F449700

General Info

Members Datasets Scaffolds Average Seq Length
466 263 443 212

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0000514|Ga0395905_0000514_49494_50195
Length 233
Sequence MMSSRSLAEVSMSDFPADIYTEPSDIDVFTLDNLGPLRRMAGVWEGRRGLDVKPKAEGPRKQAYVERIELQPVDPVTNGPQLLYGLRYHVHVVKPDQVKTYHDQVGYWLWEPATGTVIQTLAIPRGQIAMASGQAAADATSFELVATLGSQNYGICSNPFLEYGFKTVEYRIKVTINEDGTWSYDEDTVMMIKGKDEPFHHTDRNLLSKVAEPTPNPLALQWAAAKQSEKGSA

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
4 2643221638 Duganella sp. Root336D2 Isolate Unclassified
5 2643221645 Massilia sp. Root351 Isolate Unclassified
6 2643221664 Massilia sp. Root418 Isolate Unclassified
7 2738541280 Massilia sp. GV090 Isolate Unclassified
8 2738541297 Duganella sp. GV083 Isolate Unclassified
9 2738541300 Massilia sp. GV016 Isolate Unclassified
10 2738541357 Duganella sp. GV053 Isolate Unclassified
11 2738543003 Duganella sp. GV066 Isolate Unclassified
12 2738543018 Massilia sp. GV045 Isolate Unclassified
13 2738543026 Duganella sp. GV089 Isolate Unclassified
14 2738543029 Duganella sp. GV039 Isolate Unclassified
15 2738543030 Massilia sp. GV097 Isolate Unclassified
16 2821131069 Duganella sp. 1224 Isolate Unclassified
17 2842711865 Duganella sp. R-73148 Isolate Unclassified
18 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
19 2857558681 Duganella sp. R-74565 Isolate Unclassified
20 2857564685 Duganella sp. R-74599 Isolate Unclassified
21 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
22 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
23 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
24 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
25 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
26 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
27 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
28 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
29 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
30 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
31 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
32 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
35 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
94 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
95 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
136 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
182 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
189 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
190 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
193 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
196 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
197 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
200 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
206 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
214 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
215 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
220 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
221 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
222 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
223 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
224 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
225 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
228 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
229 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
230 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
231 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
232 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
233 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
234 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
245 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
250 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
251 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
260 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
261 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
262 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.06
Metatranscriptomes 0
Isolates 4.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.32
Nodule 0.43
Rhizoplane 1.5
Rhizosphere 65.24
Stem 0
Stem Tuber 0
Unclassified 10.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000433 3300002739 Bacteria 8676
2 JGI25158J39367_1000642 3300002739 Bacteria 6890
3 JGI25152J39213_1000105 3300002773 Bacteria 58863
4 JGI25150J39212_1000374 3300002774 Bacteria 21577
5 JGI25150J39212_1004353 3300002774 Bacteria 3162
6 JGI25159J45721_1000762 3300002987 Bacteria 13974
7 JGI25159J45721_1001061 3300002987 Bacteria 11738
8 JGI25159J45721_1001736 3300002987 Bacteria 8781
9 JGI25160J50197_1001081 3300003354 Bacteria 13974
10 JGI25161J50226_1000453 3300003374 Bacteria 19004
11 JGI25161J50226_1000724 3300003374 Bacteria 12794
12 Ga0055529_1000842 3300003763 Bacteria 18017
13 Ga0055526_1000001 3300003771 Bacteria 669703
14 Ga0055526_1000044 3300003771 Bacteria 123028
15 Ga0055526_1000121 3300003771 Bacteria 68852
16 Ga0055526_1005778 3300003771 Bacteria 6973
17 Ga0055537_1000179 3300003773 Bacteria 47132
18 Ga0055537_1002355 3300003773 Bacteria 6417
19 Ga0055537_1009830 3300003773 Bacteria 2069
20 Ga0055537_1013095 3300003773 Bacteria 1576
21 Ga0055524_1000008 3300003775 Bacteria 297761
22 Ga0055524_1003549 3300003775 Bacteria 7533
23 Ga0055524_1007473 3300003775 Bacteria 4633
24 Ga0055524_1022867 3300003775 Bacteria 2028
25 Ga0055524_1030376 3300003775 Bacteria 1577
26 Ga0055534_1000495 3300003784 Bacteria 21714
27 Ga0055534_1002232 3300003784 Bacteria 6854
28 Ga0055528_1000119 3300003790 Bacteria 62428
29 Ga0055530_10001373 3300003791 Bacteria 18061
30 Ga0055530_10002288 3300003791 Bacteria 12570
31 Ga0055530_10002362 3300003791 Bacteria 12255
32 Ga0055530_10044085 3300003791 Bacteria 1072
33 Ga0055531_10000001 3300003794 Bacteria 543586
34 Ga0055531_10000577 3300003794 Bacteria 31960
35 Ga0055531_10034459 3300003794 Bacteria 1606
36 Ga0055543_1000915 3300004625 Bacteria 13778
37 Ga0055543_1005198 3300004625 Bacteria 3368
38 Ga0065165_1000039 3300005262 Bacteria 208372
39 Ga0065165_1001994 3300005262 Bacteria 19150
40 Ga0065165_1019521 3300005262 Bacteria 2416
41 Ga0070677_10097995 3300005333 Bacteria 1287
42 Ga0068869_100264229 3300005334 Bacteria 1378
43 Ga0070680_100263286 3300005336 Bacteria 1459
44 Ga0068868_100027338 3300005338 Bacteria 4352
45 Ga0070675_100282177 3300005354 Unclassified 1460
46 Ga0070688_100109151 3300005365 Bacteria 1837
47 Ga0070659_100224779 3300005366 Bacteria 1550
48 Ga0070711_100061192 3300005439 Bacteria 2620
49 Ga0070711_100193944 3300005439 Bacteria 1563
50 Ga0070711_100319379 3300005439 Bacteria 1240
51 Ga0070708_100028362 3300005445 Bacteria 4817
52 Ga0070708_100051280 3300005445 Bacteria 3656
53 Ga0070708_100102743 3300005445 Bacteria 2619
54 Ga0070708_100567122 3300005445 Bacteria 1070
55 Ga0070685_10398007 3300005466 Bacteria 953
56 Ga0070706_100012860 3300005467 Bacteria 7747
57 Ga0070706_100109660 3300005467 Bacteria 2568
