F449735

General Info

Members Datasets Scaffolds Average Seq Length
466 256 441 331

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0038936|Ga0495686_0038936_428_1576
Length 382
Sequence MVLIFVLRGNCGLFRLASFLLSQFGYTFGMSVPHEKTMLKAFGINSGKVVDSASAGPDMAARALALARCTLQIEADAIIALHARLEGDTSIARAIALMMACQGRVVVSGIGKSGHIARKIAATLSSTGTPALFLHPAEAAHGDLGMVTPQDVVIAISYSGESSELLAILPIVKRMGAPLISITGKPASSLAQLADVHLDVAVAKEACPMGLAPTASTTVTLALGDALAVALLELRGFKEDDFARSHPGGALGRRLLTLVRDVMRSGDAVPAVAEDALLTDALLEITRKGMGMTAIVDADGRPLGVFTDGDLRRMLSTVQDFTSVKIRDVMHRKPHQLGPDQLAVDAVAVMEYFRINQILVVDTDGKLAGALHIHDLTRAKVI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
5 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
6 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
7 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
8 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
9 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
10 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
11 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
12 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
13 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
14 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
15 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
16 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
17 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
18 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
19 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
20 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
21 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
22 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
23 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
24 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
25 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
26 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
27 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
28 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
29 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
30 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
31 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
32 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
33 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
34 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
35 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
36 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
74 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
75 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
107 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
110 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
111 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
112 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
113 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
117 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
123 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
124 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
127 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
128 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
136 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
137 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
138 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
150 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
151 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
152 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
161 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
162 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
163 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
170 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
171 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
176 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
183 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
192 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
202 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
211 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
214 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
215 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
216 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
219 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
229 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
230 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
234 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
248 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
249 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
250 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
251 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
252 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
256 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.64
Metatranscriptomes 0
Isolates 5.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.29
Nodule 0.64
Rhizoplane 2.58
Rhizosphere 83.69
Stem 0
Stem Tuber 0
Unclassified 8.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_81665 2162886007 Bacteria 1361
2 JGI25155J39150_1000125 3300002704 Bacteria 37391
3 JGI25156J39149_1000077 3300002705 Bacteria 74919
4 JGI25156J39149_1005076 3300002705 Bacteria 3880
5 JGI25154J39366_1000103 3300002738 Bacteria 74908
6 JGI25154J39366_1000178 3300002738 Bacteria 49620
7 JGI25157J39369_1000259 3300002741 Bacteria 38902
8 rootH2_10008170 3300003320 Bacteria 9963
9 Ga0055538_1000062 3300003751 Bacteria 105260
10 Ga0055539_1000093 3300003752 Bacteria 105260
11 Ga0055533_1000105 3300003756 Bacteria 105260
12 Ga0055532_1000034 3300003758 Bacteria 210984
13 Ga0055525_1000137 3300003759 Bacteria 105260
14 Ga0055541_1000063 3300003841 Bacteria 105260
15 Ga0058692_1000847 3300003856 Bacteria 12067
16 Ga0065704_10095130 3300005289 Bacteria 2504
17 Ga0065704_10097852 3300005289 Bacteria 2376
18 Ga0070676_10032034 3300005328 Bacteria 3009
19 Ga0068869_100221212 3300005334 Bacteria 1501
20 Ga0070692_10039590 3300005345 Bacteria 2407
21 Ga0070692_10048759 3300005345 Bacteria 2195
22 Ga0070669_100089793 3300005353 Bacteria 2302
23 Ga0070688_100006040 3300005365 Bacteria 6429
24 Ga0070694_100000391 3300005444 Bacteria 23747
25 Ga0070694_100032084 3300005444 Bacteria 3448
26 Ga0070708_100000627 3300005445 Bacteria 26774
27 Ga0070662_100113641 3300005457 Bacteria 2066
28 Ga0070685_10017908 3300005466 Bacteria 3802
29 Ga0070706_100131011 3300005467 Bacteria 2340
30 Ga0070698_100206759 3300005471 Bacteria 1898
31 Ga0070697_100000090 3300005536 Bacteria 75895
32 Ga0070697_100263566 3300005536 Bacteria 1476
33 Ga0068853_100105400 3300005539 Bacteria 2498
34 Ga0070665_100019235 3300005548 Bacteria 6852
35 Ga0070704_100016824 3300005549 Bacteria 4632
36 Ga0068855_100034892 3300005563 Bacteria 5994
37 Ga0068856_100174553 3300005614 Bacteria 2161
38 Ga0068852_100011378 3300005616 Bacteria 6696
39 Ga0068864_100054224 3300005618 Unclassified 3460
40 Ga0075428_100063790 3300006844 Bacteria 4034
41 Ga0079104_1001382 3300006946 Bacteria 16496
42 Ga0105240_10000799 3300009093 Bacteria 56992
43 Ga0114129_10003091 3300009147 Bacteria 23344
44 Ga0114129_10149040 3300009147 Bacteria 3202
45 Ga0105243_10007754 3300009148 Bacteria 8256
46 Ga0105241_10045159 3300009174 Bacteria 3341
47 Ga0105241_10078566 3300009174 Bacteria 2579
48 Ga0105248_10556035 3300009177 Bacteria 1295
49 Ga0105238_10136221 3300009551 Bacteria 2433
50 Ga0105238_10189307 3300009551 Bacteria 2034
51 Ga0105246_10160366 3300011119 Bacteria 1712
52 Ga0157369_10165378 3300013105 Unclassified 2333
53 Ga0163162_10136302 3300013306 Bacteria 2566
54 Ga0163163_10001469 3300014325 Bacteria 19935
55 Ga0163163_10514378 3300014325 Unclassified 1259
56 Ga0182008_10038749 3300014497 Bacteria 2383
57 Ga0213872_10003077 3300021361 Bacteria 9396
58 Ga0213875_10000028 3300021388 Bacteria 187813
59 Ga0213871_10013381 3300021441 Bacteria 1927
60 Ga0209435_100007 3300025206 Bacteria 516857
61 Ga0209435_100444 3300025206 Bacteria 8409
62 Ga0209784_100021 3300025224 Bacteria 408534
63 Ga0209566_100119 3300025225 Bacteria 105312
64 Ga0209674_100036 3300025226 Bacteria 408534
65 Ga0209147_100017 3300025229 Bacteria 516857
66 Ga0209563_100040 3300025230 Bacteria 408534
67 Ga0209258_100115 3300025242 Bacteria 190367
68 Ga0209646_1000044 3300025246 Bacteria 334596
69 Ga0209646_1000107 3300025246 Bacteria 163112
70 Ga0209026_1000063 3300025250 Bacteria 211324
71 Ga0209026_1002436 3300025250 Bacteria 7000
72 Ga0209677_100023 3300025253 Bacteria 408534
73 Ga0209759_1000048 3300025256 Bacteria 224817
74 Ga0209759_1000198 3300025256 Bacteria 95052
75 Ga0209455_1007850 3300025272 Bacteria 2964
76 Ga0207705_10001882 3300025909 Bacteria 16468
