F449614
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 466 | 234 | 460 | 97 |
Family's Representative Sequence
| Representative Sequence | 3300005347|Ga0070668_102071054|Ga0070668_1020710541 |
| Length | 103 |
| Sequence | MVRSRTLSAPARKALAIMAGASARWWHGYELCQQAGIKSGTLYPLLMRLAAQRYLEAEWQPPEEPGRPARHAYRLTAAGRQLAHENPPARAGERXXXPEERLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 2 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 3 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 4 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 5 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 13 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 14 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 84 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 90 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 142 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 143 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 144 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 145 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 146 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 147 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 148 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 149 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 150 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 151 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 152 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 153 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 154 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 155 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 156 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 157 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 158 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 159 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 160 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 161 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 162 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 163 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 164 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 165 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 166 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 167 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 168 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 169 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 170 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 171 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 172 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 173 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 174 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 175 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 176 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 177 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 178 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 179 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 180 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 181 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 182 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 185 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 186 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 187 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 188 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 189 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 190 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 193 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 194 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 209 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 210 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 211 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 212 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 213 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 214 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 215 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 216 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 217 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 218 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 219 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 222 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 224 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 225 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 227 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 228 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 229 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 230 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 231 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 232 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 233 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 234 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.71 |
| Metatranscriptomes | 0 |
| Isolates | 1.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.52 |
| Nodule | 0 |
| Rhizoplane | 1.29 |
| Rhizosphere | 77.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1009892 | 3300001904 | Bacteria | 1565 |
| 2 | JGI24736J21556_1079632 | 3300001904 | Bacteria | 514 |
| 3 | JGI24740J21852_10064426 | 3300001979 | Bacteria | 1000 |
| 4 | JGI24740J21852_10099809 | 3300001979 | Bacteria | 740 |
| 5 | JGI24739J22299_10000613 | 3300001989 | Bacteria | 12785 |
| 6 | JGI24739J22299_10019069 | 3300001989 | Bacteria | 2459 |
| 7 | JGI24739J22299_10019365 | 3300001989 | Bacteria | 2436 |
| 8 | JGI24739J22299_10255130 | 3300001989 | Bacteria | 514 |
| 9 | JGI24737J22298_10000132 | 3300001990 | Bacteria | 22883 |
| 10 | JGI24737J22298_10019340 | 3300001990 | Bacteria | 2178 |
| 11 | JGI24737J22298_10021304 | 3300001990 | Bacteria | 2067 |
| 12 | JGI24737J22298_10047246 | 3300001990 | Unclassified | 1312 |
| 13 | JGI24743J22301_10023050 | 3300001991 | Unclassified | 1197 |
| 14 | JGI24735J21928_10000391 | 3300002067 | Bacteria | 15267 |
| 15 | JGI24735J21928_10001784 | 3300002067 | Bacteria | 7557 |
| 16 | JGI24735J21928_10009812 | 3300002067 | Bacteria | 3066 |
| 17 | JGI24735J21928_10013733 | 3300002067 | Bacteria | 2541 |
| 18 | JGI24735J21928_10014956 | 3300002067 | Bacteria | 2425 |
| 19 | JGI24735J21928_10053430 | 3300002067 | Bacteria | 1165 |
| 20 | JGI24735J21928_10074498 | 3300002067 | Bacteria | 972 |
| 21 | JGI24738J21930_10000280 | 3300002075 | Bacteria | 13977 |
| 22 | JGI24738J21930_10002675 | 3300002075 | Bacteria | 4591 |
| 23 | JGI24744J21845_10008009 | 3300002077 | Bacteria | 2182 |
| 24 | JGI25150J39212_1024134 | 3300002774 | Bacteria | 896 |
| 25 | JGI25151J46595_10091510 | 3300003187 | Bacteria | 845 |
| 26 | JGI25165J46597_1000173 | 3300003214 | Bacteria | 100834 |
| 27 | JGI25153J46596_10000231 | 3300003215 | Bacteria | 47177 |
| 28 | rootH1_10000365 | 3300003316 | Bacteria | 8254 |
| 29 | rootH1_10173631 | 3300003316 | Bacteria | 1320 |
| 30 | rootH2_10171796 | 3300003320 | Bacteria | 1447 |
| 31 | rootL2_10136660 | 3300003322 | Bacteria | 1251 |
| 32 | rootL2_10189986 | 3300003322 | Bacteria | 2304 |
| 33 | Ga0055525_1000086 | 3300003759 | Bacteria | 150228 |
| 34 | Ga0055542_1000041 | 3300003762 | Bacteria | 208892 |
| 35 | Ga0055542_1005909 | 3300003762 | Bacteria | 2684 |
| 36 | Ga0055529_1000040 | 3300003763 | Bacteria | 230562 |
| 37 | Ga0055524_1000118 | 3300003775 | Bacteria | 93202 |
| 38 | Ga0055536_1006364 | 3300003781 | Bacteria | 5539 |
| 39 | Ga0055536_1010731 | 3300003781 | Bacteria | 3595 |
| 40 | Ga0055528_1034854 | 3300003790 | Bacteria | 1232 |
| 41 | Ga0055530_10000074 | 3300003791 | Bacteria | 85116 |
| 42 | Ga0055540_1001746 | 3300003792 | Bacteria | 12453 |
| 43 | Ga0055531_10001454 | 3300003794 | Bacteria | 17456 |
| 44 | Ga0055531_10001624 | 3300003794 | Bacteria | 16296 |
| 45 | Ga0055543_1018388 | 3300004625 | Bacteria | 1304 |
| 46 | Ga0065165_1004490 | 3300005262 | Bacteria | 8586 |
| 47 | Ga0070658_10003160 | 3300005327 | Bacteria | 13594 |
| 48 | Ga0070658_10026308 | 3300005327 | Bacteria | 4667 |
| 49 | Ga0070658_10201127 | 3300005327 | Bacteria | 1681 |