58 Ga0070706_100366306 3300005467 Bacteria 1343
59 Ga0070707_100117646 3300005468 Bacteria 2579
60 Ga0070707_100132263 3300005468 Bacteria 2426
61 Ga0070699_100028026 3300005518 Bacteria 4857
62 Ga0070699_100218664 3300005518 Bacteria 1697
63 Ga0070684_100368097 3300005535 Bacteria 1323
64 Ga0070697_100088421 3300005536 Bacteria 2558
65 Ga0070697_100116978 3300005536 Bacteria 2227
66 Ga0070697_100810016 3300005536 Bacteria 829
67 Ga0068853_100001996 3300005539 Bacteria 15071
68 Ga0068855_100074210 3300005563 Bacteria 3951
69 Ga0070664_100193046 3300005564 Bacteria 1815
70 Ga0068857_100019597 3300005577 Bacteria 5942
71 Ga0068857_100433342 3300005577 Bacteria 1227
72 Ga0068856_100074508 3300005614 Bacteria 3361
73 Ga0068859_100453382 3300005617 Bacteria 1379
74 Ga0068861_100148602 3300005719 Bacteria 1920
75 Ga0068863_100075810 3300005841 Bacteria 3182
76 Ga0068860_100493470 3300005843 Bacteria 1222
77 Ga0075364_10033118 3300006051 Bacteria 3325
78 Ga0070715_10008599 3300006163 Bacteria 3564
79 Ga0070716_100174065 3300006173 Bacteria 1407
80 Ga0075366_10017778 3300006195 Bacteria 4099
81 Ga0075366_10024860 3300006195 Bacteria 3494
82 Ga0075366_10277437 3300006195 Bacteria 1024
83 Ga0097621_100214579 3300006237 Bacteria 1675
84 Ga0075370_10001791 3300006353 Bacteria 9601
85 Ga0075370_10011909 3300006353 Bacteria 4582
86 Ga0075370_10117740 3300006353 Bacteria 1545
87 Ga0075433_10144710 3300006852 Bacteria 2113
88 Ga0075434_100105972 3300006871 Bacteria 2821
89 Ga0097620_100453389 3300006931 Bacteria 1379
90 Ga0099826_10000001 3300006948 Bacteria 1155201
91 Ga0105244_10012653 3300009036 Bacteria 4976
92 Ga0105240_10013078 3300009093 Bacteria 11423
93 Ga0114129_11162059 3300009147 Bacteria 963
94 Ga0105242_10032773 3300009176 Bacteria 4156
95 Ga0105248_10063055 3300009177 Bacteria 4160
96 Ga0105237_10170343 3300009545 Bacteria 2177
97 Ga0105238_10342593 3300009551 Bacteria 1483
98 Ga0105249_10221386 3300009553 Bacteria 1862
99 Ga0105239_10082983 3300010375 Bacteria 3529
100 Ga0157374_10100375 3300013296 Bacteria 2774
101 Ga0157378_10319146 3300013297 Bacteria 1509
102 Ga0163162_10599300 3300013306 Bacteria 1228
103 Ga0157375_10080510 3300013308 Bacteria 3295
104 Ga0157375_10346020 3300013308 Bacteria 1652
105 Ga0157375_10959511 3300013308 Bacteria 996
106 Ga0157379_10002612 3300014968 Bacteria 15142
107 Ga0163161_10054909 3300017792 Bacteria 2891
108 Ga0213872_10000001 3300021361 Bacteria 662532
109 Ga0213872_10000298 3300021361 Bacteria 42359
110 Ga0213872_10011901 3300021361 Bacteria 4108
111 Ga0213872_10014015 3300021361 Bacteria 3747
112 Ga0213872_10017423 3300021361 Bacteria 3320
113 Ga0209436_100049 3300025208 Bacteria 66162
114 Ga0209436_100093 3300025208 Bacteria 44019
115 Ga0209672_105915 3300025228 Bacteria 2048
116 Ga0209258_107918 3300025242 Bacteria 1538
117 Ga0207425_1000001 3300025245 Bacteria 2525432
118 Ga0207425_1000033 3300025245 Bacteria 245540
119 Ga0207425_1000159 3300025245 Bacteria 57245
120 Ga0207425_1018671 3300025245 Bacteria 1502
121 Ga0209646_1000054 3300025246 Bacteria 279447
122 Ga0209026_1003541 3300025250 Bacteria 5059
123 Ga0209026_1010849 3300025250 Bacteria 1675
124 Ga0209129_1000003 3300025258 Bacteria 903689
125 Ga0209129_1002851 3300025258 Bacteria 7988
126 Ga0209565_1000003 3300025263 Bacteria 1099648
127 Ga0209565_1000162 3300025263 Bacteria 89049
128 Ga0209565_1000383 3300025263 Bacteria 37599
129 Ga0209565_1000474 3300025263 Bacteria 29679
130 Ga0209565_1003186 3300025263 Bacteria 5440
131 Ga0209565_1005728 3300025263 Bacteria 3577
132 Ga0209455_1000359 3300025272 Bacteria 42537
133 Ga0209673_1000003 3300025273 Bacteria 980859
134 Ga0209673_1023046 3300025273 Bacteria 2131
135 Ga0209130_1000084 3300025284 Bacteria 160070
136 Ga0209130_1000438 3300025284 Bacteria 44389
137 Ga0209130_1001623 3300025284 Bacteria 13881
138 Ga0209675_1000003 3300025291 Bacteria 1003982
139 Ga0209675_1000713 3300025291 Bacteria 22701
140 Ga0209675_1002356 3300025291 Bacteria 9756
141 Ga0209675_1003385 3300025291 Bacteria 7601
142 Ga0209675_1032517 3300025291 Bacteria 1220
143 Ga0209025_1009036 3300025294 Bacteria 7030
144 Ga0209564_1000002 3300025295 Bacteria 1636803
145 Ga0209564_1000011 3300025295 Bacteria 822327
146 Ga0209564_1000012 3300025295 Bacteria 792078
147 Ga0209564_1000095 3300025295 Bacteria 237896
148 Ga0209564_1005141 3300025295 Bacteria 7602
149 Ga0209564_1019883 3300025295 Bacteria 2487
150 Ga0209758_1000041 3300025297 Bacteria 410328
151 Ga0209050_1000011 3300025298 Bacteria 914037
152 Ga0209050_1000138 3300025298 Bacteria 173923
153 Ga0209050_1002638 3300025298 Bacteria 14724
154 Ga0209050_1009076 3300025298 Bacteria 5165
155 Ga0209256_1000005 3300025299 Bacteria 1315082
156 Ga0209256_1000068 3300025299 Bacteria 246064
157 Ga0209256_1000255 3300025299 Bacteria 94783
158 Ga0209256_1000295 3300025299 Bacteria 87239
159 Ga0209256_1002521 3300025299 Bacteria 14711
160 Ga0207426_1001590 3300025302 Bacteria 18203
161 Ga0209051_1008980 3300025303 Bacteria 5210
162 Ga0209257_1000003 3300025304 Bacteria 1702593
163 Ga0209257_1000033 3300025304 Bacteria 671006
164 Ga0209257_1006932 3300025304 Bacteria 7080
165 Ga0207696_1000087 3300025711 Bacteria 194367
166 Ga0207655_1068463 3300025728 Bacteria 1331
167 Ga0207692_10206639 3300025898 Bacteria 1157
168 Ga0207685_10010561 3300025905 Bacteria 2734
169 Ga0207684_10090914 3300025910 Bacteria 2601
170 Ga0207707_10121990 3300025912 Bacteria 2279
171 Ga0207671_10240207 3300025914 Bacteria 1423
172 Ga0207663_10168196 3300025916 Bacteria 1555
173 Ga0207663_10373219 3300025916 Bacteria 1085
174 Ga0207660_10161505 3300025917 Bacteria 1729
175 Ga0207646_10028340 3300025922 Bacteria 5099
176 Ga0207694_10223349 3300025924 Bacteria 1537
177 Ga0207690_10182794 3300025932 Bacteria 1580
178 Ga0207690_10244337 3300025932 Bacteria 1384
179 Ga0207689_10281307 3300025942 Bacteria 1378
180 Ga0207679_10330457 3300025945 Bacteria 1323
181 Ga0207677_10019953 3300026023 Bacteria 4059
182 Ga0207678_10160721 3300026067 Bacteria 1919
183 Ga0207708_10040618 3300026075 Bacteria 3546
184 Ga0207702_10113087 3300026078 Bacteria 2417
185 Ga0207641_10058824 3300026088 Bacteria 3272
186 Ga0207674_10221187 3300026116 Bacteria 1841
187 Ga0207675_100194386 3300026118 Bacteria 1947
188 Ga0209282_1000001 3300027666 Bacteria 2450367
189 Ga0268264_10259586 3300028381 Bacteria 1618
190 Ga0268264_10455138 3300028381 Bacteria 1241
191 Ga0265334_10000014 3300028573 Bacteria 154345
192 Ga0307515_10000067 3300028794 Bacteria 242978
193 Ga0307512_10038200 3300030522 Bacteria 4044
194 Ga0265330_10001738 3300031235 Bacteria 12261
195 Ga0265332_10001673 3300031238 Bacteria 12110
196 Ga0265328_10036141 3300031239 Unclassified 1825
197 Ga0265325_10003555 3300031241 Bacteria 10116
198 Ga0265329_10001775 3300031242 Bacteria 10254
199 Ga0265339_10072486 3300031249 Bacteria 1833
200 Ga0265331_10000810 3300031250 Bacteria 25854
201 Ga0265327_10003804 3300031251 Bacteria 13966
202 Ga0265327_10215604 3300031251 Bacteria 865