77 Ga0207654_10008227 3300025911 Bacteria 5264
78 Ga0207707_10208615 3300025912 Bacteria 1702
79 Ga0207695_10001014 3300025913 Bacteria 49482
80 Ga0207649_10029056 3300025920 Bacteria 3262
81 Ga0207694_10163767 3300025924 Bacteria 1798
82 Ga0207694_10165564 3300025924 Bacteria 1788
83 Ga0207687_10014439 3300025927 Bacteria 5168
84 Ga0207706_10095462 3300025933 Bacteria 2615
85 Ga0207706_10163959 3300025933 Bacteria 1953
86 Ga0207686_10090618 3300025934 Bacteria 2018
87 Ga0207709_10008958 3300025935 Bacteria 5521
88 Ga0207691_10248230 3300025940 Bacteria 1537
89 Ga0207711_10413701 3300025941 Bacteria 1254
90 Ga0207679_10188862 3300025945 Bacteria 1711
91 Ga0207667_10049646 3300025949 Bacteria 4431
92 Ga0207641_10077953 3300026088 Bacteria 2869
93 Ga0207648_10080697 3300026089 Bacteria 2838
94 Ga0207674_10047425 3300026116 Bacteria 4404
95 Ga0207674_10259855 3300026116 Bacteria 1684
96 Ga0207698_10002135 3300026142 Bacteria 11672
97 Ga0209588_1047034 3300027671 Bacteria 1395
98 Ga0265338_10001154 3300028800 Bacteria 43706
99 Ga0265332_10002576 3300031238 Bacteria 9182
100 Ga0265332_10082299 3300031238 Bacteria 1365
101 Ga0265320_10020014 3300031240 Bacteria 3641
102 Ga0265340_10100155 3300031247 Bacteria 1347
103 Ga0265339_10109064 3300031249 Unclassified 1434
104 Ga0265316_10026352 3300031344 Bacteria 4837
105 Ga0265313_10004356 3300031595 Bacteria 10934
106 Ga0316575_10001267 3300031665 Bacteria 8041
107 Ga0316579_10075569 3300031691 Bacteria 1601
108 Ga0265314_10008084 3300031711 Bacteria 9052
109 Ga0265314_10014186 3300031711 Bacteria 6390
110 Ga0265342_10025984 3300031712 Bacteria 3674
111 Ga0316576_10001504 3300031727 Bacteria 12591
112 Ga0316576_10025852 3300031727 Bacteria 4113
113 Ga0316576_10111487 3300031727 Bacteria 2050
114 Ga0316576_10162513 3300031727 Bacteria 1684
115 Ga0316578_10037857 3300031728 Bacteria 2780
116 Ga0307405_10176965 3300031731 Bacteria 1528
117 Ga0316577_10074412 3300031733 Unclassified 1897
118 Ga0307413_10262172 3300031824 Bacteria 1289
119 Ga0307410_10120942 3300031852 Bacteria 1909
120 Ga0316583_10035925 3300032133 Bacteria 1759
121 Ga0316585_10005495 3300032137 Bacteria 3579
122 Ga0373929_0000004 3300035085 Bacteria 462745
123 Ga0373955_0277338 3300035172 Bacteria 1008
124 Ga0316574_0078553 3300035398 Bacteria 2092
125 Ga0316574_0109081 3300035398 Bacteria 1774
126 Ga0316582_0008189 3300036647 Bacteria 5607
127 Ga0316582_0045829 3300036647 Bacteria 2754
128 Ga0316584_0108477 3300036712 Bacteria 2077
129 Ga0395899_0031221 3300037312 Bacteria 4004
130 Ga0395899_0039535 3300037312 Bacteria 3530
131 Ga0395900_0002597 3300037418 Bacteria 19748
132 Ga0395900_0070626 3300037418 Bacteria 3590
133 Ga0395898_0037552 3300037466 Bacteria 4804
134 Ga0395898_0144000 3300037466 Bacteria 2281
135 Ga0395898_0162354 3300037466 Bacteria 2137
136 Ga0395898_0187657 3300037466 Bacteria 1975
137 Ga0395905_0000200 3300037471 Bacteria 93008
138 Ga0395905_0102524 3300037471 Bacteria 2686
139 Ga0436364_0302973 3300037853 Bacteria 187060
140 Ga0395901_0001076 3300038443 Bacteria 29192
141 Ga0395901_0095841 3300038443 Bacteria 3109
142 Ga0395901_0173565 3300038443 Bacteria 2261
143 Ga0395901_0211257 3300038443 Bacteria 2031
144 Ga0436360_0119357 3300039438 Bacteria 3547
145 Ga0436361_0951855 3300039447 Bacteria 7513
146 Ga0439438_019758 3300041405 Bacteria 1900
147 Ga0439431_0002553 3300041997 Bacteria 4018
148 Ga0439448_0003545 3300042005 Bacteria 4332
149 Ga0439450_011105 3300042008 Bacteria 1754
150 Ga0451577_0240267 3300042876 Bacteria 1639
151 Ga0466966_0022675 3300044684 Bacteria 4118
152 Ga0466964_0008040 3300044706 Bacteria 3953
153 Ga0453684_0006851 3300044712 Bacteria 21408
154 Ga0453684_0188339 3300044712 Bacteria 2416
155 Ga0466959_0032834 3300045049 Bacteria 3842
156 Ga0451576_0016111 3300045051 Bacteria 8260
157 Ga0451576_0407886 3300045051 Bacteria 1425
158 Ga0466958_0080704 3300045836 Bacteria 2001
159 Ga0466967_0011831 3300045976 Bacteria 6637
160 Ga0466967_0025158 3300045976 Bacteria 4905
161 Ga0495617_000027 3300046452 Bacteria 157385
162 Ga0495627_000277 3300046453 Bacteria 51556
163 Ga0495590_0000053 3300046457 Bacteria 103329
164 Ga0495590_0002275 3300046457 Bacteria 8017
165 Ga0495590_0079368 3300046457 Bacteria 1155
166 Ga0495591_000500 3300046458 Bacteria 30952
167 Ga0495591_010151 3300046458 Bacteria 3674
168 Ga0495638_0037507 3300046460 Bacteria 3083
169 Ga0495653_0052356 3300046463 Bacteria 3128
170 Ga0495650_0000431 3300046471 Bacteria 67716
171 Ga0495650_0000582 3300046471 Bacteria 51082
172 Ga0495650_0011511 3300046471 Bacteria 4839
173 Ga0495580_0058717 3300046472 Unclassified 2705
174 Ga0495580_0065881 3300046472 Bacteria 2536
175 Ga0495582_0003170 3300046473 Bacteria 9235
176 Ga0495605_0000135 3300046474 Bacteria 95104
177 Ga0495605_0012191 3300046474 Bacteria 4773
178 Ga0495605_0015501 3300046474 Bacteria 4142
179 Ga0495605_0020640 3300046474 Bacteria 3499
180 Ga0495605_0026339 3300046474 Bacteria 3023
181 Ga0495605_0035842 3300046474 Bacteria 2505
182 Ga0495605_0049840 3300046474 Bacteria 2044
183 Ga0495639_0103322 3300046475 Bacteria 1347
184 Ga0495584_0000713 3300046491 Bacteria 21919
185 Ga0495584_0001504 3300046491 Bacteria 13869
186 Ga0495584_0002767 3300046491 Bacteria 9805
187 Ga0495584_0004737 3300046491 Bacteria 7282
188 Ga0495584_0087823 3300046491 Bacteria 1567
189 Ga0495585_0000466 3300046492 Bacteria 38653
190 Ga0495585_0008237 3300046492 Bacteria 6328
191 Ga0495585_0012462 3300046492 Bacteria 5009
192 Ga0495585_0042221 3300046492 Bacteria 2555
193 Ga0495585_0072659 3300046492 Bacteria 1873
194 Ga0495596_0007284 3300046500 Bacteria 5002
195 Ga0495596_0007978 3300046500 Bacteria 4737
196 Ga0495596_0015867 3300046500 Bacteria 3140
197 Ga0495596_0025519 3300046500 Bacteria 2388
198 Ga0495607_0000264 3300046501 Bacteria 56345
199 Ga0495607_0002410 3300046501 Bacteria 15261
200 Ga0495607_0004458 3300046501 Bacteria 10274
201 Ga0495607_0006913 3300046501 Bacteria 7910
202 Ga0495607_0013419 3300046501 Bacteria 5370
203 Ga0495607_0036021 3300046501 Bacteria 2987
204 Ga0495583_0002349 3300046506 Bacteria 16382
205 Ga0495583_0003787 3300046506 Bacteria 11232
206 Ga0495583_0010812 3300046506 Bacteria 5285
207 Ga0495583_0013027 3300046506 Bacteria 4667
208 Ga0495583_0051393 3300046506 Bacteria 1879
209 Ga0495583_0055998 3300046506 Bacteria 1780
210 Ga0495583_0062646 3300046506 Bacteria 1655
211 Ga0495606_0001657 3300046507 Bacteria 28942
212 Ga0495606_0004035 3300046507 Bacteria 14973
213 Ga0495606_0006559 3300046507 Bacteria 10699
214 Ga0495606_0104391 3300046507 Bacteria 1720
215 Ga0495606_0123590 3300046507 Bacteria 1546
216 Ga0495606_0137678 3300046507 Bacteria 1444
217 Ga0495610_0007656 3300046512 Bacteria 7139
218 Ga0495610_0060696 3300046512 Bacteria 1799
219 Ga0495616_0000333 3300046513 Bacteria 37273
220 Ga0495616_0003764 3300046513 Bacteria 9679
221 Ga0495616_0015793 3300046513 Bacteria 4190
222 Ga0495616_0018132 3300046513 Bacteria 3871
223 Ga0495616_0030355 3300046513 Bacteria 2841
224 Ga0495616_0044418 3300046513 Bacteria 2253
225 Ga0495616_0131892 3300046513 Bacteria 1144
226 Ga0495630_0051331 3300046517 Bacteria 3087
227 Ga0495630_0527075 3300046517 Bacteria 906
228 Ga0495631_0001600 3300046518 Bacteria 13546
229 Ga0495631_0002985 3300046518 Bacteria 9358
230 Ga0495631_0004324 3300046518 Bacteria 7576
231 Ga0495631_0010049 3300046518 Bacteria 4701
232 Ga0495632_0000069 3300046519 Bacteria 107707
233 Ga0495632_0000177 3300046519 Bacteria 65209
234 Ga0495632_0001178 3300046519 Bacteria 22245
235 Ga0495632_0001980 3300046519 Bacteria 16262
236 Ga0495632_0003331 3300046519 Bacteria 11455
237 Ga0495632_0012042 3300046519 Bacteria 5008
238 Ga0495632_0024295 3300046519 Bacteria 3221
239 Ga0495632_0094643 3300046519 Bacteria 1412
240 Ga0495637_0000053 3300046520 Bacteria 99739
241 Ga0495637_0006479 3300046520 Bacteria 5873
242 Ga0495643_0003928 3300046522 Bacteria 10651
243 Ga0495643_0005232 3300046522 Bacteria 8828
244 Ga0495643_0012850 3300046522 Bacteria 5036
245 Ga0495644_0001533 3300046523 Bacteria 9433
246 Ga0495644_0025951 3300046523 Bacteria 2223
247 Ga0495648_0005653 3300046524 Bacteria 10349
248 Ga0495648_0012325 3300046524 Bacteria 6385
249 Ga0495648_0022662 3300046524 Bacteria 4317
250 Ga0495648_0027822 3300046524 Bacteria 3777
251 Ga0495666_0000177 3300046526 Bacteria 27146
252 Ga0495642_0000137 3300046528 Bacteria 42614
253 Ga0495642_0000441 3300046528 Bacteria 21882
254 Ga0495642_0004645 3300046528 Bacteria 5319
255 Ga0495642_0014293 3300046528 Bacteria 3075
256 Ga0495642_0061333 3300046528 Bacteria 1560
257 Ga0495642_0082240 3300046528 Bacteria 1357
258 Ga0495652_0005568 3300046529 Bacteria 11846
259 Ga0495654_0049964 3300046530 Bacteria 2045