| 50 | Ga0070658_11497691 | 3300005327 | Bacteria | 585 |
| 51 | Ga0070670_100104754 | 3300005331 | Bacteria | 2437 |
| 52 | Ga0070677_10242088 | 3300005333 | Bacteria | 891 |
| 53 | Ga0070660_100001071 | 3300005339 | Bacteria | 18386 |
| 54 | Ga0070660_100008989 | 3300005339 | Bacteria | 7009 |
| 55 | Ga0070660_100025697 | 3300005339 | Bacteria | 4379 |
| 56 | Ga0070660_100571541 | 3300005339 | Bacteria | 944 |
| 57 | Ga0070660_100704082 | 3300005339 | Bacteria | 847 |
| 58 | Ga0070661_100000189 | 3300005344 | Bacteria | 51018 |
| 59 | Ga0070661_101163218 | 3300005344 | Unclassified | 644 |
| 60 | Ga0070668_102071054 | 3300005347 | Unclassified | 525 |
| 61 | Ga0070669_100088096 | 3300005353 | Bacteria | 2323 |
| 62 | Ga0070669_100298042 | 3300005353 | Bacteria | 1296 |
| 63 | Ga0070675_100010770 | 3300005354 | Bacteria | 7153 |
| 64 | Ga0070675_100990794 | 3300005354 | Bacteria | 771 |
| 65 | Ga0070675_101253981 | 3300005354 | Bacteria | 683 |
| 66 | Ga0070671_100027923 | 3300005355 | Bacteria | 4646 |
| 67 | Ga0070671_100048789 | 3300005355 | Bacteria | 3522 |
| 68 | Ga0070674_101048865 | 3300005356 | Bacteria | 718 |
| 69 | Ga0070674_101516180 | 3300005356 | Unclassified | 603 |
| 70 | Ga0070673_101100561 | 3300005364 | Bacteria | 742 |
| 71 | Ga0070673_102315462 | 3300005364 | Bacteria | 511 |
| 72 | Ga0070659_100151038 | 3300005366 | Bacteria | 1895 |
| 73 | Ga0070659_100274712 | 3300005366 | Bacteria | 1401 |
| 74 | Ga0070659_100307128 | 3300005366 | Unclassified | 1324 |
| 75 | Ga0070659_100323797 | 3300005366 | Bacteria | 1289 |
| 76 | Ga0070659_100370906 | 3300005366 | Bacteria | 1204 |
| 77 | Ga0070659_100784187 | 3300005366 | Bacteria | 828 |
| 78 | Ga0070663_100001458 | 3300005455 | Bacteria | 12998 |
| 79 | Ga0070663_100166444 | 3300005455 | Bacteria | 1701 |
| 80 | Ga0070678_100005285 | 3300005456 | Bacteria | 7442 |
| 81 | Ga0070662_100028503 | 3300005457 | Bacteria | 3886 |
| 82 | Ga0070662_100151535 | 3300005457 | Bacteria | 1806 |
| 83 | Ga0070662_100455749 | 3300005457 | Bacteria | 1062 |
| 84 | Ga0070662_100558159 | 3300005457 | Bacteria | 960 |
| 85 | Ga0070681_10012761 | 3300005458 | Bacteria | 8337 |
| 86 | Ga0070679_100000019 | 3300005530 | Bacteria | 127108 |
| 87 | Ga0070679_100380610 | 3300005530 | Unclassified | 1358 |
| 88 | Ga0068853_100006801 | 3300005539 | Bacteria | 9119 |
| 89 | Ga0068853_101341364 | 3300005539 | Bacteria | 692 |
| 90 | Ga0070672_100199065 | 3300005543 | Bacteria | 1675 |
| 91 | Ga0070693_100527914 | 3300005547 | Bacteria | 841 |
| 92 | Ga0070665_100000564 | 3300005548 | Bacteria | 51696 |
| 93 | Ga0070665_101857790 | 3300005548 | Unclassified | 608 |
| 94 | Ga0068855_100000007 | 3300005563 | Bacteria | 273676 |
| 95 | Ga0068855_100031458 | 3300005563 | Bacteria | 6336 |
| 96 | Ga0068855_100177510 | 3300005563 | Bacteria | 2409 |
| 97 | Ga0068855_101554324 | 3300005563 | Bacteria | 678 |
| 98 | Ga0070664_100319288 | 3300005564 | Bacteria | 1407 |
| 99 | Ga0068857_100150492 | 3300005577 | Unclassified | 2108 |
| 100 | Ga0068854_100000263 | 3300005578 | Bacteria | 35721 |
| 101 | Ga0068854_100006607 | 3300005578 | Bacteria | 7386 |
| 102 | Ga0068854_100035323 | 3300005578 | Bacteria | 3497 |
| 103 | Ga0068854_100250188 | 3300005578 | Bacteria | 1415 |
| 104 | Ga0068854_101931083 | 3300005578 | Bacteria | 543 |
| 105 | Ga0068856_100343936 | 3300005614 | Bacteria | 1510 |
| 106 | Ga0068856_100362726 | 3300005614 | Bacteria | 1467 |
| 107 | Ga0068856_100753968 | 3300005614 | Unclassified | 993 |
| 108 | Ga0068856_101984760 | 3300005614 | Unclassified | 592 |
| 109 | Ga0068852_100002646 | 3300005616 | Bacteria | 12375 |
| 110 | Ga0068852_100345616 | 3300005616 | Bacteria | 1451 |
| 111 | Ga0068852_100468277 | 3300005616 | Unclassified | 1250 |
| 112 | Ga0068852_102442119 | 3300005616 | Bacteria | 543 |
| 113 | Ga0068859_100031328 | 3300005617 | Bacteria | 5340 |
| 114 | Ga0068851_10064832 | 3300005834 | Bacteria | 1878 |
| 115 | Ga0068860_100012470 | 3300005843 | Bacteria | 8370 |
| 116 | Ga0068862_101128051 | 3300005844 | Bacteria | 780 |
| 117 | Ga0081539_10020671 | 3300005985 | Bacteria | 4435 |
| 118 | Ga0097621_100017199 | 3300006237 | Bacteria | 5488 |
| 119 | Ga0075370_10312673 | 3300006353 | Unclassified | 935 |
| 120 | Ga0068871_100049146 | 3300006358 | Bacteria | 3408 |
| 121 | Ga0097620_100031327 | 3300006931 | Bacteria | 5340 |
| 122 | Ga0105240_10009918 | 3300009093 | Bacteria | 13429 |
| 123 | Ga0105240_10294499 | 3300009093 | Bacteria | 1859 |
| 124 | Ga0105240_10987838 | 3300009093 | Bacteria | 901 |
| 125 | Ga0105243_11964048 | 3300009148 | Bacteria | 619 |
| 126 | Ga0105241_10046419 | 3300009174 | Bacteria | 3299 |
| 127 | Ga0105237_10000699 | 3300009545 | Bacteria | 46489 |
| 128 | Ga0105237_10194431 | 3300009545 | Bacteria | 2028 |
| 129 | Ga0105237_10426153 | 3300009545 | Bacteria | 1332 |
| 130 | Ga0105237_10735971 | 3300009545 | Bacteria | 993 |
| 131 | Ga0105238_10282194 | 3300009551 | Bacteria | 1642 |
| 132 | Ga0105239_10032266 | 3300010375 | Bacteria | 5756 |
| 133 | Ga0105239_10309939 | 3300010375 | Bacteria | 1779 |
| 134 | Ga0105239_10386347 | 3300010375 | Bacteria | 1583 |
| 135 | Ga0105239_13000822 | 3300010375 | Unclassified | 550 |
| 136 | Ga0105239_13091563 | 3300010375 | Bacteria | 542 |
| 137 | Ga0105246_10108712 | 3300011119 | Bacteria | 2033 |
| 138 | Ga0157373_10043395 | 3300013100 | Bacteria | 3212 |
| 139 | Ga0157373_10101379 | 3300013100 | Bacteria | 2026 |
| 140 | Ga0157373_10451556 | 3300013100 | Bacteria | 925 |
| 141 | Ga0157371_10085752 | 3300013102 | Bacteria | 2231 |
| 142 | Ga0157371_10343177 | 3300013102 | Bacteria | 1086 |
| 143 | Ga0157371_10675467 | 3300013102 | Bacteria | 772 |
| 144 | Ga0157371_11494187 | 3300013102 | Bacteria | 527 |
| 145 | Ga0157370_10000095 | 3300013104 | Bacteria | 100727 |
| 146 | Ga0157370_10423627 | 3300013104 | Bacteria | 1224 |
| 147 | Ga0157370_10550533 | 3300013104 | Bacteria | 1058 |
| 148 | Ga0157370_12143614 | 3300013104 | Bacteria | 501 |
| 149 | Ga0157369_10001136 | 3300013105 | Bacteria | 33292 |
| 150 | Ga0157369_10046364 | 3300013105 | Bacteria | 4724 |
| 151 | Ga0157369_10075134 | 3300013105 | Bacteria | 3624 |
| 152 | Ga0157369_10324607 | 3300013105 | Bacteria | 1600 |
| 153 | Ga0157369_10638402 | 3300013105 | Bacteria | 1098 |
| 154 | Ga0157369_11427938 | 3300013105 | Unclassified | 704 |
| 155 | Ga0157369_11448113 | 3300013105 | Bacteria | 699 |
| 156 | Ga0157374_10014640 | 3300013296 | Bacteria | 6865 |
| 157 | Ga0157372_10013535 | 3300013307 | Bacteria | 8718 |
| 158 | Ga0157372_10096974 | 3300013307 | Bacteria | 3361 |
| 159 | Ga0157372_10160072 | 3300013307 | Bacteria | 2602 |
| 160 | Ga0157372_10170674 | 3300013307 | Bacteria | 2516 |
| 161 | Ga0157372_10204405 | 3300013307 | Bacteria | 2288 |
| 162 | Ga0157372_10273824 | 3300013307 | Bacteria | 1962 |
| 163 | Ga0157372_10493955 | 3300013307 | Bacteria | 1427 |
| 164 | Ga0157372_13188496 | 3300013307 | Unclassified | 523 |
| 165 | Ga0157375_13339979 | 3300013308 | Unclassified | 535 |
| 166 | Ga0157380_10144440 | 3300014326 | Bacteria | 2049 |
| 167 | Ga0157380_10792295 | 3300014326 | Bacteria | 964 |
| 168 | Ga0157380_11570052 | 3300014326 | Unclassified | 713 |
| 169 | Ga0163161_10067589 | 3300017792 | Bacteria | 2610 |
| 170 | Ga0213876_10000617 | 3300021384 | Bacteria | 26182 |
| 171 | Ga0209674_106476 | 3300025226 | Bacteria | 1593 |
| 172 | Ga0209563_100024 | 3300025230 | Bacteria | 601155 |
| 173 | Ga0209563_100125 | 3300025230 | Bacteria | 113854 |
| 174 | Ga0207427_100701 | 3300025231 | Bacteria | 15709 |
| 175 | Ga0209437_122103 | 3300025233 | Bacteria | 752 |
| 176 | Ga0207425_1000088 | 3300025245 | Bacteria | 91367 |
| 177 | Ga0209026_1003219 | 3300025250 | Bacteria | 5502 |
| 178 | Ga0209677_106522 | 3300025253 | Bacteria | 2740 |
| 179 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 180 | Ga0209148_1000355 | 3300025254 | Bacteria | 59062 |
| 181 | Ga0209148_1003190 | 3300025254 | Bacteria | 4705 |
| 182 | Ga0209129_1003978 | 3300025258 | Bacteria | 6089 |
| 183 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 184 | Ga0209565_1013173 | 3300025263 | Bacteria | 1944 |