203 Ga0265316_10010782 3300031344 Bacteria 8303
204 Ga0307509_10214868 3300031507 Bacteria 1743
205 Ga0307408_100000530 3300031548 Bacteria 32976
206 Ga0307408_100003385 3300031548 Bacteria 10939
207 Ga0307408_100004073 3300031548 Bacteria 9969
208 Ga0307408_100004781 3300031548 Bacteria 9123
209 Ga0307408_100024052 3300031548 Bacteria 4155
210 Ga0307508_10176305 3300031616 Bacteria 1741
211 Ga0265314_10009258 3300031711 Bacteria 8342
212 Ga0265314_10015698 3300031711 Bacteria 6001
213 Ga0265342_10018868 3300031712 Bacteria 4459
214 Ga0307416_101104943 3300032002 Bacteria 897
215 Ga0307507_10226368 3300033179 Bacteria 1248
216 Ga0307510_10017896 3300033180 Bacteria 8348
217 Ga0307510_10068909 3300033180 Bacteria 3546
218 Ga0373934_0068843 3300035086 Bacteria 1414
219 Ga0373936_0003796 3300035113 Bacteria 5689
220 Ga0373945_0012638 3300035116 Bacteria 2807
221 Ga0373954_0000706 3300035118 Bacteria 12839
222 Ga0373956_0024794 3300035119 Bacteria 2588
223 Ga0373957_0066808 3300035120 Bacteria 1401
224 Ga0373955_0029396 3300035172 Bacteria 2857
225 Ga0373924_0131683 3300035410 Bacteria 1088
226 Ga0373927_0132516 3300035695 Bacteria 1628
227 Ga0373933_0008677 3300035724 Bacteria 5542
228 Ga0373933_0041605 3300035724 Bacteria 2713
229 Ga0373947_0001397 3300035725 Bacteria 14855
230 Ga0373937_0000660 3300036401 Bacteria 30186
231 Ga0373937_0001017 3300036401 Bacteria 23732
232 Ga0373925_0014609 3300037068 Bacteria 5673
233 Ga0373925_0053797 3300037068 Bacteria 3010
234 Ga0395899_0141163 3300037312 Bacteria 1714
235 Ga0395899_0459747 3300037312 Bacteria 832
236 Ga0395900_0038443 3300037418 Bacteria 4932
237 Ga0395900_0283430 3300037418 Bacteria 1648
238 Ga0395905_0000514 3300037471 Bacteria 52950
239 Ga0395905_0434657 3300037471 Bacteria 1209
240 Ga0395901_0262586 3300038443 Bacteria 1797
241 Ga0436361_0067060 3300039447 Bacteria 222217
242 Ga0436361_0091769 3300039447 Bacteria 18361
243 Ga0436361_0099372 3300039447 Bacteria 18108
244 Ga0436361_0159469 3300039447 Bacteria 12975
245 Ga0436361_0419752 3300039447 Bacteria 7578
246 Ga0436361_0529332 3300039447 Bacteria 100222
247 Ga0436361_0598612 3300039447 Bacteria 13813
248 Ga0436361_1116767 3300039447 Bacteria 1978
249 Ga0436363_0593543 3300039450 Bacteria 1341
250 Ga0451841_0465944 3300041498 Bacteria 3937
251 Ga0451853_1171350 3300041512 Bacteria 3416
252 Ga0439445_0008088 3300042004 Bacteria 2455
253 Ga0451577_0270933 3300042876 Bacteria 1538
254 Ga0466972_0034955 3300044658 Bacteria 2460
255 Ga0453683_0203827 3300044673 Bacteria 1256
256 Ga0466965_0000219 3300044683 Bacteria 18114
257 Ga0466964_0011297 3300044706 Bacteria 3372
258 Ga0466968_0004158 3300044735 Bacteria 5393
259 Ga0466968_0217749 3300044735 Bacteria 898
260 Ga0495617_000013 3300046452 Bacteria 290031
261 Ga0495617_002208 3300046452 Bacteria 7931
262 Ga0495617_004094 3300046452 Bacteria 5354
263 Ga0495590_0000034 3300046457 Bacteria 129910
264 Ga0495629_0397499 3300046459 Bacteria 937
265 Ga0495638_0000072 3300046460 Bacteria 164926
266 Ga0495638_0007854 3300046460 Bacteria 7611
267 Ga0495638_0012638 3300046460 Bacteria 5777
268 Ga0495638_0019940 3300046460 Bacteria 4433
269 Ga0495638_0043576 3300046460 Bacteria 2830
270 Ga0495653_0000005 3300046463 Bacteria 367438
271 Ga0495650_0000061 3300046471 Bacteria 283347
272 Ga0495650_0000170 3300046471 Bacteria 143177
273 Ga0495650_0000772 3300046471 Bacteria 39497
274 Ga0495650_0001945 3300046471 Bacteria 18267
275 Ga0495650_0003034 3300046471 Bacteria 12673
276 Ga0495650_0011244 3300046471 Bacteria 4918
277 Ga0495580_0001555 3300046472 Bacteria 20191
278 Ga0495605_0000107 3300046474 Bacteria 105085
279 Ga0495605_0024852 3300046474 Bacteria 3129
280 Ga0495639_0004145 3300046475 Bacteria 6212
281 Ga0495584_0004777 3300046491 Bacteria 7245
282 Ga0495584_0005863 3300046491 Bacteria 6475
283 Ga0495585_0003823 3300046492 Bacteria 10031
284 Ga0495585_0030136 3300046492 Bacteria 3086
285 Ga0495585_0050860 3300046492 Bacteria 2297
286 Ga0495607_0001028 3300046501 Bacteria 25612
287 Ga0495607_0003458 3300046501 Bacteria 12092
288 Ga0495607_0024992 3300046501 Bacteria 3719
289 Ga0495607_0068564 3300046501 Bacteria 1989
290 Ga0495607_0288384 3300046501 Bacteria 776
291 Ga0495583_0000021 3300046506 Bacteria 287046
292 Ga0495583_0000148 3300046506 Bacteria 118749
293 Ga0495583_0026289 3300046506 Bacteria 2889
294 Ga0495606_0000118 3300046507 Bacteria 134504
295 Ga0495606_0000380 3300046507 Bacteria 75389
296 Ga0495606_0000449 3300046507 Bacteria 67234
297 Ga0495606_0000460 3300046507 Bacteria 66820
298 Ga0495606_0001824 3300046507 Bacteria 26988
299 Ga0495606_0002357 3300046507 Bacteria 22177
300 Ga0495606_0008229 3300046507 Bacteria 9110
301 Ga0495606_0023481 3300046507 Bacteria 4466
302 Ga0495610_0000012 3300046512 Bacteria 517442
303 Ga0495610_0001017 3300046512 Bacteria 25842
304 Ga0495610_0003766 3300046512 Bacteria 11594
305 Ga0495610_0057271 3300046512 Bacteria 1869
306 Ga0495616_0004047 3300046513 Bacteria 9315
307 Ga0495616_0022274 3300046513 Bacteria 3421
308 Ga0495637_0000462 3300046520 Bacteria 29660
309 Ga0495643_0000135 3300046522 Bacteria 118587
310 Ga0495643_0000193 3300046522 Bacteria 96406
311 Ga0495644_0000347 3300046523 Bacteria 21047
312 Ga0495644_0003305 3300046523 Bacteria 6375
313 Ga0495648_0000037 3300046524 Bacteria 195401
314 Ga0495648_0001316 3300046524 Bacteria 24609
315 Ga0495648_0003262 3300046524 Bacteria 14373
316 Ga0495648_0007313 3300046524 Bacteria 8851
317 Ga0495648_0020024 3300046524 Bacteria 4680
318 Ga0495642_0001077 3300046528 Bacteria 12620
319 Ga0495654_0000011 3300046530 Bacteria 363172
320 Ga0495654_0110796 3300046530 Bacteria 1253
321 Ga0495586_0006624 3300046535 Bacteria 6186
322 Ga0495586_0085135 3300046535 Bacteria 1741
323 Ga0495587_0075979 3300046536 Bacteria 1951
324 Ga0495609_0000250 3300046538 Bacteria 50865
325 Ga0495609_0005829 3300046538 Bacteria 6389
326 Ga0495609_0056754 3300046538 Bacteria 1734
327 Ga0495597_0000093 3300046542 Bacteria 79411
328 Ga0495597_0000156 3300046542 Bacteria 60520
329 Ga0495597_0023058 3300046542 Bacteria 2881
330 Ga0495597_0087239 3300046542 Bacteria 1328
331 Ga0495622_0000010 3300046557 Bacteria 212375
332 Ga0495622_0000040 3300046557 Bacteria 118542
333 Ga0495622_0178831 3300046557 Bacteria 952
334 Ga0495633_0000258 3300046558 Bacteria 62715
335 Ga0495633_0000270 3300046558 Bacteria 60861
336 Ga0495633_0000653 3300046558 Bacteria 32049
337 Ga0495633_0007124 3300046558 Bacteria 6495
338 Ga0495633_0016028 3300046558 Bacteria 3876
339 Ga0495633_0038389 3300046558 Bacteria 2287
340 Ga0495656_0028905 3300046615 Bacteria 2227
341 Ga0495668_0000137 3300046616 Bacteria 111150
342 Ga0495668_0000404 3300046616 Bacteria 56317
343 Ga0495668_0000967 3300046616 Bacteria 31810
344 Ga0495668_0002114 3300046616 Bacteria 17155
345 Ga0495611_0002250 3300046648 Bacteria 8956
346 Ga0495611_0002414 3300046648 Bacteria 8564
347 Ga0495625_0000023 3300046660 Bacteria 274067
348 Ga0495625_0001530 3300046660 Bacteria 27635