260 Ga0495665_0005443 3300046531 Bacteria 6856
261 Ga0495640_0049509 3300046533 Bacteria 2897
262 Ga0495587_0084837 3300046536 Bacteria 1834
263 Ga0495609_0000007 3300046538 Bacteria 398812
264 Ga0495609_0001446 3300046538 Bacteria 15772
265 Ga0495609_0002140 3300046538 Bacteria 12423
266 Ga0495609_0009229 3300046538 Bacteria 4779
267 Ga0495609_0010787 3300046538 Bacteria 4370
268 Ga0495609_0028195 3300046538 Bacteria 2563
269 Ga0495609_0031899 3300046538 Bacteria 2394
270 Ga0495609_0045456 3300046538 Bacteria 1967
271 Ga0495609_0046233 3300046538 Bacteria 1949
272 Ga0495609_0063852 3300046538 Bacteria 1625
273 Ga0495597_0000348 3300046542 Bacteria 41331
274 Ga0495597_0001336 3300046542 Bacteria 17943
275 Ga0495597_0010005 3300046542 Bacteria 4657
276 Ga0495597_0016854 3300046542 Bacteria 3446
277 Ga0495597_0037849 3300046542 Bacteria 2164
278 Ga0495645_0064044 3300046543 Bacteria 2661
279 Ga0495633_0002729 3300046558 Bacteria 12238
280 Ga0495633_0008912 3300046558 Bacteria 5593
281 Ga0495633_0013804 3300046558 Bacteria 4242
282 Ga0495667_0028373 3300046559 Unclassified 3769
283 Ga0495668_0000962 3300046616 Bacteria 32005
284 Ga0495668_0001492 3300046616 Bacteria 22413
285 Ga0495668_0001879 3300046616 Bacteria 18822
286 Ga0495668_0004143 3300046616 Bacteria 10479
287 Ga0495668_0012875 3300046616 Bacteria 4952
288 Ga0495634_0019868 3300046642 Bacteria 4768
289 Ga0495611_0000271 3300046648 Bacteria 35492
290 Ga0495611_0013322 3300046648 Bacteria 3499
291 Ga0495611_0015525 3300046648 Bacteria 3255
292 Ga0495611_0026123 3300046648 Bacteria 2547
293 Ga0495625_0000428 3300046660 Bacteria 63353
294 Ga0495625_0023402 3300046660 Bacteria 4719
295 Ga0495625_0068150 3300046660 Bacteria 2502
296 Ga0495625_0107901 3300046660 Bacteria 1905
297 Ga0495635_0005841 3300046663 Bacteria 8576
298 Ga0495635_0024893 3300046663 Unclassified 4171
299 Ga0495661_0000549 3300046665 Bacteria 38859
300 Ga0495661_0000776 3300046665 Bacteria 30561
301 Ga0495661_0001219 3300046665 Bacteria 22320
302 Ga0495661_0002786 3300046665 Bacteria 13243
303 Ga0495661_0017352 3300046665 Bacteria 4755
304 Ga0495588_0004898 3300046674 Bacteria 5937
305 Ga0495588_0010935 3300046674 Bacteria 4244
306 Ga0495623_0004426 3300046679 Bacteria 9232
307 Ga0495623_0028737 3300046679 Bacteria 3577
308 Ga0495646_0150632 3300046680 Bacteria 1294
309 Ga0495669_0000073 3300046684 Bacteria 66387
310 Ga0495669_0004634 3300046684 Bacteria 5699
311 Ga0495669_0015135 3300046684 Bacteria 3300
312 Ga0495669_0054349 3300046684 Bacteria 1802
313 Ga0495613_0043544 3300046689 Bacteria 3321
314 Ga0495613_0302710 3300046689 Bacteria 1106
315 Ga0495624_0095323 3300046690 Bacteria 1834
316 Ga0495670_0002459 3300046691 Bacteria 9144
317 Ga0495670_0004392 3300046691 Bacteria 6915
318 Ga0495670_0066295 3300046691 Bacteria 1821
319 Ga0495671_0002956 3300046692 Bacteria 10572
320 Ga0495649_0000291 3300046694 Bacteria 44106
321 Ga0495649_0009889 3300046694 Bacteria 5643
322 Ga0495649_0058310 3300046694 Bacteria 2080
323 Ga0495649_0060986 3300046694 Bacteria 2028
324 Ga0495589_0000081 3300046794 Bacteria 88067
325 Ga0495589_0001934 3300046794 Bacteria 11734
326 Ga0495589_0002218 3300046794 Bacteria 10925
327 Ga0495589_0007240 3300046794 Bacteria 5812
328 Ga0495589_0013992 3300046794 Bacteria 4137
329 Ga0495589_0017042 3300046794 Bacteria 3730
330 Ga0495600_0056858 3300046809 Bacteria 2556
331 Ga0495660_0021954 3300046810 Bacteria 3648
332 Ga0495604_0011966 3300047317 Bacteria 6897
333 Ga0495604_0061195 3300047317 Bacteria 2880
334 Ga0495636_0043791 3300047318 Bacteria 1863
335 Ga0495672_0000135 3300047320 Bacteria 110114
336 Ga0495672_0000340 3300047320 Bacteria 59814
337 Ga0495672_0016966 3300047320 Bacteria 4880
338 Ga0495672_0101384 3300047320 Bacteria 1560
339 Ga0495676_0000221 3300047321 Bacteria 45708
340 Ga0495680_0032272 3300047322 Bacteria 4252
341 Ga0495680_0049292 3300047322 Bacteria 3299
342 Ga0495680_0054413 3300047322 Bacteria 3108
343 Ga0495683_0001222 3300047323 Bacteria 17501
344 Ga0495683_0007113 3300047323 Bacteria 6072
345 Ga0495683_0031965 3300047323 Bacteria 2681
346 Ga0495687_000030 3300047443 Bacteria 279992
347 Ga0495687_000120 3300047443 Bacteria 120987
348 Ga0495687_000374 3300047443 Bacteria 55800
349 Ga0495687_002025 3300047443 Bacteria 17139
350 Ga0495675_0011591 3300047444 Bacteria 5534
351 Ga0495675_0070279 3300047444 Bacteria 2210
352 Ga0495677_0000045 3300047445 Bacteria 73995
353 Ga0495677_0000387 3300047445 Bacteria 18876
354 Ga0495677_0001504 3300047445 Bacteria 9372
355 Ga0495677_0003277 3300047445 Bacteria 6310
356 Ga0495677_0003624 3300047445 Bacteria 5986
357 Ga0495677_0011757 3300047445 Bacteria 3199
358 Ga0495677_0028312 3300047445 Bacteria 2034
359 Ga0495679_015610 3300047446 Bacteria 2773
360 Ga0495681_0000978 3300047470 Bacteria 21839
361 Ga0495681_0001523 3300047470 Bacteria 17287
362 Ga0495681_0002791 3300047470 Bacteria 12364
363 Ga0495681_0011838 3300047470 Bacteria 5163
364 Ga0495681_0043463 3300047470 Bacteria 2166
365 Ga0495686_0000793 3300047472 Bacteria 41237
366 Ga0495686_0000802 3300047472 Bacteria 40756
367 Ga0495686_0004415 3300047472 Bacteria 11587
368 Ga0495686_0017592 3300047472 Bacteria 4810
369 Ga0495686_0038936 3300047472 Bacteria 3039
370 Ga0495602_0019975 3300048088 Bacteria 6632
371 Ga0495614_0005047 3300048089 Bacteria 5956
372 Ga0495626_0000105 3300048091 Bacteria 109725
373 Ga0495626_0001251 3300048091 Bacteria 20847
374 Ga0495626_0003522 3300048091 Bacteria 10022
375 Ga0495626_0005746 3300048091 Bacteria 7163
376 Ga0495626_0009393 3300048091 Bacteria 5287
377 Ga0495626_0010538 3300048091 Bacteria 4923
378 Ga0495626_0014390 3300048091 Bacteria 4083
379 Ga0495626_0020582 3300048091 Bacteria 3285
380 Ga0495626_0037534 3300048091 Bacteria 2301
381 Ga0495626_0075393 3300048091 Bacteria 1508
382 Ga0496102_0002351 3300048905 Bacteria 16129
383 Ga0496105_0287472 3300048908 Bacteria 1324
384 Ga0496108_0223643 3300048911 Bacteria 1636
385 Ga0496108_0411806 3300048911 Bacteria 1181
386 Ga0496109_0125405 3300048912 Unclassified 2394
387 Ga0496110_0000462 3300048913 Bacteria 27650
388 Ga0496110_0038136 3300048913 Bacteria 4179
389 Ga0496111_0072628 3300048914 Bacteria 2504
390 Ga0496111_0263133 3300048914 Bacteria 1280
391 Ga0496113_0269723 3300048916 Unclassified 1360
392 Ga0496115_0019484 3300048918 Bacteria 5221
393 Ga0496115_0077783 3300048918 Bacteria 2698
394 Ga0496116_0003824 3300048919 Bacteria 14712
395 Ga0496122_0000570 3300048925 Bacteria 75506
396 Ga0496122_0004067 3300048925 Bacteria 18560
397 Ga0496123_0000438 3300048926 Bacteria 74878
398 Ga0496123_0001939 3300048926 Bacteria 26936
399 Ga0496123_0006950 3300048926 Bacteria 10810
400 Ga0496124_0024256 3300048927 Bacteria 5521
401 Ga0496124_0044307 3300048927 Bacteria 3818
402 Ga0496124_0112084 3300048927 Bacteria 2194
403 Ga0496124_0241723 3300048927 Bacteria 1342
404 Ga0496125_0000701 3300048928 Bacteria 55423
405 Ga0496125_0005434 3300048928 Bacteria 14167
406 Ga0496125_0084626 3300048928 Bacteria 2407
407 Ga0496125_0112664 3300048928 Bacteria 1965
408 Ga0495678_000190 3300049459 Bacteria 71878
409 Ga0495678_000831 3300049459 Bacteria 27649
410 Ga0495678_001754 3300049459 Bacteria 16090
411 Ga0495678_002868 3300049459 Bacteria 11136
412 Ga0495678_004860 3300049459 Bacteria 7612
413 Ga0495682_0000714 3300049460 Bacteria 21687
414 Ga0495682_0007243 3300049460 Bacteria 4428
415 Ga0495682_0033712 3300049460 Bacteria 1889
416 Ga0501034_0000759 3300049571 Bacteria 48520
417 Ga0501034_0011664 3300049571 Bacteria 9096
418 Ga0501047_0106100 3300049581 Bacteria 2690
419 Ga0501072_0078783 3300049588 Bacteria 2609
420 Ga0501074_0299398 3300049590 Bacteria 1142
421 Ga0501075_0214193 3300049591 Bacteria 1469
422 Ga0501075_0240967 3300049591 Bacteria 1379
423 Ga0501076_0124213 3300049592 Bacteria 2091
424 Ga0501076_0151378 3300049592 Bacteria 1887
425 Ga0501077_0084455 3300049593 Bacteria 2013
426 Ga0501081_0228669 3300049743 Bacteria 1354
427 nmdc:mga05p37_6480_c1 3300050507 Bacteria 13809
428 nmdc:mga06r32_93509_c1 3300050510 Bacteria 2941
429 nmdc:mga0n895_114610_c1 3300050512 Bacteria 2713
430 Ga0495619_0039692 3300053085 Unclassified 3074
431 Ga0500643_013769 3300053087 Bacteria 2840
432 Ga0500556_0000455 3300053104 Bacteria 28996
433 Ga0500618_000364 3300053125 Bacteria 31481
434 Ga0500642_0076069 3300053130 Bacteria 1535
435 Ga0500624_000329 3300053157 Bacteria 16004
436 Ga0500636_0068734 3300053177 Bacteria 2056
437 Ga0501084_0065690 3300054114 Bacteria 3036
438 Ga0501082_0024762 3300060353 Bacteria 5174
439 Ga0501082_0435401 3300060353 Bacteria 1145
440 Ga0501082_0452124 3300060353 Bacteria 1122
441 Ga0530510_0107526 3300061734 Bacteria 2041