| 185 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 186 | Ga0209455_1000423 | 3300025272 | Bacteria | 33215 |
| 187 | Ga0209455_1049840 | 3300025272 | Unclassified | 591 |
| 188 | Ga0209676_1000187 | 3300025292 | Bacteria | 141338 |
| 189 | Ga0209676_1016315 | 3300025292 | Bacteria | 2687 |
| 190 | Ga0209025_1001369 | 3300025294 | Bacteria | 32728 |
| 191 | Ga0209758_1000007 | 3300025297 | Bacteria | 1270410 |
| 192 | Ga0209758_1000009 | 3300025297 | Bacteria | 1123483 |
| 193 | Ga0209050_1000005 | 3300025298 | Bacteria | 1557793 |
| 194 | Ga0209050_1000039 | 3300025298 | Bacteria | 410069 |
| 195 | Ga0207426_1077786 | 3300025302 | Bacteria | 907 |
| 196 | Ga0209051_1000727 | 3300025303 | Bacteria | 35760 |
| 197 | Ga0209257_1000051 | 3300025304 | Bacteria | 434166 |
| 198 | Ga0209257_1003342 | 3300025304 | Bacteria | 13875 |
| 199 | Ga0209257_1003939 | 3300025304 | Bacteria | 12060 |
| 200 | Ga0209257_1004514 | 3300025304 | Bacteria | 10710 |
| 201 | Ga0209257_1032423 | 3300025304 | Bacteria | 1657 |
| 202 | Ga0209257_1099808 | 3300025304 | Unclassified | 710 |
| 203 | Ga0207656_10235944 | 3300025321 | Bacteria | 893 |
| 204 | Ga0207682_10034549 | 3300025893 | Bacteria | 2038 |
| 205 | Ga0207688_10019118 | 3300025901 | Bacteria | 3729 |
| 206 | Ga0207688_10460173 | 3300025901 | Bacteria | 794 |
| 207 | Ga0207647_10001674 | 3300025904 | Bacteria | 17073 |
| 208 | Ga0207647_10011674 | 3300025904 | Bacteria | 6148 |
| 209 | Ga0207647_10016218 | 3300025904 | Bacteria | 5086 |
| 210 | Ga0207647_10033758 | 3300025904 | Bacteria | 3273 |
| 211 | Ga0207647_10043810 | 3300025904 | Bacteria | 2798 |
| 212 | Ga0207647_10515910 | 3300025904 | Bacteria | 665 |
| 213 | Ga0207705_10030679 | 3300025909 | Bacteria | 3836 |
| 214 | Ga0207705_10091578 | 3300025909 | Unclassified | 2227 |
| 215 | Ga0207705_11190414 | 3300025909 | Bacteria | 585 |
| 216 | Ga0207654_10164360 | 3300025911 | Bacteria | 1436 |
| 217 | Ga0207707_10024148 | 3300025912 | Bacteria | 5318 |
| 218 | Ga0207695_10017354 | 3300025913 | Bacteria | 8376 |
| 219 | Ga0207671_10034401 | 3300025914 | Bacteria | 3764 |
| 220 | Ga0207671_10476785 | 3300025914 | Bacteria | 994 |
| 221 | Ga0207660_10000452 | 3300025917 | Bacteria | 27021 |
| 222 | Ga0207660_11642153 | 3300025917 | Unclassified | 517 |
| 223 | Ga0207657_10001208 | 3300025919 | Bacteria | 27508 |
| 224 | Ga0207657_10009838 | 3300025919 | Bacteria | 9577 |
| 225 | Ga0207657_10020998 | 3300025919 | Bacteria | 6157 |
| 226 | Ga0207657_10033235 | 3300025919 | Bacteria | 4651 |
| 227 | Ga0207657_10373851 | 3300025919 | Unclassified | 1123 |
| 228 | Ga0207649_10000055 | 3300025920 | Bacteria | 103054 |
| 229 | Ga0207649_11205265 | 3300025920 | Unclassified | 598 |
| 230 | Ga0207649_11411535 | 3300025920 | Unclassified | 551 |
| 231 | Ga0207652_10000004 | 3300025921 | Bacteria | 436303 |
| 232 | Ga0207652_11187840 | 3300025921 | Bacteria | 664 |
| 233 | Ga0207681_10386678 | 3300025923 | Bacteria | 1127 |
| 234 | Ga0207681_10673706 | 3300025923 | Bacteria | 859 |
| 235 | Ga0207681_11379228 | 3300025923 | Bacteria | 592 |
| 236 | Ga0207694_10217435 | 3300025924 | Bacteria | 1558 |
| 237 | Ga0207650_10095219 | 3300025925 | Unclassified | 2282 |
| 238 | Ga0207659_10063052 | 3300025926 | Bacteria | 2678 |
| 239 | Ga0207659_10734322 | 3300025926 | Bacteria | 846 |
| 240 | Ga0207644_10009173 | 3300025931 | Bacteria | 6488 |
| 241 | Ga0207644_10087596 | 3300025931 | Bacteria | 2314 |
| 242 | Ga0207690_10105979 | 3300025932 | Bacteria | 2016 |
| 243 | Ga0207690_10267577 | 3300025932 | Unclassified | 1327 |
| 244 | Ga0207690_10284058 | 3300025932 | Bacteria | 1290 |
| 245 | Ga0207690_10658619 | 3300025932 | Bacteria | 858 |
| 246 | Ga0207690_10712390 | 3300025932 | Unclassified | 826 |
| 247 | Ga0207706_10006577 | 3300025933 | Bacteria | 10765 |
| 248 | Ga0207706_10058745 | 3300025933 | Bacteria | 3387 |
| 249 | Ga0207706_10407405 | 3300025933 | Bacteria | 1179 |
| 250 | Ga0207706_10552403 | 3300025933 | Bacteria | 991 |
| 251 | Ga0207709_10169775 | 3300025935 | Bacteria | 1529 |
| 252 | Ga0207669_11223404 | 3300025937 | Unclassified | 637 |
| 253 | Ga0207669_11702846 | 3300025937 | Unclassified | 538 |
| 254 | Ga0207691_10177291 | 3300025940 | Bacteria | 1863 |
| 255 | Ga0207691_10340432 | 3300025940 | Bacteria | 1284 |
| 256 | Ga0207679_10686331 | 3300025945 | Bacteria | 928 |
| 257 | Ga0207667_10000038 | 3300025949 | Bacteria | 280720 |
| 258 | Ga0207667_10067601 | 3300025949 | Bacteria | 3722 |
| 259 | Ga0207667_12129811 | 3300025949 | Bacteria | 519 |
| 260 | Ga0207651_10603492 | 3300025960 | Bacteria | 960 |
| 261 | Ga0207651_11995512 | 3300025960 | Bacteria | 521 |
| 262 | Ga0207640_10001332 | 3300025981 | Bacteria | 13406 |
| 263 | Ga0207640_10026503 | 3300025981 | Bacteria | 3521 |
| 264 | Ga0207640_10031613 | 3300025981 | Bacteria | 3273 |
| 265 | Ga0207640_10210994 | 3300025981 | Bacteria | 1479 |
| 266 | Ga0207677_11733089 | 3300026023 | Bacteria | 579 |
| 267 | Ga0207639_10003636 | 3300026041 | Bacteria | 10359 |
| 268 | Ga0207639_10013915 | 3300026041 | Bacteria | 5643 |
| 269 | Ga0207639_10077304 | 3300026041 | Bacteria | 2623 |
| 270 | Ga0207639_11751469 | 3300026041 | Bacteria | 582 |
| 271 | Ga0207678_10004209 | 3300026067 | Bacteria | 12911 |
| 272 | Ga0207678_10091419 | 3300026067 | Bacteria | 2601 |
| 273 | Ga0207678_11458861 | 3300026067 | Unclassified | 604 |
| 274 | Ga0207702_10056450 | 3300026078 | Bacteria | 3334 |
| 275 | Ga0207702_10132077 | 3300026078 | Bacteria | 2248 |
| 276 | Ga0207641_10353318 | 3300026088 | Unclassified | 1401 |
| 277 | Ga0207674_10049898 | 3300026116 | Bacteria | 4277 |
| 278 | Ga0207674_10873142 | 3300026116 | Bacteria | 867 |
| 279 | Ga0207683_10019962 | 3300026121 | Bacteria | 5725 |
| 280 | Ga0207698_10000404 | 3300026142 | Bacteria | 24885 |
| 281 | Ga0207698_10301865 | 3300026142 | Bacteria | 1491 |
| 282 | Ga0207698_11569733 | 3300026142 | Bacteria | 673 |
| 283 | Ga0268266_10003466 | 3300028379 | Bacteria | 15738 |
| 284 | Ga0268265_10838407 | 3300028380 | Bacteria | 899 |
| 285 | Ga0268264_10197719 | 3300028381 | Bacteria | 1837 |
| 286 | Ga0307405_11828634 | 3300031731 | Unclassified | 540 |
| 287 | Ga0307413_10016736 | 3300031824 | Bacteria | 3798 |
| 288 | Ga0307410_10019211 | 3300031852 | Bacteria | 4151 |
| 289 | Ga0307407_10170114 | 3300031903 | Unclassified | 1434 |
| 290 | Ga0307409_100007226 | 3300031995 | Bacteria | 6622 |
| 291 | Ga0307414_10045706 | 3300032004 | Bacteria | 3000 |
| 292 | Ga0307414_10330451 | 3300032004 | Bacteria | 1301 |
| 293 | Ga0307414_11687693 | 3300032004 | Unclassified | 591 |
| 294 | Ga0307411_10102698 | 3300032005 | Bacteria | 2026 |
| 295 | Ga0307411_10339155 | 3300032005 | Bacteria | 1221 |
| 296 | Ga0307411_12000740 | 3300032005 | Unclassified | 541 |
| 297 | Ga0307415_100729408 | 3300032126 | Unclassified | 897 |
| 298 | Ga0307415_100958496 | 3300032126 | Unclassified | 792 |
| 299 | Ga0395899_0058868 | 3300037312 | Bacteria | 2832 |
| 300 | Ga0395900_0051263 | 3300037418 | Bacteria | 4252 |
| 301 | Ga0395900_0093484 | 3300037418 | Bacteria | 3089 |
| 302 | Ga0395900_1320168 | 3300037418 | Bacteria | 635 |
| 303 | Ga0395900_1475869 | 3300037418 | Unclassified | 592 |
| 304 | Ga0395898_1165622 | 3300037466 | Unclassified | 702 |
| 305 | Ga0395905_0036479 | 3300037471 | Bacteria | 4618 |
| 306 | Ga0395905_0103885 | 3300037471 | Bacteria | 2667 |
| 307 | Ga0395905_0202658 | 3300037471 | Bacteria | 1860 |
| 308 | Ga0395905_0409354 | 3300037471 | Bacteria | 1252 |
| 309 | Ga0395905_0803885 | 3300037471 | Unclassified | 843 |
| 310 | Ga0436364_0184680 | 3300037853 | Unclassified | 660 |
| 311 | Ga0395901_0072959 | 3300038443 | Bacteria | 3579 |
| 312 | Ga0395901_0163929 | 3300038443 | Bacteria | 2334 |
| 313 | Ga0436365_1161979 | 3300039437 | Bacteria | 35526 |
| 314 | Ga0436365_1722611 | 3300039437 | Bacteria | 934 |
| 315 | Ga0436363_0673488 | 3300039450 | Bacteria | 566 |
| 316 | Ga0439436_0025671 | 3300041404 | Bacteria | 1730 |
| 317 | Ga0439436_0053221 | 3300041404 | Bacteria | 1140 |
| 318 | Ga0439436_0109351 | 3300041404 | Bacteria | 771 |
| 319 | Ga0439439_0040773 | 3300041406 | Bacteria | 1202 |