349 Ga0495625_0003570 3300046660 Bacteria 15339
350 Ga0495625_0005246 3300046660 Bacteria 11921
351 Ga0495625_0011630 3300046660 Bacteria 7160
352 Ga0495625_0148774 3300046660 Bacteria 1575
353 Ga0495659_0000008 3300046664 Bacteria 102082
354 Ga0495659_0000414 3300046664 Bacteria 16287
355 Ga0495659_0001006 3300046664 Bacteria 9846
356 Ga0495659_0277095 3300046664 Bacteria 704
357 Ga0495661_0006196 3300046665 Bacteria 8420
358 Ga0495661_0016554 3300046665 Bacteria 4884
359 Ga0495647_0002132 3300046681 Bacteria 6186
360 Ga0495647_0057737 3300046681 Bacteria 1524
361 Ga0495658_0013530 3300046683 Bacteria 4154
362 Ga0495658_0411564 3300046683 Bacteria 862
363 Ga0495669_0019092 3300046684 Bacteria 2956
364 Ga0495670_0001607 3300046691 Bacteria 11065
365 Ga0495670_0022608 3300046691 Bacteria 3105
366 Ga0495670_0116504 3300046691 Bacteria 1386
367 Ga0495671_0000006 3300046692 Bacteria 500471
368 Ga0495671_0000155 3300046692 Bacteria 59986
369 Ga0495671_0038447 3300046692 Bacteria 2418
370 Ga0495649_0003104 3300046694 Bacteria 11372
371 Ga0495649_0011035 3300046694 Bacteria 5323
372 Ga0495600_0251573 3300046809 Bacteria 1124
373 Ga0495660_0000339 3300046810 Bacteria 41484
374 Ga0495660_0017047 3300046810 Bacteria 4183
375 Ga0495636_0003359 3300047318 Bacteria 6201
376 Ga0495636_0009053 3300047318 Bacteria 3914
377 Ga0495672_0000030 3300047320 Bacteria 305021
378 Ga0495672_0000169 3300047320 Bacteria 94803
379 Ga0495672_0040006 3300047320 Bacteria 2846
380 Ga0495676_0046404 3300047321 Bacteria 3526
381 Ga0495680_0009388 3300047322 Bacteria 8801
382 Ga0495683_0039608 3300047323 Bacteria 2381
383 Ga0495687_000245 3300047443 Bacteria 73990
384 Ga0495687_007467 3300047443 Bacteria 6429
385 Ga0495687_053497 3300047443 Bacteria 1699
386 Ga0495677_0002637 3300047445 Bacteria 7014
387 Ga0495677_0009174 3300047445 Bacteria 3656
388 Ga0495685_000290 3300047447 Bacteria 16765
389 Ga0495673_0000003 3300047469 Bacteria 1491337
390 Ga0495673_0000015 3300047469 Bacteria 598766
391 Ga0495673_0000044 3300047469 Bacteria 283033
392 Ga0495673_0007387 3300047469 Bacteria 6325
393 Ga0495681_0019522 3300047470 Bacteria 3698
394 Ga0495686_0004973 3300047472 Bacteria 10688
395 Ga0495686_0008183 3300047472 Bacteria 7717
396 Ga0495626_0071817 3300048091 Bacteria 1554
397 Ga0496106_0393393 3300048909 Bacteria 1114
398 Ga0496106_0642582 3300048909 Bacteria 848
399 Ga0496107_0183017 3300048910 Bacteria 1556
400 Ga0496109_0043746 3300048912 Bacteria 4060
401 Ga0496110_0087193 3300048913 Bacteria 2788
402 Ga0496110_0294806 3300048913 Bacteria 1477
403 Ga0496117_0000001 3300048920 Bacteria 2526244
404 Ga0496118_0000008 3300048921 Bacteria 644537
405 Ga0496119_0175959 3300048922 Bacteria 1126
406 Ga0496120_0086510 3300048923 Bacteria 1685
407 Ga0496121_0004699 3300048924 Bacteria 18091
408 Ga0496121_0006539 3300048924 Bacteria 14404
409 Ga0496122_0001158 3300048925 Bacteria 45121
410 Ga0496123_0003745 3300048926 Bacteria 16673
411 Ga0496124_0050836 3300048927 Bacteria 3529
412 Ga0496124_0055699 3300048927 Bacteria 3340
413 Ga0496124_0070986 3300048927 Bacteria 2888
414 Ga0496124_0098109 3300048927 Bacteria 2378
415 Ga0496125_0003980 3300048928 Bacteria 17384
416 Ga0496125_0046805 3300048928 Bacteria 3625
417 Ga0496125_0064800 3300048928 Bacteria 2900
418 Ga0496125_0082343 3300048928 Bacteria 2453
419 Ga0496126_0016494 3300048929 Bacteria 7382
420 Ga0495678_000115 3300049459 Bacteria 96173
421 Ga0495678_003880 3300049459 Bacteria 8969
422 Ga0495678_004932 3300049459 Bacteria 7535
423 Ga0495682_0000370 3300049460 Bacteria 32590
424 Ga0495682_0001292 3300049460 Bacteria 13948
425 Ga0495682_0002330 3300049460 Bacteria 9037
426 Ga0495682_0042770 3300049460 Bacteria 1660
427 Ga0501033_0472155 3300049570 Bacteria 870
428 Ga0501071_0680136 3300049587 Bacteria 792
429 Ga0501035_0012832 3300049822 Bacteria 7738
430 Ga0501044_0000183 3300049823 Bacteria 77954
431 nmdc:mga0k408_12627_c1 3300050493 Bacteria 4617
432 nmdc:mga0k408_2102_c1 3300050493 Bacteria 10664
433 nmdc:mga0k408_28436_c1 3300050493 Bacteria 3178
434 nmdc:mga07m45_501_c1 3300050496 Bacteria 16602
435 nmdc:mga0n895_322648_c1 3300050512 Bacteria 1565
436 nmdc:mga0a205_1043580_c1 3300050515 Bacteria 664
437 nmdc:mga0a205_177520_c1 3300050515 Bacteria 2025
438 nmdc:mga0a205_64512_c1 3300050515 Bacteria 3537
439 Ga0500594_0041852 3300053118 Bacteria 1256
440 Ga0500618_000091 3300053125 Bacteria 73830
441 Ga0500586_003593 3300053145 Bacteria 3688
442 Ga0500622_0003630 3300053156 Bacteria 10143
443 Ga0530510_0799209 3300061734 Bacteria 720

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005333 Ga0070677_10097995 Ga0070677_100979951 196
2 3300005354 Ga0070675_100282177 Ga0070675_1002821771 196
3 3300005365 Ga0070688_100109151 Ga0070688_1001091511 196
4 3300005466 Ga0070685_10398007 Ga0070685_103980071 196
5 3300005719 Ga0068861_100148602 Ga0068861_1001486022 196
6 3300026075 Ga0207708_10040618 Ga0207708_100406183 196
7 3300026118 Ga0207675_100194386 Ga0207675_1001943863 196
8 3300046501 Ga0495607_0288384 Ga0495607_0288384_24_620 197
9 iso_pu_bacteria 2643221603 2644026719 204
10 3300006237 Ga0097621_100214579 Ga0097621_1002145791 205
11 3300009176 Ga0105242_10032773 Ga0105242_100327734 205
12 iso_pu_bacteria 2600255292 2601670731 205
13 iso_pu_bacteria 2738541297 2738828341 205
14 iso_pu_bacteria 2738541357 2739152137 205
15 iso_pu_bacteria 2738543003 2739193842 205
16 iso_pu_bacteria 2738543026 2739320533 205
17 iso_pu_bacteria 2738543029 2739338559 205
18 iso_pu_bacteria 2821131069 2821132405 205
19 iso_pu_bacteria 2857547612 2857552625 205
20 iso_pu_bacteria 2857564685 2857569894 205
21 iso_pu_bacteria 2885080285 2885085726 205
22 iso_pu_bacteria 2932410948 2932414938 205
23 iso_pu_bacteria 2932416698 2932419624 205
24 3300005577 Ga0068857_100433342 Ga0068857_1004333422 206
25 3300046615 Ga0495656_0028905 Ga0495656_0028905_1424_2056 206
26 iso_pu_bacteria 2842711865 2842713292 206
27 iso_pu_bacteria 2857558681 2857562752 206
28 3300048913 Ga0496110_0294806 Ga0496110_0294806_153_779 207
29 iso_pu_bacteria 2643221554 2643787911 207
30 iso_pu_bacteria 2643221638 2644212041 207
31 iso_pu_bacteria 2643221645 2644253189 207
32 3300005445 Ga0070708_100102743 Ga0070708_1001027431 208
33 3300005467 Ga0070706_100109660 Ga0070706_1001096601 208
34 3300005468 Ga0070707_100117646 Ga0070707_1001176464 208
35 3300005518 Ga0070699_100028026 Ga0070699_1000280261 208
36 3300005536 Ga0070697_100088421 Ga0070697_1000884214 208
37 3300025250 Ga0209026_1003541 Ga0209026_10035415 208
38 3300025910 Ga0207684_10090914 Ga0207684_100909141 208
39 3300046507 Ga0495606_0001824 Ga0495606_0001824_21065_21751 208
40 3300048909 Ga0496106_0642582 Ga0496106_0642582_164_790 208
41 iso_pu_bacteria 2643221664 2644355760 208
42 iso_pu_bacteria 2738541280 2738742179 208
43 iso_pu_bacteria 2738541300 2738841343 208
44 iso_pu_bacteria 2738543018 2739272213 208
45 iso_pu_bacteria 2738543030 2739341257 208
46 3300002774 JGI25150J39212_1004353 JGI25150J39212_10043535 209