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046517 Ga0495630_0527075 Ga0495630_0527075_50_844 252
2 3300021441 Ga0213871_10013381 Ga0213871_100133813 273
3 3300060353 Ga0501082_0452124 Ga0501082_0452124_276_1109 276
4 3300005536 Ga0070697_100000090 Ga0070697_10000009046 283
5 3300031727 Ga0316576_10111487 Ga0316576_101114872 288
6 3300031728 Ga0316578_10037857 Ga0316578_100378571 288
7 3300035398 Ga0316574_0109081 Ga0316574_0109081_33_989 288
8 3300036712 Ga0316584_0108477 Ga0316584_0108477_929_1885 288
9 3300035172 Ga0373955_0277338 Ga0373955_0277338_45_953 292
10 3300031344 Ga0265316_10026352 Ga0265316_100263523 296
11 3300035398 Ga0316574_0078553 Ga0316574_0078553_220_1116 298
12 3300049581 Ga0501047_0106100 Ga0501047_0106100_244_1242 301
13 3300046513 Ga0495616_0030355 Ga0495616_0030355_1093_2025 302
14 3300009147 Ga0114129_10149040 Ga0114129_101490402 308
15 3300009174 Ga0105241_10045159 Ga0105241_100451592 308
16 3300025927 Ga0207687_10014439 Ga0207687_100144393 308
17 3300048914 Ga0496111_0263133 Ga0496111_0263133_238_1200 308
18 3300050512 nmdc:mga0n895_114610_c1 nmdc:mga0n895_114610_c1_1406_2365 308
19 3300047472 Ga0495686_0004415 Ga0495686_0004415_1859_3022 309
20 3300048911 Ga0496108_0223643 Ga0496108_0223643_463_1485 309
21 3300053104 Ga0500556_0000455 Ga0500556_0000455_14703_15695 310
22 3300025924 Ga0207694_10165564 Ga0207694_101655643 311
23 3300005548 Ga0070665_100019235 Ga0070665_1000192356 312
24 3300046536 Ga0495587_0084837 Ga0495587_0084837_807_1805 312
25 3300046679 Ga0495623_0004426 Ga0495623_0004426_756_1754 312
26 3300046680 Ga0495646_0150632 Ga0495646_0150632_129_1127 312
27 3300047322 Ga0495680_0054413 Ga0495680_0054413_602_1600 312
28 3300047444 Ga0495675_0070279 Ga0495675_0070279_304_1302 312
29 3300005618 Ga0068864_100054224 Ga0068864_1000542241 314
30 3300044706 Ga0466964_0008040 Ga0466964_0008040_2843_3865 314
31 3300045976 Ga0466967_0011831 Ga0466967_0011831_2825_3847 314
32 3300046491 Ga0495584_0001504 Ga0495584_0001504_12550_13548 314
33 3300046492 Ga0495585_0072659 Ga0495585_0072659_754_1752 314
34 3300046500 Ga0495596_0007284 Ga0495596_0007284_780_1778 314
35 3300046501 Ga0495607_0006913 Ga0495607_0006913_2907_3905 314
36 3300046506 Ga0495583_0003787 Ga0495583_0003787_6454_7452 314
37 3300046507 Ga0495606_0104391 Ga0495606_0104391_653_1651 314
38 3300046518 Ga0495631_0004324 Ga0495631_0004324_5720_6718 314
39 3300046519 Ga0495632_0001980 Ga0495632_0001980_8240_9238 314
40 3300046522 Ga0495643_0003928 Ga0495643_0003928_2038_3036 314
41 3300046558 Ga0495633_0008912 Ga0495633_0008912_3834_4832 314
42 3300046691 Ga0495670_0066295 Ga0495670_0066295_290_1288 314
43 3300046694 Ga0495649_0009889 Ga0495649_0009889_2641_3639 314
44 3300046794 Ga0495589_0007240 Ga0495589_0007240_2152_3150 314
45 3300047323 Ga0495683_0007113 Ga0495683_0007113_4321_5319 314
46 3300047445 Ga0495677_0001504 Ga0495677_0001504_5063_6061 314
47 3300047445 Ga0495677_0011757 Ga0495677_0011757_2118_3116 314
48 3300047470 Ga0495681_0001523 Ga0495681_0001523_5446_6444 314
49 3300048091 Ga0495626_0014390 Ga0495626_0014390_2414_3412 314
50 3300049459 Ga0495678_004860 Ga0495678_004860_3781_4779 314
51 3300049593 Ga0501077_0084455 Ga0501077_0084455_993_1946 314
52 3300061734 Ga0530510_0107526 Ga0530510_0107526_759_1703 314
53 iso_pu_bacteria 2939607340 2939610120 314
54 3300014325 Ga0163163_10001469 Ga0163163_1000146918 316
55 3300014325 Ga0163163_10514378 Ga0163163_105143781 316
56 3300025912 Ga0207707_10208615 Ga0207707_102086151 316
57 3300031731 Ga0307405_10176965 Ga0307405_101769652 316
58 3300045051 Ga0451576_0407886 Ga0451576_0407886_53_1303 316
59 3300046472 Ga0495580_0058717 Ga0495580_0058717_295_1281 316
60 3300046475 Ga0495639_0103322 Ga0495639_0103322_175_1161 316
61 3300046559 Ga0495667_0028373 Ga0495667_0028373_597_1583 316
62 3300046663 Ga0495635_0024893 Ga0495635_0024893_2945_3931 316
63 3300046684 Ga0495669_0004634 Ga0495669_0004634_4492_5478 316
64 3300048911 Ga0496108_0411806 Ga0496108_0411806_13_999 316
65 3300048912 Ga0496109_0125405 Ga0496109_0125405_621_1607 316
66 3300048916 Ga0496113_0269723 Ga0496113_0269723_267_1253 316
67 3300053085 Ga0495619_0039692 Ga0495619_0039692_753_1739 316
68 iso_pu_bacteria 2687453129 2687578412 316
69 3300003320 rootH2_10008170 rootH2_100081702 317
70 3300003856 Ga0058692_1000847 Ga0058692_10008479 317
71 3300006946 Ga0079104_1001382 Ga0079104_100138214 317
72 3300039438 Ga0436360_0119357 Ga0436360_0119357_1096_2076 317
73 3300041405 Ga0439438_019758 Ga0439438_019758_265_1230 317
74 3300046460 Ga0495638_0037507 Ga0495638_0037507_1497_2450 317
75 3300046501 Ga0495607_0004458 Ga0495607_0004458_1094_2092 317
76 3300046513 Ga0495616_0015793 Ga0495616_0015793_2085_3083 317
77 3300046519 Ga0495632_0001178 Ga0495632_0001178_14733_15731 317
78 3300046665 Ga0495661_0017352 Ga0495661_0017352_1176_2174 317
79 3300047445 Ga0495677_0003277 Ga0495677_0003277_1165_2163 317
80 iso_pu_bacteria 2896109856 2896113056 317
81 3300005334 Ga0068869_100221212 Ga0068869_1002212122 318
82 3300005345 Ga0070692_10039590 Ga0070692_100395902 318
83 3300005345 Ga0070692_10048759 Ga0070692_100487592 318
84 3300005444 Ga0070694_100000391 Ga0070694_10000039128 318
85 3300005444 Ga0070694_100032084 Ga0070694_1000320843 318
86 3300005549 Ga0070704_100016824 Ga0070704_1000168245 318
87 3300006844 Ga0075428_100063790 Ga0075428_1000637902 318
88 3300009147 Ga0114129_10003091 Ga0114129_1000309117 318
89 3300013306 Ga0163162_10136302 Ga0163162_101363021 318
90 3300025933 Ga0207706_10163959 Ga0207706_101639592 318
91 3300031665 Ga0316575_10001267 Ga0316575_100012676 318
92 3300031727 Ga0316576_10001504 Ga0316576_100015048 318
93 3300031727 Ga0316576_10025852 Ga0316576_100258521 318
94 3300031727 Ga0316576_10162513 Ga0316576_101625131 318
95 3300032133 Ga0316583_10035925 Ga0316583_100359252 318
96 3300032137 Ga0316585_10005495 Ga0316585_100054953 318
97 3300041997 Ga0439431_0002553 Ga0439431_0002553_1552_2526 318
98 3300045049 Ga0466959_0032834 Ga0466959_0032834_2750_3724 318
99 3300045051 Ga0451576_0016111 Ga0451576_0016111_7042_7998 318
100 3300046501 Ga0495607_0036021 Ga0495607_0036021_1086_2096 318
101 3300046689 Ga0495613_0302710 Ga0495613_0302710_93_1058 318
102 3300049571 Ga0501034_0011664 Ga0501034_0011664_7224_8198 318
103 3300049591 Ga0501075_0240967 Ga0501075_0240967_337_1296 318
104 3300049592 Ga0501076_0124213 Ga0501076_0124213_33_992 318
105 3300049743 Ga0501081_0228669 Ga0501081_0228669_255_1214 318
106 3300050507 nmdc:mga05p37_6480_c1 nmdc:mga05p37_6480_c1_7444_8400 318
107 3300050510 nmdc:mga06r32_93509_c1 nmdc:mga06r32_93509_c1_694_1650 318
108 3300060353 Ga0501082_0435401 Ga0501082_0435401_35_994 318
109 3300005365 Ga0070688_100006040 Ga0070688_1000060403 319
110 3300005466 Ga0070685_10017908 Ga0070685_100179083 319
111 3300026088 Ga0207641_10077953 Ga0207641_100779533 319
112 3300031733 Ga0316577_10074412 Ga0316577_100744122 319
113 3300036647 Ga0316582_0008189 Ga0316582_0008189_239_1204 319
114 3300036647 Ga0316582_0045829 Ga0316582_0045829_72_1037 319
115 3300049588 Ga0501072_0078783 Ga0501072_0078783_1200_2168 319
116 3300049591 Ga0501075_0214193 Ga0501075_0214193_336_1304 319
117 3300049592 Ga0501076_0151378 Ga0501076_0151378_673_1641 319