| 320 | Ga0439439_0241816 | 3300041406 | Bacteria | 533 |
| 321 | Ga0439447_082409 | 3300041407 | Bacteria | 742 |
| 322 | Ga0439461_0000800 | 3300041410 | Bacteria | 4631 |
| 323 | Ga0439461_0003244 | 3300041410 | Bacteria | 2666 |
| 324 | Ga0439461_0009372 | 3300041410 | Bacteria | 1774 |
| 325 | Ga0439466_0060653 | 3300041411 | Bacteria | 1219 |
| 326 | Ga0439466_0125618 | 3300041411 | Bacteria | 791 |
| 327 | Ga0439465_0000058 | 3300041413 | Bacteria | 23896 |
| 328 | Ga0439465_0006192 | 3300041413 | Bacteria | 3803 |
| 329 | Ga0439465_0006371 | 3300041413 | Bacteria | 3748 |
| 330 | Ga0439465_0022170 | 3300041413 | Bacteria | 1994 |
| 331 | Ga0439465_0030071 | 3300041413 | Bacteria | 1726 |
| 332 | Ga0451789_0553014 | 3300041443 | Bacteria | 608 |
| 333 | Ga0451793_1319936 | 3300041452 | Bacteria | 822 |
| 334 | Ga0451795_1411884 | 3300041456 | Unclassified | 589 |
| 335 | Ga0451833_0807197 | 3300041491 | Unclassified | 553 |
| 336 | Ga0439431_0000427 | 3300041997 | Bacteria | 8943 |
| 337 | Ga0439431_0002599 | 3300041997 | Bacteria | 3985 |
| 338 | Ga0439431_0004172 | 3300041997 | Bacteria | 3170 |
| 339 | Ga0439431_0020289 | 3300041997 | Bacteria | 1586 |
| 340 | Ga0439431_0108406 | 3300041997 | Bacteria | 767 |
| 341 | Ga0439442_009923 | 3300042002 | Bacteria | 1927 |
| 342 | Ga0439442_104367 | 3300042002 | Bacteria | 615 |
| 343 | Ga0439445_0001262 | 3300042004 | Bacteria | 5480 |
| 344 | Ga0439445_0002858 | 3300042004 | Bacteria | 3857 |
| 345 | Ga0439445_0015374 | 3300042004 | Bacteria | 1873 |
| 346 | Ga0439445_0020326 | 3300042004 | Bacteria | 1661 |
| 347 | Ga0439445_0024172 | 3300042004 | Bacteria | 1542 |
| 348 | Ga0439445_0026300 | 3300042004 | Bacteria | 1489 |
| 349 | Ga0439445_0028946 | 3300042004 | Bacteria | 1430 |
| 350 | Ga0439448_0001347 | 3300042005 | Bacteria | 6292 |
| 351 | Ga0439448_0022082 | 3300042005 | Bacteria | 1975 |
| 352 | Ga0439448_0024162 | 3300042005 | Bacteria | 1899 |
| 353 | Ga0439448_0029731 | 3300042005 | Bacteria | 1730 |
| 354 | Ga0439432_001007 | 3300042006 | Bacteria | 10647 |
| 355 | Ga0439432_003123 | 3300042006 | Bacteria | 6169 |
| 356 | Ga0439432_015958 | 3300042006 | Bacteria | 2530 |
| 357 | Ga0439449_0305722 | 3300042007 | Bacteria | 600 |
| 358 | Ga0439450_078111 | 3300042008 | Bacteria | 820 |
| 359 | Ga0439452_013772 | 3300042010 | Bacteria | 2262 |
| 360 | Ga0439452_028380 | 3300042010 | Bacteria | 1396 |
| 361 | Ga0439455_0000530 | 3300042012 | Bacteria | 5353 |
| 362 | Ga0439455_0001694 | 3300042012 | Bacteria | 3800 |
| 363 | Ga0439455_0003084 | 3300042012 | Bacteria | 3133 |
| 364 | Ga0439455_0004893 | 3300042012 | Bacteria | 2686 |
| 365 | Ga0439455_0017039 | 3300042012 | Bacteria | 1687 |
| 366 | Ga0439457_010560 | 3300042014 | Bacteria | 2120 |
| 367 | Ga0439462_0001356 | 3300042015 | Bacteria | 5408 |
| 368 | Ga0439462_0005516 | 3300042015 | Bacteria | 3120 |
| 369 | Ga0439462_0059858 | 3300042015 | Bacteria | 1030 |
| 370 | Ga0439462_0158330 | 3300042015 | Bacteria | 638 |
| 371 | Ga0450898_045443 | 3300042134 | Bacteria | 839 |
| 372 | Ga0439446_0003091 | 3300042156 | Bacteria | 4087 |
| 373 | Ga0439458_0000212 | 3300042157 | Bacteria | 13647 |
| 374 | Ga0439458_0000552 | 3300042157 | Bacteria | 9632 |
| 375 | Ga0439458_0000641 | 3300042157 | Bacteria | 9030 |
| 376 | Ga0439434_0001645 | 3300042435 | Bacteria | 6464 |
| 377 | Ga0439434_0003993 | 3300042435 | Bacteria | 4307 |
| 378 | Ga0439434_0022902 | 3300042435 | Bacteria | 1879 |
| 379 | Ga0439434_0024727 | 3300042435 | Bacteria | 1812 |
| 380 | Ga0439434_0108064 | 3300042435 | Bacteria | 899 |
| 381 | Ga0466972_0494928 | 3300044658 | Bacteria | 575 |
| 382 | Ga0466966_0030483 | 3300044684 | Plasmid | 3503 |
| 383 | Ga0466961_0001163 | 3300044693 | Bacteria | 16194 |
| 384 | Ga0466963_0104570 | 3300044694 | Bacteria | 1940 |
| 385 | Ga0466963_0901067 | 3300044694 | Bacteria | 623 |
| 386 | Ga0466963_0983525 | 3300044694 | Unclassified | 594 |
| 387 | Ga0466964_0034465 | 3300044706 | Bacteria | 2020 |
| 388 | Ga0466968_0115395 | 3300044735 | Bacteria | 1211 |
| 389 | Ga0466970_0002019 | 3300044765 | Bacteria | 9821 |
| 390 | Ga0466957_0110692 | 3300044842 | Bacteria | 1741 |
| 391 | Ga0466960_0054187 | 3300044901 | Unclassified | 1946 |
| 392 | Ga0466959_0023694 | 3300045049 | Bacteria | 4543 |
| 393 | Ga0466958_0052741 | 3300045836 | Bacteria | 2466 |
| 394 | Ga0466958_0161785 | 3300045836 | Bacteria | 1414 |
| 395 | Ga0466958_0640145 | 3300045836 | Bacteria | 692 |
| 396 | Ga0466967_0096341 | 3300045976 | Bacteria | 2699 |
| 397 | Ga0466967_0501251 | 3300045976 | Unclassified | 1191 |
| 398 | Ga0466967_0966490 | 3300045976 | Bacteria | 848 |
| 399 | Ga0495627_012033 | 3300046453 | Bacteria | 3081 |
| 400 | Ga0495650_0237181 | 3300046471 | Unclassified | 624 |
| 401 | Ga0495606_0002862 | 3300046507 | Bacteria | 19095 |
| 402 | Ga0495606_0128361 | 3300046507 | Bacteria | 1510 |
| 403 | Ga0495642_0009737 | 3300046528 | Bacteria | 3680 |
| 404 | Ga0495668_0456933 | 3300046616 | Bacteria | 703 |
| 405 | Ga0495625_0109130 | 3300046660 | Bacteria | 1893 |
| 406 | Ga0495670_0000037 | 3300046691 | Bacteria | 77395 |
| 407 | Ga0495671_0399285 | 3300046692 | Unclassified | 658 |
| 408 | Ga0495649_0285280 | 3300046694 | Bacteria | 843 |
| 409 | Ga0495660_0472722 | 3300046810 | Bacteria | 539 |
| 410 | Ga0495687_111976 | 3300047443 | Bacteria | 1001 |
| 411 | Ga0495673_0029088 | 3300047469 | Bacteria | 2611 |
| 412 | Ga0495681_0033013 | 3300047470 | Bacteria | 2598 |
| 413 | Ga0495681_0287806 | 3300047470 | Unclassified | 639 |
| 414 | Ga0495686_0001276 | 3300047472 | Bacteria | 28479 |
| 415 | Ga0496102_0418265 | 3300048905 | Bacteria | 1259 |
| 416 | Ga0496102_0840891 | 3300048905 | Bacteria | 840 |
| 417 | Ga0496115_0741624 | 3300048918 | Bacteria | 769 |
| 418 | Ga0496117_0014693 | 3300048920 | Bacteria | 6727 |
| 419 | Ga0496117_0419840 | 3300048920 | Unclassified | 669 |
| 420 | Ga0496118_0011963 | 3300048921 | Bacteria | 8387 |
| 421 | Ga0496118_0173168 | 3300048921 | Bacteria | 1315 |
| 422 | Ga0496120_0024742 | 3300048923 | Bacteria | 3738 |
| 423 | Ga0496121_0024764 | 3300048924 | Bacteria | 5726 |
| 424 | Ga0496121_0174328 | 3300048924 | Bacteria | 1559 |
| 425 | Ga0496122_0011314 | 3300048925 | Bacteria | 9058 |
| 426 | Ga0496122_0066088 | 3300048925 | Bacteria | 2616 |
| 427 | Ga0496123_0007037 | 3300048926 | Bacteria | 10709 |
| 428 | Ga0496123_0025194 | 3300048926 | Bacteria | 4492 |
| 429 | Ga0496123_0087132 | 3300048926 | Bacteria | 1869 |
| 430 | Ga0496123_0202751 | 3300048926 | Unclassified | 1015 |
| 431 | Ga0496124_0001368 | 3300048927 | Bacteria | 36509 |
| 432 | Ga0496124_0005887 | 3300048927 | Bacteria | 13575 |
| 433 | Ga0496124_0059884 | 3300048927 | Bacteria | 3197 |
| 434 | Ga0496124_0562992 | 3300048927 | Bacteria | 750 |
| 435 | Ga0496125_0264837 | 3300048928 | Bacteria | 1075 |
| 436 | Ga0496125_0309512 | 3300048928 | Bacteria | 963 |
| 437 | Ga0496125_0402128 | 3300048928 | Bacteria | 800 |
| 438 | Ga0496126_0323782 | 3300048929 | Bacteria | 1266 |
| 439 | Ga0501033_0386161 | 3300049570 | Unclassified | 978 |
| 440 | Ga0501034_0858927 | 3300049571 | Bacteria | 797 |
| 441 | Ga0501238_077597 | 3300049671 | Unclassified | 521 |
| 442 | Ga0501080_0568948 | 3300049742 | Bacteria | 1008 |
| 443 | Ga0501080_1019217 | 3300049742 | Bacteria | 717 |
| 444 | Ga0501241_004217 | 3300049758 | Bacteria | 2699 |
| 445 | Ga0501276_015292 | 3300049773 | Unclassified | 689 |
| 446 | Ga0501035_0054257 | 3300049822 | Bacteria | 3582 |
| 447 | nmdc:mga07m45_118528_c1 | 3300050496 | Unclassified | 1528 |
| 448 | Ga0500643_001018 | 3300053087 | Bacteria | 17087 |
| 449 | Ga0500643_004787 | 3300053087 | Bacteria | 5989 |
| 450 | Ga0500643_010613 | 3300053087 | Bacteria | 3415 |
| 451 | Ga0500643_109862 | 3300053087 | Unclassified | 745 |
| 452 | Ga0500643_188816 | 3300053087 | Bacteria | 552 |
| 453 | Ga0500566_0140795 | 3300053094 | Bacteria | 1280 |
| 454 | Ga0500650_0363648 | 3300053098 | Bacteria | 631 |
| 455 | Ga0500655_062209 | 3300053133 | Bacteria | 753 |
| 456 | Ga0500658_0001792 | 3300053134 | Bacteria | 8477 |
| 457 | Ga0500658_0014110 | 3300053134 | Bacteria | 2956 |
