmdc:mga0a205_28683_c1
911 nmdc:mga0a205_56665_c1
912 nmdc:mga0a205_83834_c1
913 nmdc:mga0a205_99294_c1
914 Ga0501084_0013198
915 Ga0501084_0025671
916 Ga0501084_0070387
917 Ga0501084_0084416
918 Ga0501084_0147318
919 Ga0501084_0210990
920 Ga0501084_0237079
921 Ga0501082_0008877
922 Ga0501082_0021287
923 Ga0501082_0218472
924 Ga0501082_0255905
925 Ga0530510_0002225
926 Ga0530510_0009680
927 Ga0530510_0013367
928 Ga0530510_0025702
929 Ga0530510_0033841
930 Ga0530510_0088123
931 Ga0530510_0111517
932 Ga0530510_0134259

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04303

PrpF

PrpF protein

3

389

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5k87-assembly1.cif.gz_A crystal structure of malonate bound to methylaconitate isomerase prpf from shewanella oneidensis 0.8623 2 355
5k87-assembly1.cif.gz_A crystal structure of malonate bound to methylaconitate isomerase prpf from shewanella oneidensis 0.8579 2 355
2pw0-assembly1.cif.gz_A crystal structure of trans-aconitate bound to methylaconitate isomerase prpf from shewanella oneidensis 0.8566 2 355
5k87-assembly1.cif.gz_B crystal structure of malonate bound to methylaconitate isomerase prpf from shewanella oneidensis 0.8557 2 355
2pvz-assembly1.cif.gz_B crystal structure of methylaconitate isomerase prpf from shewanella oneidensis 0.8523 2 355
ID Description Score Start End Superfamily
2pw0B02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9225 168 333 3.10.310.10
2h9fA02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9139 166 337 3.10.310.10
3g7kB02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9099 166 332 3.10.310.10
2pw0B02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8966 168 333 3.10.310.10
af_P0AAV8_179_330_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8763 173 331 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A2V6WWF8-F1-model_v4 Acetylornithine aminotransferase 0.9984 194 282 GO:0008483
GO:0016853
AF-A0A441XJS6-F1-model_v4 4-oxalomesaconate tautomerase 0.9874 164 234 GO:0016853
AF-A0A0J0YP45-F1-model_v4 3-methylitaconate isomerase 0.9866 242 305 GO:0016853
AF-A0A699XVE4-F1-model_v4 Uncharacterized protein 0.9834 238 299 GO:0016853
AF-A0A1I1W7K3-F1-model_v4 PrpF protein 0.9785 238 307 GO:0016853

Map