118 3300054114 Ga0501084_0065690 Ga0501084_0065690_1093_2061 319
119 3300060353 Ga0501082_0024762 Ga0501082_0024762_3242_4210 319
120 3300005328 Ga0070676_10032034 Ga0070676_100320343 320
121 3300005471 Ga0070698_100206759 Ga0070698_1002067591 320
122 3300009177 Ga0105248_10556035 Ga0105248_105560351 320
123 3300025941 Ga0207711_10413701 Ga0207711_104137011 320
124 3300028800 Ga0265338_10001154 Ga0265338_100011544 320
125 3300031238 Ga0265332_10002576 Ga0265332_100025765 320
126 3300031247 Ga0265340_10100155 Ga0265340_101001551 320
127 3300031711 Ga0265314_10008084 Ga0265314_100080845 320
128 3300031712 Ga0265342_10025984 Ga0265342_100259843 320
129 3300044712 Ga0453684_0188339 Ga0453684_0188339_1214_2179 320
130 3300048918 Ga0496115_0077783 Ga0496115_0077783_303_1268 320
131 3300053087 Ga0500643_013769 Ga0500643_013769_309_1313 320
132 3300053157 Ga0500624_000329 Ga0500624_000329_6303_7307 320
133 3300053177 Ga0500636_0068734 Ga0500636_0068734_997_2001 320
134 iso_pu_bacteria 2846037992 2846040054 320
135 3300035085 Ga0373929_0000004 Ga0373929_0000004_84428_85417 321
136 3300037471 Ga0395905_0000200 Ga0395905_0000200_56080_57063 321
137 3300053130 Ga0500642_0076069 Ga0500642_0076069_401_1405 321
138 iso_pu_bacteria 2989392574 2989393400 321
139 iso_pu_bacteria 8002392321 8002395693 321
140 3300005445 Ga0070708_100000627 Ga0070708_10000062715 322
141 3300005467 Ga0070706_100131011 Ga0070706_1001310113 322
142 3300005536 Ga0070697_100263566 Ga0070697_1002635661 322
143 3300013105 Ga0157369_10165378 Ga0157369_101653783 322
144 3300021388 Ga0213875_10000028 Ga0213875_100000284 322
145 3300027671 Ga0209588_1047034 Ga0209588_10470342 322
146 3300031691 Ga0316579_10075569 Ga0316579_100755691 322
147 3300037853 Ga0436364_0302973 Ga0436364_0302973_3966_4946 322
148 3300046519 Ga0495632_0094643 Ga0495632_0094643_301_1293 322
149 3300053125 Ga0500618_000364 Ga0500618_000364_28343_29356 322
150 iso_pu_bacteria 2887375801 2887376839 322
151 3300005289 Ga0065704_10095130 Ga0065704_100951302 323
152 3300031238 Ga0265332_10082299 Ga0265332_100822992 323
153 3300031240 Ga0265320_10020014 Ga0265320_100200142 323
154 3300031249 Ga0265339_10109064 Ga0265339_101090641 323
155 3300031595 Ga0265313_10004356 Ga0265313_100043566 323
156 3300031711 Ga0265314_10014186 Ga0265314_100141865 323
157 3300037418 Ga0395900_0070626 Ga0395900_0070626_1387_2376 323
158 3300049571 Ga0501034_0000759 Ga0501034_0000759_863_1870 323
159 3300049590 Ga0501074_0299398 Ga0501074_0299398_45_1052 323
160 iso_pu_bacteria 2808606418 2809145786 323
161 iso_pu_bacteria 2884811622 2884811841 323
162 iso_pu_bacteria 2884836552 2884839832 323
163 iso_pu_bacteria 2884852848 2884856357 323
164 iso_pu_bacteria 2896154374 2896158722 323
165 3300002704 JGI25155J39150_1000125 JGI25155J39150_100012526 324
166 3300002705 JGI25156J39149_1000077 JGI25156J39149_100007734 324
167 3300002705 JGI25156J39149_1005076 JGI25156J39149_10050762 324
168 3300002738 JGI25154J39366_1000103 JGI25154J39366_100010334 324
169 3300002738 JGI25154J39366_1000178 JGI25154J39366_100017811 324
170 3300002741 JGI25157J39369_1000259 JGI25157J39369_100025917 324
171 3300003751 Ga0055538_1000062 Ga0055538_100006225 324
172 3300003752 Ga0055539_1000093 Ga0055539_100009325 324
173 3300003756 Ga0055533_1000105 Ga0055533_100010525 324
174 3300003758 Ga0055532_1000034 Ga0055532_100003474 324
175 3300003759 Ga0055525_1000137 Ga0055525_100013725 324
176 3300003841 Ga0055541_1000063 Ga0055541_100006325 324
177 3300005353 Ga0070669_100089793 Ga0070669_1000897932 324
178 3300005457 Ga0070662_100113641 Ga0070662_1001136412 324
179 3300005539 Ga0068853_100105400 Ga0068853_1001054002 324
180 3300005563 Ga0068855_100034892 Ga0068855_1000348923 324
181 3300005614 Ga0068856_100174553 Ga0068856_1001745532 324
182 3300005616 Ga0068852_100011378 Ga0068852_1000113787 324
183 3300009093 Ga0105240_10000799 Ga0105240_1000079911 324
184 3300009148 Ga0105243_10007754 Ga0105243_100077549 324
185 3300009174 Ga0105241_10078566 Ga0105241_100785662 324
186 3300009551 Ga0105238_10136221 Ga0105238_101362212 324
187 3300009551 Ga0105238_10189307 Ga0105238_101893072 324
188 3300011119 Ga0105246_10160366 Ga0105246_101603662 324
189 3300014497 Ga0182008_10038749 Ga0182008_100387492 324
190 3300021361 Ga0213872_10003077 Ga0213872_100030771 324
191 3300025206 Ga0209435_100007 Ga0209435_10000774 324
192 3300025206 Ga0209435_100444 Ga0209435_1004442 324
193 3300025224 Ga0209784_100021 Ga0209784_100021315 324
194 3300025225 Ga0209566_100119 Ga0209566_10011967 324
195 3300025226 Ga0209674_100036 Ga0209674_100036315 324
196 3300025229 Ga0209147_100017 Ga0209147_100017398 324
197 3300025230 Ga0209563_100040 Ga0209563_100040315 324
198 3300025242 Ga0209258_100115 Ga0209258_10011563 324
199 3300025246 Ga0209646_1000044 Ga0209646_1000044239 324
200 3300025246 Ga0209646_1000107 Ga0209646_100010766 324
201 3300025250 Ga0209026_1000063 Ga0209026_100006374 324
202 3300025250 Ga0209026_1002436 Ga0209026_10024365 324
203 3300025253 Ga0209677_100023 Ga0209677_100023315 324
204 3300025256 Ga0209759_1000048 Ga0209759_100004874 324
205 3300025256 Ga0209759_1000198 Ga0209759_100019811 324
206 3300025272 Ga0209455_1007850 Ga0209455_10078502 324
207 3300025909 Ga0207705_10001882 Ga0207705_100018826 324
208 3300025911 Ga0207654_10008227 Ga0207654_100082272 324
209 3300025913 Ga0207695_10001014 Ga0207695_100010146 324
210 3300025920 Ga0207649_10029056 Ga0207649_100290562 324
211 3300025924 Ga0207694_10163767 Ga0207694_101637672 324
212 3300025933 Ga0207706_10095462 Ga0207706_100954622 324
213 3300025934 Ga0207686_10090618 Ga0207686_100906182 324
214 3300025935 Ga0207709_10008958 Ga0207709_100089582 324
215 3300025940 Ga0207691_10248230 Ga0207691_102482301 324
216 3300025945 Ga0207679_10188862 Ga0207679_101888621 324
217 3300025949 Ga0207667_10049646 Ga0207667_100496462 324
218 3300026089 Ga0207648_10080697 Ga0207648_100806972 324
219 3300026116 Ga0207674_10047425 Ga0207674_100474252 324
220 3300026116 Ga0207674_10259855 Ga0207674_102598552 324
221 3300026142 Ga0207698_10002135 Ga0207698_1000213513 324
222 3300037312 Ga0395899_0031221 Ga0395899_0031221_2853_3851 324
223 3300037312 Ga0395899_0039535 Ga0395899_0039535_71_1069 324
224 3300037418 Ga0395900_0002597 Ga0395900_0002597_3744_4742 324
225 3300037466 Ga0395898_0037552 Ga0395898_0037552_1110_2108 324
226 3300037466 Ga0395898_0144000 Ga0395898_0144000_1163_2161 324
227 3300037466 Ga0395898_0162354 Ga0395898_0162354_383_1381 324
228 3300037466 Ga0395898_0187657 Ga0395898_0187657_92_1114 324
229 3300037471 Ga0395905_0102524 Ga0395905_0102524_242_1240 324
230 3300038443 Ga0395901_0001076 Ga0395901_0001076_3744_4742 324
231 3300038443 Ga0395901_0095841 Ga0395901_0095841_1959_2981 324
232 3300038443 Ga0395901_0173565 Ga0395901_0173565_223_1245 324
233 3300038443 Ga0395901_0211257 Ga0395901_0211257_974_1972 324
234 3300039447 Ga0436361_0951855 Ga0436361_0951855_6409_7437 324
235 3300042005 Ga0439448_0003545 Ga0439448_0003545_816_1814 324
236 3300042008 Ga0439450_011105 Ga0439450_011105_68_1090 324
237 3300042876 Ga0451577_0240267 Ga0451577_0240267_441_1427 324
238 3300044684 Ga0466966_0022675 Ga0466966_0022675_816_1814 324
239 3300044712 Ga0453684_0006851 Ga0453684_0006851_9535_10521 324
240 3300045836 Ga0466958_0080704 Ga0466958_0080704_251_1249 324