| 458 | Ga0500568_0038949 | 3300053139 | Bacteria | 1922 |
| 459 | Ga0500587_001316 | 3300053739 | Bacteria | 3486 |
| 460 | Ga0466962_0232672 | 3300061719 | Bacteria | 904 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041452 | Ga0451793_1319936 | Ga0451793_1319936_153_416 | 84 |
| 2 | 3300044842 | Ga0466957_0110692 | Ga0466957_0110692_175_477 | 86 |
| 3 | iso_pu_bacteria | 2818991466 | 2819716595 | 86 |
| 4 | iso_pu_bacteria | 2879163058 | 2879165410 | 86 |
| 5 | 3300003759 | Ga0055525_1000086 | Ga0055525_1000086147 | 88 |
| 6 | 3300003762 | Ga0055542_1000041 | Ga0055542_1000041110 | 88 |
| 7 | 3300003762 | Ga0055542_1005909 | Ga0055542_10059096 | 88 |
| 8 | 3300003763 | Ga0055529_1000040 | Ga0055529_1000040135 | 88 |
| 9 | 3300025230 | Ga0209563_100024 | Ga0209563_100024228 | 88 |
| 10 | 3300025254 | Ga0209148_1000008 | Ga0209148_1000008185 | 88 |
| 11 | 3300025272 | Ga0209455_1000002 | Ga0209455_10000021239 | 88 |
| 12 | 3300025297 | Ga0209758_1000007 | Ga0209758_1000007388 | 88 |
| 13 | 3300025920 | Ga0207649_11205265 | Ga0207649_112052652 | 88 |
| 14 | 3300032126 | Ga0307415_100958496 | Ga0307415_1009584962 | 88 |
| 15 | 3300005339 | Ga0070660_100001071 | Ga0070660_1000010714 | 89 |
| 16 | 3300021384 | Ga0213876_10000617 | Ga0213876_100006172 | 89 |
| 17 | 3300025226 | Ga0209674_106476 | Ga0209674_1064762 | 89 |
| 18 | 3300039437 | Ga0436365_1161979 | Ga0436365_1161979_330_599 | 89 |
| 19 | 3300039437 | Ga0436365_1722611 | Ga0436365_1722611_620_889 | 89 |
| 20 | 3300039450 | Ga0436363_0673488 | Ga0436363_0673488_247_516 | 89 |
| 21 | 3300046692 | Ga0495671_0399285 | Ga0495671_0399285_202_471 | 89 |
| 22 | 3300001979 | JGI24740J21852_10099809 | JGI24740J21852_100998092 | 90 |
| 23 | 3300002067 | JGI24735J21928_10013733 | JGI24735J21928_100137331 | 90 |
| 24 | 3300003316 | rootH1_10173631 | rootH1_101736312 | 90 |
| 25 | 3300003320 | rootH2_10171796 | rootH2_101717962 | 90 |
| 26 | 3300003781 | Ga0055536_1006364 | Ga0055536_10063642 | 90 |
| 27 | 3300005339 | Ga0070660_100704082 | Ga0070660_1007040821 | 90 |
| 28 | 3300005353 | Ga0070669_100088096 | Ga0070669_1000880965 | 90 |
| 29 | 3300005354 | Ga0070675_101253981 | Ga0070675_1012539812 | 90 |
| 30 | 3300005355 | Ga0070671_100027923 | Ga0070671_1000279233 | 90 |
| 31 | 3300005356 | Ga0070674_101048865 | Ga0070674_1010488651 | 90 |
| 32 | 3300005455 | Ga0070663_100166444 | Ga0070663_1001664441 | 90 |
| 33 | 3300005563 | Ga0068855_100177510 | Ga0068855_1001775103 | 90 |
| 34 | 3300005578 | Ga0068854_100006607 | Ga0068854_1000066072 | 90 |
| 35 | 3300005614 | Ga0068856_101984760 | Ga0068856_1019847602 | 90 |
| 36 | 3300006931 | Ga0097620_100031327 | Ga0097620_1000313275 | 90 |
| 37 | 3300009093 | Ga0105240_10009918 | Ga0105240_1000991812 | 90 |
| 38 | 3300009093 | Ga0105240_10294499 | Ga0105240_102944991 | 90 |
| 39 | 3300009148 | Ga0105243_11964048 | Ga0105243_119640482 | 90 |
| 40 | 3300009545 | Ga0105237_10000699 | Ga0105237_100006994 | 90 |
| 41 | 3300009545 | Ga0105237_10194431 | Ga0105237_101944313 | 90 |
| 42 | 3300010375 | Ga0105239_10309939 | Ga0105239_103099393 | 90 |
| 43 | 3300010375 | Ga0105239_10386347 | Ga0105239_103863471 | 90 |
| 44 | 3300011119 | Ga0105246_10108712 | Ga0105246_101087122 | 90 |
| 45 | 3300013100 | Ga0157373_10043395 | Ga0157373_100433952 | 90 |
| 46 | 3300013102 | Ga0157371_10085752 | Ga0157371_100857521 | 90 |
| 47 | 3300013102 | Ga0157371_11494187 | Ga0157371_114941871 | 90 |
| 48 | 3300013104 | Ga0157370_10000095 | Ga0157370_1000009549 | 90 |
| 49 | 3300013104 | Ga0157370_10550533 | Ga0157370_105505332 | 90 |
| 50 | 3300013104 | Ga0157370_12143614 | Ga0157370_121436142 | 90 |
| 51 | 3300013105 | Ga0157369_10046364 | Ga0157369_100463646 | 90 |
| 52 | 3300013105 | Ga0157369_10075134 | Ga0157369_100751344 | 90 |
| 53 | 3300013307 | Ga0157372_10013535 | Ga0157372_100135354 | 90 |
| 54 | 3300013307 | Ga0157372_10096974 | Ga0157372_100969744 | 90 |
| 55 | 3300013307 | Ga0157372_10170674 | Ga0157372_101706743 | 90 |
| 56 | 3300013307 | Ga0157372_10273824 | Ga0157372_102738242 | 90 |
| 57 | 3300013307 | Ga0157372_13188496 | Ga0157372_131884961 | 90 |
| 58 | 3300014326 | Ga0157380_10144440 | Ga0157380_101444403 | 90 |
| 59 | 3300014326 | Ga0157380_10792295 | Ga0157380_107922952 | 90 |
| 60 | 3300014326 | Ga0157380_11570052 | Ga0157380_115700521 | 90 |
| 61 | 3300025254 | Ga0209148_1000355 | Ga0209148_100035544 | 90 |
| 62 | 3300025272 | Ga0209455_1049840 | Ga0209455_10498402 | 90 |
| 63 | 3300025292 | Ga0209676_1000187 | Ga0209676_100018795 | 90 |
| 64 | 3300025298 | Ga0209050_1000039 | Ga0209050_1000039155 | 90 |
| 65 | 3300025302 | Ga0207426_1077786 | Ga0207426_10777862 | 90 |
| 66 | 3300025304 | Ga0209257_1000051 | Ga0209257_1000051155 | 90 |
| 67 | 3300025304 | Ga0209257_1032423 | Ga0209257_10324233 | 90 |
| 68 | 3300025901 | Ga0207688_10460173 | Ga0207688_104601731 | 90 |
| 69 | 3300025919 | Ga0207657_10009838 | Ga0207657_100098386 | 90 |
| 70 | 3300025921 | Ga0207652_11187840 | Ga0207652_111878401 | 90 |
| 71 | 3300025925 | Ga0207650_10095219 | Ga0207650_100952193 | 90 |
| 72 | 3300025926 | Ga0207659_10734322 | Ga0207659_107343221 | 90 |
| 73 | 3300025931 | Ga0207644_10087596 | Ga0207644_100875963 | 90 |
| 74 | 3300025932 | Ga0207690_10712390 | Ga0207690_107123902 | 90 |
| 75 | 3300025949 | Ga0207667_10067601 | Ga0207667_100676013 | 90 |
| 76 | 3300025981 | Ga0207640_10031613 | Ga0207640_100316135 | 90 |
| 77 | 3300026041 | Ga0207639_10013915 | Ga0207639_100139156 | 90 |
| 78 | 3300026067 | Ga0207678_10091419 | Ga0207678_100914193 | 90 |
| 79 | 3300026116 | Ga0207674_10873142 | Ga0207674_108731422 | 90 |
| 80 | 3300032005 | Ga0307411_10339155 | Ga0307411_103391551 | 90 |
| 81 | 3300037418 | Ga0395900_0051263 | Ga0395900_0051263_3425_3697 | 90 |
| 82 | 3300037418 | Ga0395900_1320168 | Ga0395900_1320168_147_419 | 90 |
| 83 | 3300037471 | Ga0395905_0202658 | Ga0395905_0202658_721_993 | 90 |
| 84 | 3300037471 | Ga0395905_0803885 | Ga0395905_0803885_171_443 | 90 |
| 85 | 3300038443 | Ga0395901_0072959 | Ga0395901_0072959_3050_3322 | 90 |
| 86 | 3300041404 | Ga0439436_0025671 | Ga0439436_0025671_1342_1617 | 90 |
| 87 | 3300041404 | Ga0439436_0109351 | Ga0439436_0109351_461_733 | 90 |
| 88 | 3300041406 | Ga0439439_0241816 | Ga0439439_0241816_229_501 | 90 |
| 89 | 3300041407 | Ga0439447_082409 | Ga0439447_082409_73_345 | 90 |
| 90 | 3300041410 | Ga0439461_0000800 | Ga0439461_0000800_3970_4242 | 90 |
| 91 | 3300041410 | Ga0439461_0003244 | Ga0439461_0003244_73_345 | 90 |
| 92 | 3300041413 | Ga0439465_0000058 | Ga0439465_0000058_12040_12315 | 90 |
| 93 | 3300041413 | Ga0439465_0022170 | Ga0439465_0022170_397_669 | 90 |
| 94 | 3300041413 | Ga0439465_0030071 | Ga0439465_0030071_25_297 | 90 |
| 95 | 3300041997 | Ga0439431_0002599 | Ga0439431_0002599_869_1144 | 90 |
| 96 | 3300041997 | Ga0439431_0004172 | Ga0439431_0004172_1341_1613 | 90 |
| 97 | 3300042002 | Ga0439442_104367 | Ga0439442_104367_154_426 | 90 |
| 98 | 3300042004 | Ga0439445_0001262 | Ga0439445_0001262_4811_5086 | 90 |
| 99 | 3300042004 | Ga0439445_0020326 | Ga0439445_0020326_304_576 | 90 |
| 100 | 3300042004 | Ga0439445_0028946 | Ga0439445_0028946_279_551 | 90 |
| 101 | 3300042005 | Ga0439448_0024162 | Ga0439448_0024162_914_1186 | 90 |
| 102 | 3300042006 | Ga0439432_001007 | Ga0439432_001007_4851_5123 | 90 |
| 103 | 3300042006 | Ga0439432_003123 | Ga0439432_003123_3164_3436 | 90 |
| 104 | 3300042010 | Ga0439452_028380 | Ga0439452_028380_226_498 | 90 |
| 105 | 3300042012 | Ga0439455_0000530 | Ga0439455_0000530_4342_4614 | 90 |
| 106 | 3300042014 | Ga0439457_010560 | Ga0439457_010560_1583_1855 | 90 |
| 107 | 3300042015 | Ga0439462_0001356 | Ga0439462_0001356_2419_2691 | 90 |
| 108 | 3300042015 | Ga0439462_0005516 | Ga0439462_0005516_2301_2573 | 90 |
| 109 | 3300042134 | Ga0450898_045443 | Ga0450898_045443_58_330 | 90 |
| 110 | 3300042156 | Ga0439446_0003091 | Ga0439446_0003091_771_1043 | 90 |
| 111 | 3300042435 | Ga0439434_0001645 | Ga0439434_0001645_5473_5745 | 90 |
| 112 | 3300042435 | Ga0439434_0003993 | Ga0439434_0003993_1557_1829 | 90 |
| 113 | 3300044658 | Ga0466972_0494928 | Ga0466972_0494928_129_401 | 90 |