47 3300003771 Ga0055526_1000044 Ga0055526_100004425 209
48 3300003791 Ga0055530_10044085 Ga0055530_100440851 209
49 3300003794 Ga0055531_10000001 Ga0055531_10000001380 209
50 3300005336 Ga0070680_100263286 Ga0070680_1002632862 209
51 3300005366 Ga0070659_100224779 Ga0070659_1002247793 209
52 3300005535 Ga0070684_100368097 Ga0070684_1003680971 209
53 3300005539 Ga0068853_100001996 Ga0068853_1000019968 209
54 3300005563 Ga0068855_100074210 Ga0068855_1000742103 209
55 3300005577 Ga0068857_100019597 Ga0068857_1000195973 209
56 3300005614 Ga0068856_100074508 Ga0068856_1000745083 209
57 3300005841 Ga0068863_100075810 Ga0068863_1000758103 209
58 3300006051 Ga0075364_10033118 Ga0075364_100331182 209
59 3300006195 Ga0075366_10024860 Ga0075366_100248603 209
60 3300006353 Ga0075370_10117740 Ga0075370_101177402 209
61 3300006852 Ga0075433_10144710 Ga0075433_101447102 209
62 3300006871 Ga0075434_100105972 Ga0075434_1001059722 209
63 3300009036 Ga0105244_10012653 Ga0105244_100126533 209
64 3300009093 Ga0105240_10013078 Ga0105240_100130783 209
65 3300009551 Ga0105238_10342593 Ga0105238_103425932 209
66 3300009553 Ga0105249_10221386 Ga0105249_102213864 209
67 3300010375 Ga0105239_10082983 Ga0105239_100829834 209
68 3300017792 Ga0163161_10054909 Ga0163161_100549092 209
69 3300021361 Ga0213872_10011901 Ga0213872_100119013 209
70 3300025245 Ga0207425_1000159 Ga0207425_100015910 209
71 3300025294 Ga0209025_1009036 Ga0209025_10090363 209
72 3300025295 Ga0209564_1000011 Ga0209564_1000011618 209
73 3300025298 Ga0209050_1009076 Ga0209050_10090765 209
74 3300025303 Ga0209051_1008980 Ga0209051_10089805 209
75 3300025304 Ga0209257_1000033 Ga0209257_1000033468 209
76 3300025728 Ga0207655_1068463 Ga0207655_10684632 209
77 3300025912 Ga0207707_10121990 Ga0207707_101219904 209
78 3300025914 Ga0207671_10240207 Ga0207671_102402072 209
79 3300025917 Ga0207660_10161505 Ga0207660_101615052 209
80 3300025924 Ga0207694_10223349 Ga0207694_102233492 209
81 3300025932 Ga0207690_10182794 Ga0207690_101827943 209
82 3300026067 Ga0207678_10160721 Ga0207678_101607212 209
83 3300026078 Ga0207702_10113087 Ga0207702_101130871 209
84 3300026088 Ga0207641_10058824 Ga0207641_100588241 209
85 3300026116 Ga0207674_10221187 Ga0207674_102211873 209
86 3300028381 Ga0268264_10259586 Ga0268264_102595862 209
87 3300031711 Ga0265314_10015698 Ga0265314_100156987 209
88 3300033179 Ga0307507_10226368 Ga0307507_102263681 209
89 3300037312 Ga0395899_0141163 Ga0395899_0141163_48_677 209
90 3300037312 Ga0395899_0459747 Ga0395899_0459747_96_725 209
91 3300037418 Ga0395900_0038443 Ga0395900_0038443_2497_3126 209
92 3300037418 Ga0395900_0283430 Ga0395900_0283430_139_768 209
93 3300038443 Ga0395901_0262586 Ga0395901_0262586_712_1341 209
94 3300039447 Ga0436361_0159469 Ga0436361_0159469_9244_9873 209
95 3300039447 Ga0436361_0598612 Ga0436361_0598612_10685_11314 209
96 3300039450 Ga0436363_0593543 Ga0436363_0593543_531_1184 209
97 3300044658 Ga0466972_0034955 Ga0466972_0034955_1327_1956 209
98 3300044683 Ga0466965_0000219 Ga0466965_0000219_16458_17087 209
99 3300044706 Ga0466964_0011297 Ga0466964_0011297_754_1383 209
100 3300044735 Ga0466968_0004158 Ga0466968_0004158_3237_3866 209
101 3300044735 Ga0466968_0217749 Ga0466968_0217749_257_886 209
102 3300046452 Ga0495617_000013 Ga0495617_000013_273561_274199 209
103 3300046452 Ga0495617_002208 Ga0495617_002208_3243_3881 209
104 3300046460 Ga0495638_0012638 Ga0495638_0012638_2053_2691 209
105 3300046460 Ga0495638_0043576 Ga0495638_0043576_1992_2630 209
106 3300046463 Ga0495653_0000005 Ga0495653_0000005_111836_112474 209
107 3300046471 Ga0495650_0000061 Ga0495650_0000061_245449_246078 209
108 3300046471 Ga0495650_0000170 Ga0495650_0000170_125196_125834 209
109 3300046471 Ga0495650_0000772 Ga0495650_0000772_8120_8758 209
110 3300046471 Ga0495650_0001945 Ga0495650_0001945_6506_7144 209
111 3300046471 Ga0495650_0011244 Ga0495650_0011244_4017_4655 209
112 3300046474 Ga0495605_0000107 Ga0495605_0000107_14982_15620 209
113 3300046492 Ga0495585_0003823 Ga0495585_0003823_7140_7778 209
114 3300046501 Ga0495607_0068564 Ga0495607_0068564_839_1477 209
115 3300046507 Ga0495606_0000118 Ga0495606_0000118_17509_18147 209
116 3300046507 Ga0495606_0000380 Ga0495606_0000380_45271_45909 209
117 3300046507 Ga0495606_0000449 Ga0495606_0000449_7509_8159 209
118 3300046507 Ga0495606_0002357 Ga0495606_0002357_17445_18074 209
119 3300046512 Ga0495610_0000012 Ga0495610_0000012_200070_200708 209
120 3300046512 Ga0495610_0003766 Ga0495610_0003766_912_1550 209
121 3300046520 Ga0495637_0000462 Ga0495637_0000462_13932_14597 209
122 3300046524 Ga0495648_0001316 Ga0495648_0001316_19687_20325 209
123 3300046524 Ga0495648_0007313 Ga0495648_0007313_4163_4801 209
124 3300046524 Ga0495648_0020024 Ga0495648_0020024_538_1176 209
125 3300046530 Ga0495654_0000011 Ga0495654_0000011_187524_188189 209
126 3300046558 Ga0495633_0000270 Ga0495633_0000270_36601_37251 209
127 3300046558 Ga0495633_0016028 Ga0495633_0016028_1824_2462 209
128 3300046616 Ga0495668_0000137 Ga0495668_0000137_92853_93491 209
129 3300046616 Ga0495668_0000967 Ga0495668_0000967_15744_16382 209
130 3300046616 Ga0495668_0002114 Ga0495668_0002114_5001_5639 209
131 3300046660 Ga0495625_0001530 Ga0495625_0001530_13271_13909 209
132 3300046665 Ga0495661_0006196 Ga0495661_0006196_3020_3658 209
133 3300046692 Ga0495671_0000006 Ga0495671_0000006_99362_100000 209
134 3300046694 Ga0495649_0011035 Ga0495649_0011035_131_769 209
135 3300047469 Ga0495673_0000003 Ga0495673_0000003_287073_287711 209
136 3300047469 Ga0495673_0000044 Ga0495673_0000044_15793_16431 209
137 3300047472 Ga0495686_0004973 Ga0495686_0004973_7521_8159 209
138 3300048910 Ga0496107_0183017 Ga0496107_0183017_49_687 209
139 3300048920 Ga0496117_0000001 Ga0496117_0000001_1955734_1956381 209
140 3300048921 Ga0496118_0000008 Ga0496118_0000008_74027_74674 209
141 3300048922 Ga0496119_0175959 Ga0496119_0175959_451_1089 209
142 3300048923 Ga0496120_0086510 Ga0496120_0086510_234_872 209
143 3300048924 Ga0496121_0004699 Ga0496121_0004699_7847_8491 209
144 3300048925 Ga0496122_0001158 Ga0496122_0001158_6028_6675 209
145 3300048926 Ga0496123_0003745 Ga0496123_0003745_7850_8497 209
146 3300048927 Ga0496124_0055699 Ga0496124_0055699_1097_1735 209
147 3300048927 Ga0496124_0070986 Ga0496124_0070986_486_1124 209
148 3300048927 Ga0496124_0098109 Ga0496124_0098109_682_1329 209
149 3300048928 Ga0496125_0046805 Ga0496125_0046805_1460_2098 209
150 3300048928 Ga0496125_0082343 Ga0496125_0082343_203_850 209
151 3300048929 Ga0496126_0016494 Ga0496126_0016494_1883_2521 209
152 3300049460 Ga0495682_0002330 Ga0495682_0002330_140_787 209
153 3300050493 nmdc:mga0k408_28436_c1 nmdc:mga0k408_28436_c1_264_893 209
154 3300050512 nmdc:mga0n895_322648_c1 nmdc:mga0n895_322648_c1_586_1215 209
155 3300050515 nmdc:mga0a205_1043580_c1 nmdc:mga0a205_1043580_c1_23_652 209
156 3300050515 nmdc:mga0a205_177520_c1 nmdc:mga0a205_177520_c1_1313_1942 209
157 3300053118 Ga0500594_0041852 Ga0500594_0041852_489_1127 209