241 3300045976 Ga0466967_0025158 Ga0466967_0025158_1925_2923 324
242 3300046452 Ga0495617_000027 Ga0495617_000027_120484_121482 324
243 3300046453 Ga0495627_000277 Ga0495627_000277_24625_25623 324
244 3300046457 Ga0495590_0000053 Ga0495590_0000053_83566_84564 324
245 3300046457 Ga0495590_0002275 Ga0495590_0002275_2086_3108 324
246 3300046457 Ga0495590_0079368 Ga0495590_0079368_14_1012 324
247 3300046458 Ga0495591_000500 Ga0495591_000500_3958_4956 324
248 3300046458 Ga0495591_010151 Ga0495591_010151_537_1535 324
249 3300046463 Ga0495653_0052356 Ga0495653_0052356_2027_3025 324
250 3300046471 Ga0495650_0000431 Ga0495650_0000431_27572_28636 324
251 3300046471 Ga0495650_0000582 Ga0495650_0000582_10867_11865 324
252 3300046471 Ga0495650_0011511 Ga0495650_0011511_1422_2420 324
253 3300046472 Ga0495580_0065881 Ga0495580_0065881_1083_2081 324
254 3300046473 Ga0495582_0003170 Ga0495582_0003170_7385_8383 324
255 3300046474 Ga0495605_0000135 Ga0495605_0000135_35832_36830 324
256 3300046474 Ga0495605_0012191 Ga0495605_0012191_2602_3600 324
257 3300046474 Ga0495605_0015501 Ga0495605_0015501_1920_2918 324
258 3300046474 Ga0495605_0020640 Ga0495605_0020640_415_1437 324
259 3300046474 Ga0495605_0026339 Ga0495605_0026339_662_1660 324
260 3300046474 Ga0495605_0035842 Ga0495605_0035842_206_1204 324
261 3300046474 Ga0495605_0049840 Ga0495605_0049840_169_1167 324
262 3300046491 Ga0495584_0000713 Ga0495584_0000713_9549_10571 324
263 3300046491 Ga0495584_0002767 Ga0495584_0002767_4876_5874 324
264 3300046491 Ga0495584_0004737 Ga0495584_0004737_5112_6110 324
265 3300046491 Ga0495584_0087823 Ga0495584_0087823_35_1057 324
266 3300046492 Ga0495585_0000466 Ga0495585_0000466_11034_12032 324
267 3300046492 Ga0495585_0008237 Ga0495585_0008237_2366_3364 324
268 3300046492 Ga0495585_0012462 Ga0495585_0012462_2118_3116 324
269 3300046492 Ga0495585_0042221 Ga0495585_0042221_1200_2198 324
270 3300046500 Ga0495596_0007978 Ga0495596_0007978_1704_2702 324
271 3300046500 Ga0495596_0015867 Ga0495596_0015867_2102_3100 324
272 3300046500 Ga0495596_0025519 Ga0495596_0025519_279_1277 324
273 3300046501 Ga0495607_0000264 Ga0495607_0000264_307_1305 324
274 3300046501 Ga0495607_0002410 Ga0495607_0002410_6767_7789 324
275 3300046501 Ga0495607_0013419 Ga0495607_0013419_3103_4101 324
276 3300046506 Ga0495583_0002349 Ga0495583_0002349_11385_12383 324
277 3300046506 Ga0495583_0010812 Ga0495583_0010812_131_1153 324
278 3300046506 Ga0495583_0013027 Ga0495583_0013027_1146_2144 324
279 3300046506 Ga0495583_0051393 Ga0495583_0051393_838_1836 324
280 3300046506 Ga0495583_0055998 Ga0495583_0055998_120_1118 324
281 3300046506 Ga0495583_0062646 Ga0495583_0062646_509_1507 324
282 3300046507 Ga0495606_0001657 Ga0495606_0001657_2569_3597 324
283 3300046507 Ga0495606_0004035 Ga0495606_0004035_2759_3844 324
284 3300046507 Ga0495606_0006559 Ga0495606_0006559_4898_5962 324
285 3300046507 Ga0495606_0123590 Ga0495606_0123590_22_1020 324
286 3300046507 Ga0495606_0137678 Ga0495606_0137678_68_1066 324
287 3300046512 Ga0495610_0007656 Ga0495610_0007656_1931_2929 324
288 3300046512 Ga0495610_0060696 Ga0495610_0060696_669_1667 324
289 3300046513 Ga0495616_0000333 Ga0495616_0000333_3803_4801 324
290 3300046513 Ga0495616_0003764 Ga0495616_0003764_1693_2691 324
291 3300046513 Ga0495616_0018132 Ga0495616_0018132_782_1780 324
292 3300046513 Ga0495616_0044418 Ga0495616_0044418_750_1772 324
293 3300046513 Ga0495616_0131892 Ga0495616_0131892_20_1018 324
294 3300046517 Ga0495630_0051331 Ga0495630_0051331_498_1496 324
295 3300046518 Ga0495631_0001600 Ga0495631_0001600_5274_6272 324
296 3300046518 Ga0495631_0002985 Ga0495631_0002985_2564_3562 324
297 3300046518 Ga0495631_0010049 Ga0495631_0010049_641_1639 324
298 3300046519 Ga0495632_0000069 Ga0495632_0000069_22299_23297 324
299 3300046519 Ga0495632_0000177 Ga0495632_0000177_19335_20333 324
300 3300046519 Ga0495632_0003331 Ga0495632_0003331_2139_3137 324
301 3300046519 Ga0495632_0012042 Ga0495632_0012042_310_1308 324
302 3300046519 Ga0495632_0024295 Ga0495632_0024295_709_1719 324
303 3300046520 Ga0495637_0000053 Ga0495637_0000053_90485_91483 324
304 3300046520 Ga0495637_0006479 Ga0495637_0006479_3083_4081 324
305 3300046522 Ga0495643_0005232 Ga0495643_0005232_5677_6675 324
306 3300046522 Ga0495643_0012850 Ga0495643_0012850_67_1065 324
307 3300046523 Ga0495644_0001533 Ga0495644_0001533_2213_3211 324
308 3300046523 Ga0495644_0025951 Ga0495644_0025951_925_1923 324
309 3300046524 Ga0495648_0005653 Ga0495648_0005653_7965_8963 324
310 3300046524 Ga0495648_0012325 Ga0495648_0012325_2036_3034 324
311 3300046524 Ga0495648_0022662 Ga0495648_0022662_1286_2284 324
312 3300046524 Ga0495648_0027822 Ga0495648_0027822_533_1555 324
313 3300046526 Ga0495666_0000177 Ga0495666_0000177_12144_13142 324
314 3300046528 Ga0495642_0000137 Ga0495642_0000137_35512_36510 324
315 3300046528 Ga0495642_0000441 Ga0495642_0000441_5424_6422 324
316 3300046528 Ga0495642_0004645 Ga0495642_0004645_4215_5213 324
317 3300046528 Ga0495642_0014293 Ga0495642_0014293_246_1244 324
318 3300046528 Ga0495642_0061333 Ga0495642_0061333_67_1089 324
319 3300046528 Ga0495642_0082240 Ga0495642_0082240_321_1319 324
320 3300046529 Ga0495652_0005568 Ga0495652_0005568_5705_6703 324
321 3300046530 Ga0495654_0049964 Ga0495654_0049964_855_1853 324
322 3300046531 Ga0495665_0005443 Ga0495665_0005443_5095_6093 324
323 3300046533 Ga0495640_0049509 Ga0495640_0049509_1775_2773 324
324 3300046538 Ga0495609_0000007 Ga0495609_0000007_313735_314757 324
325 3300046538 Ga0495609_0001446 Ga0495609_0001446_7907_8905 324
326 3300046538 Ga0495609_0002140 Ga0495609_0002140_10247_11245 324
327 3300046538 Ga0495609_0009229 Ga0495609_0009229_1180_2202 324
328 3300046538 Ga0495609_0010787 Ga0495609_0010787_597_1619 324
329 3300046538 Ga0495609_0028195 Ga0495609_0028195_809_1807 324
330 3300046538 Ga0495609_0031899 Ga0495609_0031899_1207_2205 324
331 3300046538 Ga0495609_0045456 Ga0495609_0045456_158_1156 324
332 3300046538 Ga0495609_0046233 Ga0495609_0046233_918_1916 324
333 3300046538 Ga0495609_0063852 Ga0495609_0063852_165_1163 324
334 3300046542 Ga0495597_0000348 Ga0495597_0000348_21529_22551 324
335 3300046542 Ga0495597_0001336 Ga0495597_0001336_7166_8164 324
336 3300046542 Ga0495597_0010005 Ga0495597_0010005_1363_2361 324
337 3300046542 Ga0495597_0016854 Ga0495597_0016854_1415_2413 324
338 3300046542 Ga0495597_0037849 Ga0495597_0037849_172_1194 324
339 3300046543 Ga0495645_0064044 Ga0495645_0064044_1271_2269 324
340 3300046558 Ga0495633_0002729 Ga0495633_0002729_4612_5610 324
341 3300046558 Ga0495633_0013804 Ga0495633_0013804_1599_2597 324
342 3300046616 Ga0495668_0000962 Ga0495668_0000962_11218_12240 324
343 3300046616 Ga0495668_0001492 Ga0495668_0001492_19176_20174 324
344 3300046616 Ga0495668_0001879 Ga0495668_0001879_8845_9843 324
345 3300046616 Ga0495668_0004143 Ga0495668_0004143_7178_8176 324
346 3300046616 Ga0495668_0012875 Ga0495668_0012875_462_1484 324
347 3300046642 Ga0495634_0019868 Ga0495634_0019868_2047_3045 324
348 3300046648 Ga0495611_0000271 Ga0495611_0000271_30501_31523 324
349 3300046648 Ga0495611_0013322 Ga0495611_0013322_1597_2595 324
350 3300046648 Ga0495611_0015525 Ga0495611_0015525_873_1871 324
351 3300046648 Ga0495611_0026123 Ga0495611_0026123_1104_2102 324