| 114 | 3300044684 | Ga0466966_0030483 | Ga0466966_0030483_3177_3449 | 90 |
| 115 | 3300044693 | Ga0466961_0001163 | Ga0466961_0001163_10682_10954 | 90 |
| 116 | 3300044694 | Ga0466963_0901067 | Ga0466963_0901067_19_291 | 90 |
| 117 | 3300044694 | Ga0466963_0983525 | Ga0466963_0983525_177_452 | 90 |
| 118 | 3300044706 | Ga0466964_0034465 | Ga0466964_0034465_828_1100 | 90 |
| 119 | 3300044735 | Ga0466968_0115395 | Ga0466968_0115395_238_510 | 90 |
| 120 | 3300044765 | Ga0466970_0002019 | Ga0466970_0002019_3471_3743 | 90 |
| 121 | 3300044901 | Ga0466960_0054187 | Ga0466960_0054187_1514_1786 | 90 |
| 122 | 3300045049 | Ga0466959_0023694 | Ga0466959_0023694_3382_3654 | 90 |
| 123 | 3300045836 | Ga0466958_0052741 | Ga0466958_0052741_752_1027 | 90 |
| 124 | 3300045836 | Ga0466958_0161785 | Ga0466958_0161785_147_419 | 90 |
| 125 | 3300045836 | Ga0466958_0640145 | Ga0466958_0640145_337_609 | 90 |
| 126 | 3300045976 | Ga0466967_0501251 | Ga0466967_0501251_575_847 | 90 |
| 127 | 3300045976 | Ga0466967_0966490 | Ga0466967_0966490_228_500 | 90 |
| 128 | 3300046453 | Ga0495627_012033 | Ga0495627_012033_790_1062 | 90 |
| 129 | 3300046507 | Ga0495606_0002862 | Ga0495606_0002862_18057_18329 | 90 |
| 130 | 3300046691 | Ga0495670_0000037 | Ga0495670_0000037_48649_48921 | 90 |
| 131 | 3300047470 | Ga0495681_0033013 | Ga0495681_0033013_471_743 | 90 |
| 132 | 3300047470 | Ga0495681_0287806 | Ga0495681_0287806_278_550 | 90 |
| 133 | 3300048905 | Ga0496102_0840891 | Ga0496102_0840891_533_805 | 90 |
| 134 | 3300048918 | Ga0496115_0741624 | Ga0496115_0741624_12_284 | 90 |
| 135 | 3300048920 | Ga0496117_0014693 | Ga0496117_0014693_886_1158 | 90 |
| 136 | 3300048920 | Ga0496117_0419840 | Ga0496117_0419840_132_404 | 90 |
| 137 | 3300048921 | Ga0496118_0011963 | Ga0496118_0011963_3779_4051 | 90 |
| 138 | 3300048921 | Ga0496118_0173168 | Ga0496118_0173168_338_610 | 90 |
| 139 | 3300048924 | Ga0496121_0174328 | Ga0496121_0174328_978_1250 | 90 |
| 140 | 3300048925 | Ga0496122_0011314 | Ga0496122_0011314_360_632 | 90 |
| 141 | 3300048925 | Ga0496122_0066088 | Ga0496122_0066088_1945_2217 | 90 |
| 142 | 3300048926 | Ga0496123_0007037 | Ga0496123_0007037_2034_2306 | 90 |
| 143 | 3300048926 | Ga0496123_0025194 | Ga0496123_0025194_1706_1978 | 90 |
| 144 | 3300048926 | Ga0496123_0087132 | Ga0496123_0087132_1453_1731 | 90 |
| 145 | 3300048927 | Ga0496124_0001368 | Ga0496124_0001368_16874_17146 | 90 |
| 146 | 3300048927 | Ga0496124_0005887 | Ga0496124_0005887_7715_7987 | 90 |
| 147 | 3300048927 | Ga0496124_0059884 | Ga0496124_0059884_247_525 | 90 |
| 148 | 3300048927 | Ga0496124_0562992 | Ga0496124_0562992_181_453 | 90 |
| 149 | 3300048928 | Ga0496125_0264837 | Ga0496125_0264837_466_738 | 90 |
| 150 | 3300048928 | Ga0496125_0402128 | Ga0496125_0402128_363_635 | 90 |
| 151 | 3300048929 | Ga0496126_0323782 | Ga0496126_0323782_877_1149 | 90 |
| 152 | 3300049570 | Ga0501033_0386161 | Ga0501033_0386161_560_832 | 90 |
| 153 | 3300049571 | Ga0501034_0858927 | Ga0501034_0858927_196_468 | 90 |
| 154 | 3300049742 | Ga0501080_0568948 | Ga0501080_0568948_138_410 | 90 |
| 155 | 3300049822 | Ga0501035_0054257 | Ga0501035_0054257_2690_2962 | 90 |
| 156 | 3300053087 | Ga0500643_001018 | Ga0500643_001018_12357_12629 | 90 |
| 157 | 3300053087 | Ga0500643_004787 | Ga0500643_004787_5661_5939 | 90 |
| 158 | 3300053087 | Ga0500643_010613 | Ga0500643_010613_1103_1375 | 90 |
| 159 | 3300053087 | Ga0500643_109862 | Ga0500643_109862_352_624 | 90 |
| 160 | 3300053087 | Ga0500643_188816 | Ga0500643_188816_224_502 | 90 |
| 161 | 3300053094 | Ga0500566_0140795 | Ga0500566_0140795_146_424 | 90 |
| 162 | 3300053098 | Ga0500650_0363648 | Ga0500650_0363648_52_327 | 90 |
| 163 | 3300053133 | Ga0500655_062209 | Ga0500655_062209_93_365 | 90 |
| 164 | 3300053134 | Ga0500658_0001792 | Ga0500658_0001792_4116_4391 | 90 |
| 165 | 3300053134 | Ga0500658_0014110 | Ga0500658_0014110_1546_1818 | 90 |
| 166 | 3300053139 | Ga0500568_0038949 | Ga0500568_0038949_1386_1658 | 90 |
| 167 | 3300061719 | Ga0466962_0232672 | Ga0466962_0232672_408_683 | 90 |
| 168 | 3300025917 | Ga0207660_11642153 | Ga0207660_116421531 | 93 |
| 169 | 3300005333 | Ga0070677_10242088 | Ga0070677_102420882 | 94 |
| 170 | 3300013307 | Ga0157372_10204405 | Ga0157372_102044053 | 94 |
| 171 | 3300025893 | Ga0207682_10034549 | Ga0207682_100345492 | 94 |
| 172 | 3300031731 | Ga0307405_11828634 | Ga0307405_118286341 | 95 |
| 173 | 3300031824 | Ga0307413_10016736 | Ga0307413_100167363 | 95 |
| 174 | 3300031852 | Ga0307410_10019211 | Ga0307410_100192112 | 95 |
| 175 | 3300031903 | Ga0307407_10170114 | Ga0307407_101701143 | 95 |
| 176 | 3300031995 | Ga0307409_100007226 | Ga0307409_1000072263 | 95 |
| 177 | 3300032004 | Ga0307414_10045706 | Ga0307414_100457062 | 95 |
| 178 | 3300032005 | Ga0307411_10102698 | Ga0307411_101026983 | 95 |
| 179 | 3300032126 | Ga0307415_100729408 | Ga0307415_1007294081 | 95 |
| 180 | iso_pu_bacteria | 2818991466 | 2819713786 | 96 |
| 181 | iso_pu_bacteria | 2928526807 | 2928527437 | 96 |
| 182 | iso_pu_bacteria | 2928526807 | 2928528244 | 96 |
| 183 | iso_pu_bacteria | 2946787523 | 2946791455 | 96 |
| 184 | 3300003187 | JGI25151J46595_10091510 | JGI25151J46595_100915102 | 98 |
| 185 | 3300003215 | JGI25153J46596_10000231 | JGI25153J46596_1000023120 | 98 |
| 186 | 3300003781 | Ga0055536_1010731 | Ga0055536_10107313 | 98 |
| 187 | 3300003792 | Ga0055540_1001746 | Ga0055540_100174610 | 98 |
| 188 | 3300025245 | Ga0207425_1000088 | Ga0207425_100008814 | 98 |
| 189 | 3300025258 | Ga0209129_1003978 | Ga0209129_10039786 | 98 |
| 190 | 3300025263 | Ga0209565_1013173 | Ga0209565_10131733 | 98 |
| 191 | 3300025292 | Ga0209676_1016315 | Ga0209676_10163152 | 98 |
| 192 | 3300025294 | Ga0209025_1001369 | Ga0209025_100136914 | 98 |
| 193 | 3300025297 | Ga0209758_1000009 | Ga0209758_1000009552 | 98 |
| 194 | 3300025298 | Ga0209050_1000005 | Ga0209050_1000005618 | 98 |
| 195 | 3300025303 | Ga0209051_1000727 | Ga0209051_100072722 | 98 |
| 196 | 3300025304 | Ga0209257_1003939 | Ga0209257_10039397 | 98 |
| 197 | 3300025304 | Ga0209257_1004514 | Ga0209257_10045146 | 98 |
| 198 | 3300048905 | Ga0496102_0418265 | Ga0496102_0418265_369_665 | 98 |
| 199 | 3300005327 | Ga0070658_10003160 | Ga0070658_100031607 | 99 |
| 200 | 3300005366 | Ga0070659_100784187 | Ga0070659_1007841872 | 99 |
| 201 | 3300013104 | Ga0157370_10423627 | Ga0157370_104236272 | 99 |
| 202 | 3300013105 | Ga0157369_11427938 | Ga0157369_114279381 | 99 |
| 203 | 3300013308 | Ga0157375_13339979 | Ga0157375_133399792 | 99 |
| 204 | 3300025233 | Ga0209437_122103 | Ga0209437_1221031 | 99 |
| 205 | 3300025253 | Ga0209677_106522 | Ga0209677_1065224 | 99 |
| 206 | 3300025909 | Ga0207705_10091578 | Ga0207705_100915783 | 99 |
| 207 | 3300025919 | Ga0207657_10001208 | Ga0207657_1000120825 | 99 |
| 208 | 3300025960 | Ga0207651_10603492 | Ga0207651_106034922 | 99 |
| 209 | 3300046616 | Ga0495668_0456933 | Ga0495668_0456933_306_614 | 99 |
| 210 | 3300046660 | Ga0495625_0109130 | Ga0495625_0109130_507_815 | 99 |
| 211 | 3300001904 | JGI24736J21556_1009892 | JGI24736J21556_10098922 | 100 |
| 212 | 3300001904 | JGI24736J21556_1079632 | JGI24736J21556_10796321 | 100 |
| 213 | 3300001979 | JGI24740J21852_10064426 | JGI24740J21852_100644262 | 100 |
| 214 | 3300001989 | JGI24739J22299_10000613 | JGI24739J22299_100006137 | 100 |
| 215 | 3300001989 | JGI24739J22299_10019069 | JGI24739J22299_100190693 | 100 |
| 216 | 3300001989 | JGI24739J22299_10019365 | JGI24739J22299_100193654 | 100 |
| 217 | 3300001989 | JGI24739J22299_10255130 | JGI24739J22299_102551302 | 100 |
| 218 | 3300001990 | JGI24737J22298_10000132 | JGI24737J22298_100001326 | 100 |
| 219 | 3300001990 | JGI24737J22298_10019340 | JGI24737J22298_100193402 | 100 |
| 220 | 3300001990 | JGI24737J22298_10021304 | JGI24737J22298_100213043 | 100 |
| 221 | 3300001990 | JGI24737J22298_10047246 | JGI24737J22298_100472462 | 100 |
| 222 | 3300001991 | JGI24743J22301_10023050 | JGI24743J22301_100230502 | 100 |
| 223 | 3300002067 | JGI24735J21928_10000391 | JGI24735J21928_1000039113 | 100 |
| 224 | 3300002067 | JGI24735J21928_10001784 | JGI24735J21928_100017843 | 100 |
| 225 | 3300002067 | JGI24735J21928_10009812 | JGI24735J21928_100098123 | 100 |