158 3300053125 Ga0500618_000091 Ga0500618_000091_51734_52372 209
159 3300053145 Ga0500586_003593 Ga0500586_003593_1083_1721 209
160 3300003763 Ga0055529_1000842 Ga0055529_100084210 210
161 3300003771 Ga0055526_1000001 Ga0055526_1000001265 210
162 3300005334 Ga0068869_100264229 Ga0068869_1002642291 210
163 3300005338 Ga0068868_100027338 Ga0068868_1000273382 210
164 3300005439 Ga0070711_100061192 Ga0070711_1000611923 210
165 3300005439 Ga0070711_100193944 Ga0070711_1001939442 210
166 3300005439 Ga0070711_100319379 Ga0070711_1003193792 210
167 3300005445 Ga0070708_100028362 Ga0070708_1000283624 210
168 3300005445 Ga0070708_100051280 Ga0070708_1000512804 210
169 3300005445 Ga0070708_100567122 Ga0070708_1005671221 210
170 3300005467 Ga0070706_100012860 Ga0070706_1000128604 210
171 3300005467 Ga0070706_100366306 Ga0070706_1003663062 210
172 3300005468 Ga0070707_100132263 Ga0070707_1001322634 210
173 3300005518 Ga0070699_100218664 Ga0070699_1002186643 210
174 3300005536 Ga0070697_100116978 Ga0070697_1001169783 210
175 3300005536 Ga0070697_100810016 Ga0070697_1008100161 210
176 3300005564 Ga0070664_100193046 Ga0070664_1001930462 210
177 3300005617 Ga0068859_100453382 Ga0068859_1004533822 210
178 3300005843 Ga0068860_100493470 Ga0068860_1004934702 210
179 3300006163 Ga0070715_10008599 Ga0070715_100085992 210
180 3300006173 Ga0070716_100174065 Ga0070716_1001740652 210
181 3300006195 Ga0075366_10017778 Ga0075366_100177783 210
182 3300006195 Ga0075366_10277437 Ga0075366_102774372 210
183 3300006353 Ga0075370_10001791 Ga0075370_100017912 210
184 3300006353 Ga0075370_10011909 Ga0075370_100119095 210
185 3300006931 Ga0097620_100453389 Ga0097620_1004533892 210
186 3300009147 Ga0114129_11162059 Ga0114129_111620591 210
187 3300009177 Ga0105248_10063055 Ga0105248_100630554 210
188 3300009545 Ga0105237_10170343 Ga0105237_101703433 210
189 3300013296 Ga0157374_10100375 Ga0157374_101003751 210
190 3300013297 Ga0157378_10319146 Ga0157378_103191462 210
191 3300013306 Ga0163162_10599300 Ga0163162_105993001 210
192 3300013308 Ga0157375_10080510 Ga0157375_100805105 210
193 3300013308 Ga0157375_10346020 Ga0157375_103460202 210
194 3300013308 Ga0157375_10959511 Ga0157375_109595111 210
195 3300014968 Ga0157379_10002612 Ga0157379_100026125 210
196 3300021361 Ga0213872_10000001 Ga0213872_1000000111 210
197 3300021361 Ga0213872_10000298 Ga0213872_1000029812 210
198 3300021361 Ga0213872_10014015 Ga0213872_100140153 210
199 3300021361 Ga0213872_10017423 Ga0213872_100174235 210
200 3300025228 Ga0209672_105915 Ga0209672_1059152 210
201 3300025242 Ga0209258_107918 Ga0209258_1079182 210
202 3300025246 Ga0209646_1000054 Ga0209646_1000054192 210
203 3300025250 Ga0209026_1010849 Ga0209026_10108492 210
204 3300025272 Ga0209455_1000359 Ga0209455_10003593 210
205 3300025295 Ga0209564_1000002 Ga0209564_1000002302 210
206 3300025711 Ga0207696_1000087 Ga0207696_100008751 210
207 3300025898 Ga0207692_10206639 Ga0207692_102066392 210
208 3300025905 Ga0207685_10010561 Ga0207685_100105612 210
209 3300025916 Ga0207663_10168196 Ga0207663_101681961 210
210 3300025916 Ga0207663_10373219 Ga0207663_103732191 210
211 3300025922 Ga0207646_10028340 Ga0207646_100283402 210
212 3300025932 Ga0207690_10244337 Ga0207690_102443372 210
213 3300025942 Ga0207689_10281307 Ga0207689_102813072 210
214 3300025945 Ga0207679_10330457 Ga0207679_103304572 210
215 3300026023 Ga0207677_10019953 Ga0207677_100199533 210
216 3300028381 Ga0268264_10455138 Ga0268264_104551382 210
217 3300028573 Ga0265334_10000014 Ga0265334_1000001455 210
218 3300028794 Ga0307515_10000067 Ga0307515_1000006721 210
219 3300030522 Ga0307512_10038200 Ga0307512_100382003 210
220 3300031235 Ga0265330_10001738 Ga0265330_1000173811 210
221 3300031238 Ga0265332_10001673 Ga0265332_100016736 210
222 3300031239 Ga0265328_10036141 Ga0265328_100361412 210
223 3300031241 Ga0265325_10003555 Ga0265325_1000355510 210
224 3300031242 Ga0265329_10001775 Ga0265329_100017755 210
225 3300031249 Ga0265339_10072486 Ga0265339_100724862 210
226 3300031250 Ga0265331_10000810 Ga0265331_100008108 210
227 3300031251 Ga0265327_10003804 Ga0265327_100038046 210
228 3300031251 Ga0265327_10215604 Ga0265327_102156041 210
229 3300031344 Ga0265316_10010782 Ga0265316_100107826 210
230 3300031507 Ga0307509_10214868 Ga0307509_102148682 210
231 3300031616 Ga0307508_10176305 Ga0307508_101763052 210
232 3300031711 Ga0265314_10009258 Ga0265314_100092586 210
233 3300031712 Ga0265342_10018868 Ga0265342_100188681 210
234 3300033180 Ga0307510_10017896 Ga0307510_100178967 210
235 3300033180 Ga0307510_10068909 Ga0307510_100689092 210
236 3300035086 Ga0373934_0068843 Ga0373934_0068843_124_765 210
237 3300035113 Ga0373936_0003796 Ga0373936_0003796_179_811 210
238 3300035116 Ga0373945_0012638 Ga0373945_0012638_1587_2219 210
239 3300035118 Ga0373954_0000706 Ga0373954_0000706_6111_6743 210
240 3300035119 Ga0373956_0024794 Ga0373956_0024794_1208_1849 210
241 3300035120 Ga0373957_0066808 Ga0373957_0066808_351_992 210
242 3300035172 Ga0373955_0029396 Ga0373955_0029396_1804_2445 210
243 3300035410 Ga0373924_0131683 Ga0373924_0131683_66_698 210
244 3300035695 Ga0373927_0132516 Ga0373927_0132516_220_855 210
245 3300035724 Ga0373933_0008677 Ga0373933_0008677_214_855 210
246 3300035724 Ga0373933_0041605 Ga0373933_0041605_1258_1890 210
247 3300035725 Ga0373947_0001397 Ga0373947_0001397_13889_14521 210
248 3300036401 Ga0373937_0000660 Ga0373937_0000660_10505_11137 210
249 3300036401 Ga0373937_0001017 Ga0373937_0001017_16482_17123 210
250 3300037068 Ga0373925_0014609 Ga0373925_0014609_3072_3704 210
251 3300037068 Ga0373925_0053797 Ga0373925_0053797_2278_2913 210
252 3300037471 Ga0395905_0000514 Ga0395905_0000514_49494_50195 210
253 3300037471 Ga0395905_0434657 Ga0395905_0434657_117_761 210
254 3300039447 Ga0436361_0067060 Ga0436361_0067060_404_1048 210
255 3300039447 Ga0436361_0091769 Ga0436361_0091769_9233_9877 210
256 3300039447 Ga0436361_0099372 Ga0436361_0099372_15641_16273 210
257 3300039447 Ga0436361_0419752 Ga0436361_0419752_2256_2900 210
258 3300039447 Ga0436361_0529332 Ga0436361_0529332_13751_14392 210
259 3300039447 Ga0436361_1116767 Ga0436361_1116767_882_1526 210
260 3300041498 Ga0451841_0465944 Ga0451841_0465944_2551_3183 210
261 3300041512 Ga0451853_1171350 Ga0451853_1171350_22_654 210
262 3300042004 Ga0439445_0008088 Ga0439445_0008088_1146_1784 210
263 3300042876 Ga0451577_0270933 Ga0451577_0270933_197_829 210
264 3300044673 Ga0453683_0203827 Ga0453683_0203827_35_667 210
265 3300046457 Ga0495590_0000034 Ga0495590_0000034_23056_23697 210
266 3300046459 Ga0495629_0397499 Ga0495629_0397499_129_776 210
267 3300046460 Ga0495638_0000072 Ga0495638_0000072_26774_27415 210
268 3300046471 Ga0495650_0003034 Ga0495650_0003034_6883_7524 210
269 3300046472 Ga0495580_0001555 Ga0495580_0001555_2494_3126 210
270 3300046474 Ga0495605_0024852 Ga0495605_0024852_333_965 210
271 3300046475 Ga0495639_0004145 Ga0495639_0004145_3470_4102 210
272 3300046492 Ga0495585_0030136 Ga0495585_0030136_1033_1665 210
273 3300046501 Ga0495607_0003458 Ga0495607_0003458_2711_3352 210