352 3300046660 Ga0495625_0000428 Ga0495625_0000428_38265_39293 324
353 3300046660 Ga0495625_0023402 Ga0495625_0023402_3617_4615 324
354 3300046660 Ga0495625_0068150 Ga0495625_0068150_1079_2077 324
355 3300046660 Ga0495625_0107901 Ga0495625_0107901_555_1553 324
356 3300046663 Ga0495635_0005841 Ga0495635_0005841_2128_3126 324
357 3300046665 Ga0495661_0000549 Ga0495661_0000549_23314_24312 324
358 3300046665 Ga0495661_0000776 Ga0495661_0000776_15587_16609 324
359 3300046665 Ga0495661_0001219 Ga0495661_0001219_18053_19075 324
360 3300046665 Ga0495661_0002786 Ga0495661_0002786_2297_3295 324
361 3300046674 Ga0495588_0004898 Ga0495588_0004898_2387_3385 324
362 3300046674 Ga0495588_0010935 Ga0495588_0010935_3141_4139 324
363 3300046679 Ga0495623_0028737 Ga0495623_0028737_456_1454 324
364 3300046684 Ga0495669_0000073 Ga0495669_0000073_31750_32748 324
365 3300046684 Ga0495669_0015135 Ga0495669_0015135_421_1419 324
366 3300046684 Ga0495669_0054349 Ga0495669_0054349_44_1066 324
367 3300046689 Ga0495613_0043544 Ga0495613_0043544_92_1090 324
368 3300046690 Ga0495624_0095323 Ga0495624_0095323_622_1620 324
369 3300046691 Ga0495670_0002459 Ga0495670_0002459_5842_6840 324
370 3300046691 Ga0495670_0004392 Ga0495670_0004392_5221_6219 324
371 3300046692 Ga0495671_0002956 Ga0495671_0002956_7132_8130 324
372 3300046694 Ga0495649_0000291 Ga0495649_0000291_17486_18484 324
373 3300046694 Ga0495649_0058310 Ga0495649_0058310_566_1564 324
374 3300046694 Ga0495649_0060986 Ga0495649_0060986_874_1872 324
375 3300046794 Ga0495589_0000081 Ga0495589_0000081_9985_11007 324
376 3300046794 Ga0495589_0001934 Ga0495589_0001934_3673_4671 324
377 3300046794 Ga0495589_0002218 Ga0495589_0002218_5241_6263 324
378 3300046794 Ga0495589_0013992 Ga0495589_0013992_2088_3086 324
379 3300046794 Ga0495589_0017042 Ga0495589_0017042_1204_2202 324
380 3300046809 Ga0495600_0056858 Ga0495600_0056858_778_1776 324
381 3300046810 Ga0495660_0021954 Ga0495660_0021954_1484_2506 324
382 3300047317 Ga0495604_0011966 Ga0495604_0011966_729_1727 324
383 3300047317 Ga0495604_0061195 Ga0495604_0061195_723_1721 324
384 3300047318 Ga0495636_0043791 Ga0495636_0043791_586_1608 324
385 3300047320 Ga0495672_0000135 Ga0495672_0000135_88426_89424 324
386 3300047320 Ga0495672_0000340 Ga0495672_0000340_37083_38081 324
387 3300047320 Ga0495672_0016966 Ga0495672_0016966_2404_3402 324
388 3300047320 Ga0495672_0101384 Ga0495672_0101384_537_1535 324
389 3300047321 Ga0495676_0000221 Ga0495676_0000221_7918_8916 324
390 3300047322 Ga0495680_0032272 Ga0495680_0032272_2586_3584 324
391 3300047322 Ga0495680_0049292 Ga0495680_0049292_1350_2348 324
392 3300047323 Ga0495683_0001222 Ga0495683_0001222_11386_12384 324
393 3300047323 Ga0495683_0031965 Ga0495683_0031965_234_1232 324
394 3300047443 Ga0495687_000030 Ga0495687_000030_137402_138400 324
395 3300047443 Ga0495687_000120 Ga0495687_000120_58414_59436 324
396 3300047443 Ga0495687_000374 Ga0495687_000374_26295_27293 324
397 3300047443 Ga0495687_002025 Ga0495687_002025_9841_10839 324
398 3300047444 Ga0495675_0011591 Ga0495675_0011591_4082_5080 324
399 3300047445 Ga0495677_0000045 Ga0495677_0000045_66207_67229 324
400 3300047445 Ga0495677_0000387 Ga0495677_0000387_16701_17699 324
401 3300047445 Ga0495677_0003624 Ga0495677_0003624_2757_3755 324
402 3300047445 Ga0495677_0028312 Ga0495677_0028312_488_1486 324
403 3300047446 Ga0495679_015610 Ga0495679_015610_834_1832 324
404 3300047470 Ga0495681_0000978 Ga0495681_0000978_19057_20055 324
405 3300047470 Ga0495681_0002791 Ga0495681_0002791_6673_7671 324
406 3300047470 Ga0495681_0011838 Ga0495681_0011838_2098_3096 324
407 3300047470 Ga0495681_0043463 Ga0495681_0043463_310_1308 324
408 3300047472 Ga0495686_0000793 Ga0495686_0000793_6581_7579 324
409 3300047472 Ga0495686_0000802 Ga0495686_0000802_10371_11369 324
410 3300047472 Ga0495686_0017592 Ga0495686_0017592_2229_3227 324
411 3300047472 Ga0495686_0038936 Ga0495686_0038936_428_1576 324
412 3300048088 Ga0495602_0019975 Ga0495602_0019975_3307_4305 324
413 3300048089 Ga0495614_0005047 Ga0495614_0005047_1718_2716 324
414 3300048091 Ga0495626_0000105 Ga0495626_0000105_79333_80343 324
415 3300048091 Ga0495626_0001251 Ga0495626_0001251_13168_14166 324
416 3300048091 Ga0495626_0003522 Ga0495626_0003522_2456_3454 324
417 3300048091 Ga0495626_0005746 Ga0495626_0005746_1290_2288 324
418 3300048091 Ga0495626_0009393 Ga0495626_0009393_2504_3502 324
419 3300048091 Ga0495626_0010538 Ga0495626_0010538_1398_2396 324
420 3300048091 Ga0495626_0020582 Ga0495626_0020582_1048_2046 324
421 3300048091 Ga0495626_0037534 Ga0495626_0037534_402_1424 324
422 3300048091 Ga0495626_0075393 Ga0495626_0075393_285_1283 324
423 3300048905 Ga0496102_0002351 Ga0496102_0002351_2553_3551 324
424 3300048908 Ga0496105_0287472 Ga0496105_0287472_47_1045 324
425 3300048913 Ga0496110_0000462 Ga0496110_0000462_17218_18216 324
426 3300048913 Ga0496110_0038136 Ga0496110_0038136_1177_2199 324
427 3300048914 Ga0496111_0072628 Ga0496111_0072628_1135_2157 324
428 3300048918 Ga0496115_0019484 Ga0496115_0019484_2127_3125 324
429 3300048919 Ga0496116_0003824 Ga0496116_0003824_5480_6508 324
430 3300048925 Ga0496122_0000570 Ga0496122_0000570_38088_39116 324
431 3300048925 Ga0496122_0004067 Ga0496122_0004067_10852_11850 324
432 3300048926 Ga0496123_0000438 Ga0496123_0000438_37290_38318 324
433 3300048926 Ga0496123_0001939 Ga0496123_0001939_18452_19450 324
434 3300048926 Ga0496123_0006950 Ga0496123_0006950_3893_4915 324
435 3300048927 Ga0496124_0024256 Ga0496124_0024256_1255_2253 324
436 3300048927 Ga0496124_0044307 Ga0496124_0044307_2023_3045 324
437 3300048927 Ga0496124_0112084 Ga0496124_0112084_775_1797 324
438 3300048927 Ga0496124_0241723 Ga0496124_0241723_34_1032 324
439 3300048928 Ga0496125_0000701 Ga0496125_0000701_4698_5726 324
440 3300048928 Ga0496125_0005434 Ga0496125_0005434_4670_5668 324
441 3300048928 Ga0496125_0084626 Ga0496125_0084626_472_1500 324
442 3300048928 Ga0496125_0112664 Ga0496125_0112664_89_1099 324
443 3300049459 Ga0495678_000190 Ga0495678_000190_33264_34262 324
444 3300049459 Ga0495678_000831 Ga0495678_000831_25966_26988 324
445 3300049459 Ga0495678_001754 Ga0495678_001754_10747_11745 324
446 3300049459 Ga0495678_002868 Ga0495678_002868_8037_9035 324
447 3300049460 Ga0495682_0000714 Ga0495682_0000714_16677_17675 324
448 3300049460 Ga0495682_0007243 Ga0495682_0007243_1144_2142 324
449 3300049460 Ga0495682_0033712 Ga0495682_0033712_832_1830 324
450 iso_pu_bacteria 2511231003 2511248563 324
451 iso_pu_bacteria 2521172590 2521559905 324
452 iso_pu_bacteria 2548876994 2550694927 324
453 iso_pu_bacteria 2551306416 2553006960 324
454 iso_pu_bacteria 2739367655 2739611456 324
455 iso_pu_bacteria 2765235838 2765571142 324
456 iso_pu_bacteria 2808606386 2808982682 324
457 iso_pu_bacteria 2808606415 2809130183 324
458 iso_pu_bacteria 2808606419 2809150340 324
459 iso_pu_bacteria 2818991445 2819594004 324
460 iso_pu_bacteria 2818991449 2819618206 324
461 iso_pu_bacteria 2852618963 2852621437 324
462 iso_pu_bacteria 2923510766 2923513679 324
463 2162886007 SwRhRL2b_contig_81665 SwRhRL2b_0022.00005080 326
464 3300005289 Ga0065704_10097852 Ga0065704_100978523 326
465 3300031824 Ga0307413_10262172 Ga0307413_102621722 326
466 3300031852 Ga0307410_10120942 Ga0307410_101209423 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01380