| 226 | 3300002067 | JGI24735J21928_10014956 | JGI24735J21928_100149564 | 100 |
| 227 | 3300002067 | JGI24735J21928_10053430 | JGI24735J21928_100534302 | 100 |
| 228 | 3300002067 | JGI24735J21928_10074498 | JGI24735J21928_100744982 | 100 |
| 229 | 3300002075 | JGI24738J21930_10000280 | JGI24738J21930_100002806 | 100 |
| 230 | 3300002075 | JGI24738J21930_10002675 | JGI24738J21930_100026754 | 100 |
| 231 | 3300002077 | JGI24744J21845_10008009 | JGI24744J21845_100080093 | 100 |
| 232 | 3300002774 | JGI25150J39212_1024134 | JGI25150J39212_10241341 | 100 |
| 233 | 3300003214 | JGI25165J46597_1000173 | JGI25165J46597_10001739 | 100 |
| 234 | 3300003316 | rootH1_10000365 | rootH1_100003652 | 100 |
| 235 | 3300003322 | rootL2_10136660 | rootL2_101366601 | 100 |
| 236 | 3300003322 | rootL2_10189986 | rootL2_101899863 | 100 |
| 237 | 3300003775 | Ga0055524_1000118 | Ga0055524_1000118102 | 100 |
| 238 | 3300003790 | Ga0055528_1034854 | Ga0055528_10348543 | 100 |
| 239 | 3300003791 | Ga0055530_10000074 | Ga0055530_1000007446 | 100 |
| 240 | 3300003794 | Ga0055531_10001454 | Ga0055531_100014543 | 100 |
| 241 | 3300003794 | Ga0055531_10001624 | Ga0055531_100016249 | 100 |
| 242 | 3300004625 | Ga0055543_1018388 | Ga0055543_10183882 | 100 |
| 243 | 3300005262 | Ga0065165_1004490 | Ga0065165_10044908 | 100 |
| 244 | 3300005327 | Ga0070658_10026308 | Ga0070658_100263087 | 100 |
| 245 | 3300005327 | Ga0070658_10201127 | Ga0070658_102011272 | 100 |
| 246 | 3300005327 | Ga0070658_11497691 | Ga0070658_114976912 | 100 |
| 247 | 3300005331 | Ga0070670_100104754 | Ga0070670_1001047543 | 100 |
| 248 | 3300005339 | Ga0070660_100008989 | Ga0070660_1000089893 | 100 |
| 249 | 3300005339 | Ga0070660_100025697 | Ga0070660_1000256972 | 100 |
| 250 | 3300005339 | Ga0070660_100571541 | Ga0070660_1005715411 | 100 |
| 251 | 3300005344 | Ga0070661_100000189 | Ga0070661_10000018951 | 100 |
| 252 | 3300005344 | Ga0070661_101163218 | Ga0070661_1011632182 | 100 |
| 253 | 3300005347 | Ga0070668_102071054 | Ga0070668_1020710541 | 100 |
| 254 | 3300005353 | Ga0070669_100298042 | Ga0070669_1002980422 | 100 |
| 255 | 3300005354 | Ga0070675_100010770 | Ga0070675_1000107704 | 100 |
| 256 | 3300005354 | Ga0070675_100990794 | Ga0070675_1009907942 | 100 |
| 257 | 3300005355 | Ga0070671_100048789 | Ga0070671_1000487894 | 100 |
| 258 | 3300005356 | Ga0070674_101516180 | Ga0070674_1015161802 | 100 |
| 259 | 3300005364 | Ga0070673_101100561 | Ga0070673_1011005612 | 100 |
| 260 | 3300005364 | Ga0070673_102315462 | Ga0070673_1023154622 | 100 |
| 261 | 3300005366 | Ga0070659_100151038 | Ga0070659_1001510384 | 100 |
| 262 | 3300005366 | Ga0070659_100274712 | Ga0070659_1002747122 | 100 |
| 263 | 3300005366 | Ga0070659_100307128 | Ga0070659_1003071282 | 100 |
| 264 | 3300005366 | Ga0070659_100323797 | Ga0070659_1003237972 | 100 |
| 265 | 3300005366 | Ga0070659_100370906 | Ga0070659_1003709062 | 100 |
| 266 | 3300005455 | Ga0070663_100001458 | Ga0070663_1000014588 | 100 |
| 267 | 3300005456 | Ga0070678_100005285 | Ga0070678_1000052858 | 100 |
| 268 | 3300005457 | Ga0070662_100028503 | Ga0070662_1000285033 | 100 |
| 269 | 3300005457 | Ga0070662_100151535 | Ga0070662_1001515352 | 100 |
| 270 | 3300005457 | Ga0070662_100455749 | Ga0070662_1004557493 | 100 |
| 271 | 3300005457 | Ga0070662_100558159 | Ga0070662_1005581592 | 100 |
| 272 | 3300005458 | Ga0070681_10012761 | Ga0070681_100127616 | 100 |
| 273 | 3300005530 | Ga0070679_100000019 | Ga0070679_10000001977 | 100 |
| 274 | 3300005530 | Ga0070679_100380610 | Ga0070679_1003806102 | 100 |
| 275 | 3300005539 | Ga0068853_100006801 | Ga0068853_1000068014 | 100 |
| 276 | 3300005539 | Ga0068853_101341364 | Ga0068853_1013413641 | 100 |
| 277 | 3300005543 | Ga0070672_100199065 | Ga0070672_1001990653 | 100 |
| 278 | 3300005547 | Ga0070693_100527914 | Ga0070693_1005279142 | 100 |
| 279 | 3300005548 | Ga0070665_100000564 | Ga0070665_10000056446 | 100 |
| 280 | 3300005548 | Ga0070665_101857790 | Ga0070665_1018577901 | 100 |
| 281 | 3300005563 | Ga0068855_100000007 | Ga0068855_10000000780 | 100 |
| 282 | 3300005563 | Ga0068855_100031458 | Ga0068855_1000314582 | 100 |
| 283 | 3300005563 | Ga0068855_101554324 | Ga0068855_1015543241 | 100 |
| 284 | 3300005564 | Ga0070664_100319288 | Ga0070664_1003192883 | 100 |
| 285 | 3300005577 | Ga0068857_100150492 | Ga0068857_1001504923 | 100 |
| 286 | 3300005578 | Ga0068854_100000263 | Ga0068854_1000002635 | 100 |
| 287 | 3300005578 | Ga0068854_100035323 | Ga0068854_1000353232 | 100 |
| 288 | 3300005578 | Ga0068854_100250188 | Ga0068854_1002501883 | 100 |
| 289 | 3300005578 | Ga0068854_101931083 | Ga0068854_1019310831 | 100 |
| 290 | 3300005614 | Ga0068856_100343936 | Ga0068856_1003439361 | 100 |
| 291 | 3300005614 | Ga0068856_100362726 | Ga0068856_1003627263 | 100 |
| 292 | 3300005614 | Ga0068856_100753968 | Ga0068856_1007539682 | 100 |
| 293 | 3300005616 | Ga0068852_100002646 | Ga0068852_10000264611 | 100 |
| 294 | 3300005616 | Ga0068852_100345616 | Ga0068852_1003456162 | 100 |
| 295 | 3300005616 | Ga0068852_100468277 | Ga0068852_1004682772 | 100 |
| 296 | 3300005616 | Ga0068852_102442119 | Ga0068852_1024421192 | 100 |
| 297 | 3300005617 | Ga0068859_100031328 | Ga0068859_1000313283 | 100 |
| 298 | 3300005834 | Ga0068851_10064832 | Ga0068851_100648323 | 100 |
| 299 | 3300005843 | Ga0068860_100012470 | Ga0068860_1000124702 | 100 |
| 300 | 3300005844 | Ga0068862_101128051 | Ga0068862_1011280512 | 100 |
| 301 | 3300005985 | Ga0081539_10020671 | Ga0081539_100206712 | 100 |
| 302 | 3300006237 | Ga0097621_100017199 | Ga0097621_1000171994 | 100 |
| 303 | 3300006353 | Ga0075370_10312673 | Ga0075370_103126732 | 100 |
| 304 | 3300006358 | Ga0068871_100049146 | Ga0068871_1000491464 | 100 |
| 305 | 3300009093 | Ga0105240_10987838 | Ga0105240_109878382 | 100 |
| 306 | 3300009174 | Ga0105241_10046419 | Ga0105241_100464192 | 100 |
| 307 | 3300009545 | Ga0105237_10426153 | Ga0105237_104261533 | 100 |
| 308 | 3300009545 | Ga0105237_10735971 | Ga0105237_107359711 | 100 |
| 309 | 3300009551 | Ga0105238_10282194 | Ga0105238_102821943 | 100 |
| 310 | 3300010375 | Ga0105239_10032266 | Ga0105239_100322665 | 100 |
| 311 | 3300010375 | Ga0105239_13000822 | Ga0105239_130008222 | 100 |
| 312 | 3300010375 | Ga0105239_13091563 | Ga0105239_130915631 | 100 |
| 313 | 3300013100 | Ga0157373_10101379 | Ga0157373_101013792 | 100 |
| 314 | 3300013100 | Ga0157373_10451556 | Ga0157373_104515561 | 100 |
| 315 | 3300013102 | Ga0157371_10343177 | Ga0157371_103431772 | 100 |
| 316 | 3300013102 | Ga0157371_10675467 | Ga0157371_106754672 | 100 |
| 317 | 3300013105 | Ga0157369_10001136 | Ga0157369_1000113631 | 100 |
| 318 | 3300013105 | Ga0157369_10324607 | Ga0157369_103246072 | 100 |
| 319 | 3300013105 | Ga0157369_10638402 | Ga0157369_106384022 | 100 |
| 320 | 3300013105 | Ga0157369_11448113 | Ga0157369_114481131 | 100 |
| 321 | 3300013296 | Ga0157374_10014640 | Ga0157374_100146404 | 100 |
| 322 | 3300013307 | Ga0157372_10160072 | Ga0157372_101600723 | 100 |
| 323 | 3300013307 | Ga0157372_10493955 | Ga0157372_104939552 | 100 |
| 324 | 3300017792 | Ga0163161_10067589 | Ga0163161_100675895 | 100 |
| 325 | 3300025230 | Ga0209563_100125 | Ga0209563_10012558 | 100 |
| 326 | 3300025231 | Ga0207427_100701 | Ga0207427_1007014 | 100 |
| 327 | 3300025250 | Ga0209026_1003219 | Ga0209026_10032194 | 100 |
| 328 | 3300025254 | Ga0209148_1003190 | Ga0209148_10031903 | 100 |
| 329 | 3300025261 | Ga0209233_1000003 | Ga0209233_10000031196 | 100 |
| 330 | 3300025272 | Ga0209455_1000423 | Ga0209455_100042319 | 100 |
| 331 | 3300025304 | Ga0209257_1003342 | Ga0209257_10033422 | 100 |
| 332 | 3300025304 | Ga0209257_1099808 | Ga0209257_10998082 | 100 |
| 333 | 3300025321 | Ga0207656_10235944 | Ga0207656_102359442 | 100 |
| 334 | 3300025901 | Ga0207688_10019118 | Ga0207688_100191183 | 100 |
| 335 | 3300025904 | Ga0207647_10001674 | Ga0207647_1000167412 | 100 |
| 336 | 3300025904 | Ga0207647_10011674 | Ga0207647_100116746 | 100 |
| 337 | 3300025904 | Ga0207647_10016218 | Ga0207647_100162185 | 100 |
| 338 | 3300025904 | Ga0207647_10033758 | Ga0207647_100337584 | 100 |
| 339 | 3300025904 | Ga0207647_10043810 | Ga0207647_100438103 | 100 |