274 3300046506 Ga0495583_0000021 Ga0495583_0000021_251452_252084 210
275 3300046506 Ga0495583_0000148 Ga0495583_0000148_26677_27318 210
276 3300046507 Ga0495606_0000460 Ga0495606_0000460_23323_23964 210
277 3300046507 Ga0495606_0008229 Ga0495606_0008229_1989_2630 210
278 3300046512 Ga0495610_0001017 Ga0495610_0001017_11595_12236 210
279 3300046512 Ga0495610_0057271 Ga0495610_0057271_957_1598 210
280 3300046522 Ga0495643_0000135 Ga0495643_0000135_91550_92191 210
281 3300046522 Ga0495643_0000193 Ga0495643_0000193_73928_74569 210
282 3300046523 Ga0495644_0000347 Ga0495644_0000347_8121_8753 210
283 3300046524 Ga0495648_0000037 Ga0495648_0000037_168082_168723 210
284 3300046524 Ga0495648_0003262 Ga0495648_0003262_3398_4030 210
285 3300046528 Ga0495642_0001077 Ga0495642_0001077_3848_4489 210
286 3300046535 Ga0495586_0006624 Ga0495586_0006624_2871_3503 210
287 3300046535 Ga0495586_0085135 Ga0495586_0085135_558_1193 210
288 3300046536 Ga0495587_0075979 Ga0495587_0075979_341_982 210
289 3300046538 Ga0495609_0005829 Ga0495609_0005829_4515_5147 210
290 3300046538 Ga0495609_0056754 Ga0495609_0056754_388_1029 210
291 3300046542 Ga0495597_0000093 Ga0495597_0000093_18781_19422 210
292 3300046542 Ga0495597_0000156 Ga0495597_0000156_33348_33989 210
293 3300046542 Ga0495597_0087239 Ga0495597_0087239_436_1083 210
294 3300046557 Ga0495622_0000010 Ga0495622_0000010_183736_184377 210
295 3300046557 Ga0495622_0000040 Ga0495622_0000040_91227_91868 210
296 3300046558 Ga0495633_0000258 Ga0495633_0000258_12637_13278 210
297 3300046558 Ga0495633_0000653 Ga0495633_0000653_22890_23531 210
298 3300046558 Ga0495633_0007124 Ga0495633_0007124_2215_2856 210
299 3300046616 Ga0495668_0000404 Ga0495668_0000404_32651_33292 210
300 3300046648 Ga0495611_0002250 Ga0495611_0002250_7643_8275 210
301 3300046660 Ga0495625_0000023 Ga0495625_0000023_211252_211893 210
302 3300046660 Ga0495625_0011630 Ga0495625_0011630_1345_1986 210
303 3300046664 Ga0495659_0000414 Ga0495659_0000414_14096_14728 210
304 3300046681 Ga0495647_0002132 Ga0495647_0002132_3705_4337 210
305 3300046681 Ga0495647_0057737 Ga0495647_0057737_451_1086 210
306 3300046683 Ga0495658_0013530 Ga0495658_0013530_948_1580 210
307 3300046683 Ga0495658_0411564 Ga0495658_0411564_138_773 210
308 3300046691 Ga0495670_0001607 Ga0495670_0001607_902_1534 210
309 3300046694 Ga0495649_0003104 Ga0495649_0003104_8303_8944 210
310 3300046809 Ga0495600_0251573 Ga0495600_0251573_337_978 210
311 3300046810 Ga0495660_0017047 Ga0495660_0017047_1357_1998 210
312 3300047318 Ga0495636_0009053 Ga0495636_0009053_1581_2213 210
313 3300047320 Ga0495672_0000030 Ga0495672_0000030_21545_22186 210
314 3300047321 Ga0495676_0046404 Ga0495676_0046404_2516_3148 210
315 3300047322 Ga0495680_0009388 Ga0495680_0009388_1535_2176 210
316 3300047443 Ga0495687_000245 Ga0495687_000245_41973_42605 210
317 3300047443 Ga0495687_007467 Ga0495687_007467_5445_6086 210
318 3300047445 Ga0495677_0009174 Ga0495677_0009174_1858_2490 210
319 3300047447 Ga0495685_000290 Ga0495685_000290_5151_5783 210
320 3300047469 Ga0495673_0000015 Ga0495673_0000015_178288_178929 210
321 3300048091 Ga0495626_0071817 Ga0495626_0071817_102_749 210
322 3300048909 Ga0496106_0393393 Ga0496106_0393393_295_927 210
323 3300048912 Ga0496109_0043746 Ga0496109_0043746_553_1203 210
324 3300048913 Ga0496110_0087193 Ga0496110_0087193_192_824 210
325 3300048924 Ga0496121_0006539 Ga0496121_0006539_11510_12148 210
326 3300048927 Ga0496124_0050836 Ga0496124_0050836_2825_3463 210
327 3300048928 Ga0496125_0003980 Ga0496125_0003980_6562_7200 210
328 3300048928 Ga0496125_0064800 Ga0496125_0064800_1946_2584 210
329 3300049459 Ga0495678_000115 Ga0495678_000115_21828_22469 210
330 3300049459 Ga0495678_003880 Ga0495678_003880_1609_2241 210
331 3300049459 Ga0495678_004932 Ga0495678_004932_927_1568 210
332 3300049460 Ga0495682_0001292 Ga0495682_0001292_3980_4612 210
333 3300049570 Ga0501033_0472155 Ga0501033_0472155_100_780 210
334 3300049587 Ga0501071_0680136 Ga0501071_0680136_138_776 210
335 3300049822 Ga0501035_0012832 Ga0501035_0012832_4551_5183 210
336 3300049823 Ga0501044_0000183 Ga0501044_0000183_30777_31409 210
337 3300050493 nmdc:mga0k408_12627_c1 nmdc:mga0k408_12627_c1_876_1508 210
338 3300050493 nmdc:mga0k408_2102_c1 nmdc:mga0k408_2102_c1_7518_8165 210
339 3300050496 nmdc:mga07m45_501_c1 nmdc:mga07m45_501_c1_3354_4001 210
340 3300050515 nmdc:mga0a205_64512_c1 nmdc:mga0a205_64512_c1_2642_3274 210
341 3300053156 Ga0500622_0003630 Ga0500622_0003630_8696_9373 210
342 3300061734 Ga0530510_0799209 Ga0530510_0799209_34_672 210
343 3300002739 JGI25158J39367_1000433 JGI25158J39367_10004337 211
344 3300002739 JGI25158J39367_1000642 JGI25158J39367_10006424 211
345 3300002773 JGI25152J39213_1000105 JGI25152J39213_100010535 211
346 3300002774 JGI25150J39212_1000374 JGI25150J39212_100037416 211
347 3300002987 JGI25159J45721_1000762 JGI25159J45721_10007629 211
348 3300002987 JGI25159J45721_1001061 JGI25159J45721_100106111 211
349 3300002987 JGI25159J45721_1001736 JGI25159J45721_10017367 211
350 3300003354 JGI25160J50197_1001081 JGI25160J50197_10010818 211
351 3300003374 JGI25161J50226_1000453 JGI25161J50226_100045311 211
352 3300003374 JGI25161J50226_1000724 JGI25161J50226_10007247 211
353 3300003771 Ga0055526_1000121 Ga0055526_100012153 211
354 3300003771 Ga0055526_1005778 Ga0055526_100577810 211
355 3300003773 Ga0055537_1000179 Ga0055537_100017917 211
356 3300003773 Ga0055537_1002355 Ga0055537_10023558 211
357 3300003773 Ga0055537_1009830 Ga0055537_10098303 211
358 3300003773 Ga0055537_1013095 Ga0055537_10130952 211
359 3300003775 Ga0055524_1000008 Ga0055524_1000008168 211
360 3300003775 Ga0055524_1003549 Ga0055524_10035497 211
361 3300003775 Ga0055524_1007473 Ga0055524_10074733 211
362 3300003775 Ga0055524_1022867 Ga0055524_10228672 211
363 3300003775 Ga0055524_1030376 Ga0055524_10303762 211
364 3300003784 Ga0055534_1000495 Ga0055534_10004956 211
365 3300003784 Ga0055534_1002232 Ga0055534_10022322 211
366 3300003790 Ga0055528_1000119 Ga0055528_100011944 211
367 3300003791 Ga0055530_10001373 Ga0055530_1000137311 211
368 3300003791 Ga0055530_10002288 Ga0055530_100022887 211
369 3300003791 Ga0055530_10002362 Ga0055530_100023626 211
370 3300003794 Ga0055531_10000577 Ga0055531_100005778 211
371 3300003794 Ga0055531_10034459 Ga0055531_100344592 211
372 3300004625 Ga0055543_1000915 Ga0055543_100091511 211
373 3300004625 Ga0055543_1005198 Ga0055543_10051981 211
374 3300005262 Ga0065165_1000039 Ga0065165_1000039204 211
375 3300005262 Ga0065165_1001994 Ga0065165_100199411 211
376 3300005262 Ga0065165_1019521 Ga0065165_10195212 211
377 3300006948 Ga0099826_10000001 Ga0099826_10000001434 211
378 3300025208 Ga0209436_100049 Ga0209436_10004947 211
379 3300025208 Ga0209436_100093 Ga0209436_10009341 211
380 3300025245 Ga0207425_1000001 Ga0207425_1000001131 211
381 3300025245 Ga0207425_1000033 Ga0207425_1000033189 211
382 3300025245 Ga0207425_1018671 Ga0207425_10186712 211
383 3300025258 Ga0209129_1000003 Ga0209129_1000003131 211