SIS

SIS domain

98

230

0.98

PF00571

CBS

CBS domain

326

382

0.93

PF00571

CBS

CBS domain

259

317

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xhz-assembly1.cif.gz_B probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography 0.9846 6 178
2xhz-assembly1.cif.gz_B probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography 0.9735 6 178
3fxa-assembly1.cif.gz_D crystal structure of a putative sugar-phosphate isomerase (lmof2365_0531) from listeria monocytogenes str. 4b f2365 at 1.60 a resolution 0.9718 1 190
5uqi-assembly1.cif.gz_A e. coli cft073 c3406 in complex with a5p 0.9685 2 189
5uqi-assembly1.cif.gz_A e. coli cft073 c3406 in complex with a5p 0.9635 2 189
ID Description Score Start End Superfamily
af_P45395_11_201_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9909 7 195 3.40.50.10490
af_P17115_194_318_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9777 198 322 3.10.580.10
af_P45395_11_201_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9756 7 195 3.40.50.10490
5vhuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9694 2 189 3.40.50.10490
5vhuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9644 2 189 3.40.50.10490
ID Description Score Start End GO Terms
AF-A0A7C1G239-F1-model_v4 SIS domain-containing protein 0.9948 8 110 GO:0097367
GO:1901135
AF-A0A656SJ60-F1-model_v4 deleted 0.9915 40 121
AF-A0A5C9ADZ1-F1-model_v4 KpsF/GutQ family sugar-phosphate isomerase 0.9913 3 191 GO:0005975
GO:0016853
GO:0097367
GO:1901135
AF-A0A4V2AMI0-F1-model_v4 SIS domain-containing protein 0.9856 18 163 GO:0097367
GO:1901135
AF-A0A7G3ELT6-F1-model_v4 deleted 0.984 3 189

Feature Viewer

pLDDT pTM Quality
93.15 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map