384 3300025258 Ga0209129_1002851 Ga0209129_10028513 211
385 3300025263 Ga0209565_1000003 Ga0209565_1000003239 211
386 3300025263 Ga0209565_1000162 Ga0209565_100016246 211
387 3300025263 Ga0209565_1000383 Ga0209565_10003832 211
388 3300025263 Ga0209565_1000474 Ga0209565_100047427 211
389 3300025263 Ga0209565_1003186 Ga0209565_10031862 211
390 3300025263 Ga0209565_1005728 Ga0209565_10057285 211
391 3300025273 Ga0209673_1000003 Ga0209673_1000003125 211
392 3300025273 Ga0209673_1023046 Ga0209673_10230462 211
393 3300025284 Ga0209130_1000084 Ga0209130_1000084128 211
394 3300025284 Ga0209130_1000438 Ga0209130_100043811 211
395 3300025284 Ga0209130_1001623 Ga0209130_10016238 211
396 3300025291 Ga0209675_1000003 Ga0209675_1000003799 211
397 3300025291 Ga0209675_1000713 Ga0209675_10007132 211
398 3300025291 Ga0209675_1002356 Ga0209675_10023569 211
399 3300025291 Ga0209675_1003385 Ga0209675_10033852 211
400 3300025291 Ga0209675_1032517 Ga0209675_10325171 211
401 3300025295 Ga0209564_1000012 Ga0209564_1000012608 211
402 3300025295 Ga0209564_1000095 Ga0209564_100009539 211
403 3300025295 Ga0209564_1005141 Ga0209564_10051412 211
404 3300025295 Ga0209564_1019883 Ga0209564_10198834 211
405 3300025297 Ga0209758_1000041 Ga0209758_100004179 211
406 3300025298 Ga0209050_1000011 Ga0209050_1000011296 211
407 3300025298 Ga0209050_1000138 Ga0209050_1000138121 211
408 3300025298 Ga0209050_1002638 Ga0209050_100263811 211
409 3300025299 Ga0209256_1000005 Ga0209256_10000051114 211
410 3300025299 Ga0209256_1000068 Ga0209256_10000687 211
411 3300025299 Ga0209256_1000255 Ga0209256_100025552 211
412 3300025299 Ga0209256_1000295 Ga0209256_100029544 211
413 3300025299 Ga0209256_1002521 Ga0209256_10025217 211
414 3300025302 Ga0207426_1001590 Ga0207426_10015906 211
415 3300025304 Ga0209257_1000003 Ga0209257_10000031068 211
416 3300025304 Ga0209257_1006932 Ga0209257_10069326 211
417 3300027666 Ga0209282_1000001 Ga0209282_10000011572 211
418 3300031548 Ga0307408_100000530 Ga0307408_10000053024 211
419 3300031548 Ga0307408_100003385 Ga0307408_10000338510 211
420 3300031548 Ga0307408_100004073 Ga0307408_1000040733 211
421 3300031548 Ga0307408_100004781 Ga0307408_1000047816 211
422 3300031548 Ga0307408_100024052 Ga0307408_1000240523 211
423 3300032002 Ga0307416_101104943 Ga0307416_1011049432 211
424 3300046452 Ga0495617_004094 Ga0495617_004094_4614_5252 211
425 3300046460 Ga0495638_0007854 Ga0495638_0007854_1483_2121 211
426 3300046460 Ga0495638_0019940 Ga0495638_0019940_2554_3189 211
427 3300046491 Ga0495584_0004777 Ga0495584_0004777_1383_2021 211
428 3300046491 Ga0495584_0005863 Ga0495584_0005863_1442_2077 211
429 3300046492 Ga0495585_0050860 Ga0495585_0050860_422_1060 211
430 3300046501 Ga0495607_0001028 Ga0495607_0001028_10586_11221 211
431 3300046501 Ga0495607_0024992 Ga0495607_0024992_86_724 211
432 3300046506 Ga0495583_0026289 Ga0495583_0026289_43_678 211
433 3300046507 Ga0495606_0023481 Ga0495606_0023481_764_1402 211
434 3300046513 Ga0495616_0004047 Ga0495616_0004047_1233_1868 211
435 3300046513 Ga0495616_0022274 Ga0495616_0022274_2548_3186 211
436 3300046523 Ga0495644_0003305 Ga0495644_0003305_2691_3329 211
437 3300046530 Ga0495654_0110796 Ga0495654_0110796_328_972 211
438 3300046538 Ga0495609_0000250 Ga0495609_0000250_22257_22892 211
439 3300046542 Ga0495597_0023058 Ga0495597_0023058_1688_2332 211
440 3300046557 Ga0495622_0178831 Ga0495622_0178831_99_737 211
441 3300046558 Ga0495633_0038389 Ga0495633_0038389_252_890 211
442 3300046648 Ga0495611_0002414 Ga0495611_0002414_5497_6135 211
443 3300046660 Ga0495625_0003570 Ga0495625_0003570_8208_8843 211
444 3300046660 Ga0495625_0005246 Ga0495625_0005246_1468_2112 211
445 3300046660 Ga0495625_0148774 Ga0495625_0148774_880_1518 211
446 3300046664 Ga0495659_0000008 Ga0495659_0000008_23524_24168 211
447 3300046664 Ga0495659_0001006 Ga0495659_0001006_5550_6185 211
448 3300046664 Ga0495659_0277095 Ga0495659_0277095_45_683 211
449 3300046665 Ga0495661_0016554 Ga0495661_0016554_4080_4715 211
450 3300046684 Ga0495669_0019092 Ga0495669_0019092_663_1298 211
451 3300046691 Ga0495670_0022608 Ga0495670_0022608_799_1437 211
452 3300046691 Ga0495670_0116504 Ga0495670_0116504_367_1002 211
453 3300046692 Ga0495671_0000155 Ga0495671_0000155_30968_31612 211
454 3300046692 Ga0495671_0038447 Ga0495671_0038447_226_864 211
455 3300046810 Ga0495660_0000339 Ga0495660_0000339_9105_9743 211
456 3300047318 Ga0495636_0003359 Ga0495636_0003359_5208_5843 211
457 3300047320 Ga0495672_0000169 Ga0495672_0000169_536_1180 211
458 3300047320 Ga0495672_0040006 Ga0495672_0040006_1603_2241 211
459 3300047323 Ga0495683_0039608 Ga0495683_0039608_253_891 211
460 3300047443 Ga0495687_053497 Ga0495687_053497_774_1409 211
461 3300047445 Ga0495677_0002637 Ga0495677_0002637_743_1378 211
462 3300047469 Ga0495673_0007387 Ga0495673_0007387_5508_6146 211
463 3300047470 Ga0495681_0019522 Ga0495681_0019522_278_913 211
464 3300047472 Ga0495686_0008183 Ga0495686_0008183_2637_3275 211
465 3300049460 Ga0495682_0000370 Ga0495682_0000370_27364_28002 211
466 3300049460 Ga0495682_0042770 Ga0495682_0042770_150_788 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08768

THAP4_heme-bd

THAP4-like, heme-binding beta-barrel domain

33

209

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wje-assembly1.cif.gz_A crystal structure of mutant nitrobindin m75w/h76l/q96c/m148l/h158l (nb6) from arabidopsis thaliana 0.823 15 200
3wje-assembly1.cif.gz_A crystal structure of mutant nitrobindin m75w/h76l/q96c/m148l/h158l (nb6) from arabidopsis thaliana 0.818 15 200
3ia8-assembly1.cif.gz_A the structure of the c-terminal heme nitrobindin domain of thap domain-containing protein 4 from homo sapiens 0.8108 16 200
2a13-assembly1.cif.gz_A x-ray structure of protein from arabidopsis thaliana at1g79260 0.7954 22 200
3ia8-assembly1.cif.gz_A the structure of the c-terminal heme nitrobindin domain of thap domain-containing protein 4 from homo sapiens 0.7926 16 200
ID Description Score Start End Superfamily
3ia8B00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8483 23 200 2.40.128.20
3wjeB00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8184 22 200 2.40.128.20
3ia8B00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8079 23 200 2.40.128.20
af_Q22857_66_227_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.807 22 200 2.40.128.20
af_Q18793_24_191_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7966 25 200 2.40.128.20
ID Description Score Start End GO Terms
AF-A0A3P1XIV0-F1-model_v4 deleted 0.9953 4 210
AF-A0A7Y7IB24-F1-model_v4 THAP4-like heme-binding beta-barrel domain-containing protein 0.9946 4 210
AF-A0A381EA63-F1-model_v4 Uncharacterized conserved protein 0.9935 4 210
AF-A0A366FDZ7-F1-model_v4 THAP4-like heme-binding beta-barrel domain-containing protein 0.9932 1 210
AF-A0A562IKF3-F1-model_v4 THAP4-like heme-binding beta-barrel domain-containing protein 0.993 1 210

Feature Viewer

pLDDT pTM Quality
94.99 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map