| 340 | 3300025904 | Ga0207647_10515910 | Ga0207647_105159101 | 100 |
| 341 | 3300025909 | Ga0207705_10030679 | Ga0207705_100306792 | 100 |
| 342 | 3300025909 | Ga0207705_11190414 | Ga0207705_111904142 | 100 |
| 343 | 3300025911 | Ga0207654_10164360 | Ga0207654_101643602 | 100 |
| 344 | 3300025912 | Ga0207707_10024148 | Ga0207707_100241485 | 100 |
| 345 | 3300025913 | Ga0207695_10017354 | Ga0207695_100173547 | 100 |
| 346 | 3300025914 | Ga0207671_10034401 | Ga0207671_100344017 | 100 |
| 347 | 3300025914 | Ga0207671_10476785 | Ga0207671_104767851 | 100 |
| 348 | 3300025917 | Ga0207660_10000452 | Ga0207660_1000045213 | 100 |
| 349 | 3300025919 | Ga0207657_10020998 | Ga0207657_100209983 | 100 |
| 350 | 3300025919 | Ga0207657_10033235 | Ga0207657_100332358 | 100 |
| 351 | 3300025919 | Ga0207657_10373851 | Ga0207657_103738512 | 100 |
| 352 | 3300025920 | Ga0207649_10000055 | Ga0207649_1000005551 | 100 |
| 353 | 3300025920 | Ga0207649_11411535 | Ga0207649_114115352 | 100 |
| 354 | 3300025921 | Ga0207652_10000004 | Ga0207652_10000004332 | 100 |
| 355 | 3300025923 | Ga0207681_10386678 | Ga0207681_103866782 | 100 |
| 356 | 3300025923 | Ga0207681_10673706 | Ga0207681_106737061 | 100 |
| 357 | 3300025923 | Ga0207681_11379228 | Ga0207681_113792281 | 100 |
| 358 | 3300025924 | Ga0207694_10217435 | Ga0207694_102174351 | 100 |
| 359 | 3300025926 | Ga0207659_10063052 | Ga0207659_100630523 | 100 |
| 360 | 3300025931 | Ga0207644_10009173 | Ga0207644_100091734 | 100 |
| 361 | 3300025932 | Ga0207690_10105979 | Ga0207690_101059792 | 100 |
| 362 | 3300025932 | Ga0207690_10267577 | Ga0207690_102675772 | 100 |
| 363 | 3300025932 | Ga0207690_10284058 | Ga0207690_102840583 | 100 |
| 364 | 3300025932 | Ga0207690_10658619 | Ga0207690_106586192 | 100 |
| 365 | 3300025933 | Ga0207706_10006577 | Ga0207706_100065773 | 100 |
| 366 | 3300025933 | Ga0207706_10058745 | Ga0207706_100587452 | 100 |
| 367 | 3300025933 | Ga0207706_10407405 | Ga0207706_104074051 | 100 |
| 368 | 3300025933 | Ga0207706_10552403 | Ga0207706_105524032 | 100 |
| 369 | 3300025935 | Ga0207709_10169775 | Ga0207709_101697751 | 100 |
| 370 | 3300025937 | Ga0207669_11223404 | Ga0207669_112234042 | 100 |
| 371 | 3300025937 | Ga0207669_11702846 | Ga0207669_117028461 | 100 |
| 372 | 3300025940 | Ga0207691_10177291 | Ga0207691_101772912 | 100 |
| 373 | 3300025940 | Ga0207691_10340432 | Ga0207691_103404322 | 100 |
| 374 | 3300025945 | Ga0207679_10686331 | Ga0207679_106863312 | 100 |
| 375 | 3300025949 | Ga0207667_10000038 | Ga0207667_1000003878 | 100 |
| 376 | 3300025949 | Ga0207667_12129811 | Ga0207667_121298111 | 100 |
| 377 | 3300025960 | Ga0207651_11995512 | Ga0207651_119955121 | 100 |
| 378 | 3300025981 | Ga0207640_10001332 | Ga0207640_1000133210 | 100 |
| 379 | 3300025981 | Ga0207640_10026503 | Ga0207640_100265032 | 100 |
| 380 | 3300025981 | Ga0207640_10210994 | Ga0207640_102109942 | 100 |
| 381 | 3300026023 | Ga0207677_11733089 | Ga0207677_117330891 | 100 |
| 382 | 3300026041 | Ga0207639_10003636 | Ga0207639_100036366 | 100 |
| 383 | 3300026041 | Ga0207639_10077304 | Ga0207639_100773044 | 100 |
| 384 | 3300026041 | Ga0207639_11751469 | Ga0207639_117514692 | 100 |
| 385 | 3300026067 | Ga0207678_10004209 | Ga0207678_100042097 | 100 |
| 386 | 3300026067 | Ga0207678_11458861 | Ga0207678_114588612 | 100 |
| 387 | 3300026078 | Ga0207702_10056450 | Ga0207702_100564501 | 100 |
| 388 | 3300026078 | Ga0207702_10132077 | Ga0207702_101320774 | 100 |
| 389 | 3300026088 | Ga0207641_10353318 | Ga0207641_103533183 | 100 |
| 390 | 3300026116 | Ga0207674_10049898 | Ga0207674_100498983 | 100 |
| 391 | 3300026121 | Ga0207683_10019962 | Ga0207683_100199624 | 100 |
| 392 | 3300026142 | Ga0207698_10000404 | Ga0207698_100004045 | 100 |
| 393 | 3300026142 | Ga0207698_10301865 | Ga0207698_103018652 | 100 |
| 394 | 3300026142 | Ga0207698_11569733 | Ga0207698_115697331 | 100 |
| 395 | 3300028379 | Ga0268266_10003466 | Ga0268266_100034667 | 100 |
| 396 | 3300028380 | Ga0268265_10838407 | Ga0268265_108384072 | 100 |
| 397 | 3300028381 | Ga0268264_10197719 | Ga0268264_101977192 | 100 |
| 398 | 3300032004 | Ga0307414_10330451 | Ga0307414_103304512 | 100 |
| 399 | 3300032004 | Ga0307414_11687693 | Ga0307414_116876931 | 100 |
| 400 | 3300032005 | Ga0307411_12000740 | Ga0307411_120007402 | 100 |
| 401 | 3300037312 | Ga0395899_0058868 | Ga0395899_0058868_1405_1707 | 100 |
| 402 | 3300037418 | Ga0395900_0093484 | Ga0395900_0093484_2512_2820 | 100 |
| 403 | 3300037418 | Ga0395900_1475869 | Ga0395900_1475869_230_532 | 100 |
| 404 | 3300037466 | Ga0395898_1165622 | Ga0395898_1165622_112_414 | 100 |
| 405 | 3300037471 | Ga0395905_0036479 | Ga0395905_0036479_2094_2396 | 100 |
| 406 | 3300037471 | Ga0395905_0103885 | Ga0395905_0103885_2125_2433 | 100 |
| 407 | 3300037471 | Ga0395905_0409354 | Ga0395905_0409354_316_621 | 100 |
| 408 | 3300037853 | Ga0436364_0184680 | Ga0436364_0184680_260_574 | 100 |
| 409 | 3300038443 | Ga0395901_0163929 | Ga0395901_0163929_1487_1795 | 100 |
| 410 | 3300041404 | Ga0439436_0053221 | Ga0439436_0053221_358_675 | 100 |
| 411 | 3300041406 | Ga0439439_0040773 | Ga0439439_0040773_875_1177 | 100 |
| 412 | 3300041410 | Ga0439461_0009372 | Ga0439461_0009372_589_906 | 100 |
| 413 | 3300041411 | Ga0439466_0060653 | Ga0439466_0060653_305_622 | 100 |
| 414 | 3300041411 | Ga0439466_0125618 | Ga0439466_0125618_368_670 | 100 |
| 415 | 3300041413 | Ga0439465_0006192 | Ga0439465_0006192_3051_3368 | 100 |
| 416 | 3300041413 | Ga0439465_0006371 | Ga0439465_0006371_2674_2991 | 100 |
| 417 | 3300041443 | Ga0451789_0553014 | Ga0451789_0553014_232_534 | 100 |
| 418 | 3300041456 | Ga0451795_1411884 | Ga0451795_1411884_12_314 | 100 |
| 419 | 3300041491 | Ga0451833_0807197 | Ga0451833_0807197_125_436 | 100 |
| 420 | 3300041997 | Ga0439431_0000427 | Ga0439431_0000427_7672_7989 | 100 |
| 421 | 3300041997 | Ga0439431_0020289 | Ga0439431_0020289_862_1179 | 100 |
| 422 | 3300041997 | Ga0439431_0108406 | Ga0439431_0108406_118_420 | 100 |
| 423 | 3300042002 | Ga0439442_009923 | Ga0439442_009923_1369_1686 | 100 |
| 424 | 3300042004 | Ga0439445_0002858 | Ga0439445_0002858_436_753 | 100 |
| 425 | 3300042004 | Ga0439445_0015374 | Ga0439445_0015374_943_1260 | 100 |
| 426 | 3300042004 | Ga0439445_0024172 | Ga0439445_0024172_1070_1387 | 100 |
| 427 | 3300042004 | Ga0439445_0026300 | Ga0439445_0026300_179_481 | 100 |
| 428 | 3300042005 | Ga0439448_0001347 | Ga0439448_0001347_3995_4297 | 100 |
| 429 | 3300042005 | Ga0439448_0022082 | Ga0439448_0022082_1023_1325 | 100 |
| 430 | 3300042005 | Ga0439448_0029731 | Ga0439448_0029731_1261_1563 | 100 |
| 431 | 3300042006 | Ga0439432_015958 | Ga0439432_015958_1174_1491 | 100 |
| 432 | 3300042007 | Ga0439449_0305722 | Ga0439449_0305722_241_558 | 100 |
| 433 | 3300042008 | Ga0439450_078111 | Ga0439450_078111_85_387 | 100 |
| 434 | 3300042010 | Ga0439452_013772 | Ga0439452_013772_210_527 | 100 |
| 435 | 3300042012 | Ga0439455_0001694 | Ga0439455_0001694_579_881 | 100 |
| 436 | 3300042012 | Ga0439455_0003084 | Ga0439455_0003084_1017_1319 | 100 |
| 437 | 3300042012 | Ga0439455_0004893 | Ga0439455_0004893_1985_2287 | 100 |
| 438 | 3300042012 | Ga0439455_0017039 | Ga0439455_0017039_1034_1336 | 100 |
| 439 | 3300042015 | Ga0439462_0059858 | Ga0439462_0059858_483_800 | 100 |
| 440 | 3300042015 | Ga0439462_0158330 | Ga0439462_0158330_24_341 | 100 |
| 441 | 3300042157 | Ga0439458_0000212 | Ga0439458_0000212_8091_8393 | 100 |
| 442 | 3300042157 | Ga0439458_0000552 | Ga0439458_0000552_7550_7852 | 100 |
| 443 | 3300042157 | Ga0439458_0000641 | Ga0439458_0000641_1771_2079 | 100 |
| 444 | 3300042435 | Ga0439434_0022902 | Ga0439434_0022902_411_728 | 100 |
| 445 | 3300042435 | Ga0439434_0024727 | Ga0439434_0024727_350_667 | 100 |
| 446 | 3300042435 | Ga0439434_0108064 | Ga0439434_0108064_163_480 | 100 |
| 447 | 3300044694 | Ga0466963_0104570 | Ga0466963_0104570_1396_1701 | 100 |
| 448 | 3300045976 | Ga0466967_0096341 | Ga0466967_0096341_940_1242 | 100 |
| 449 | 3300046471 | Ga0495650_0237181 | Ga0495650_0237181_30_341 | 100 |
| 450 | 3300046507 | Ga0495606_0128361 | Ga0495606_0128361_82_384 | 100 |
| 451 | 3300046528 | Ga0495642_0009737 | Ga0495642_0009737_403_705 | 100 |
| 452 | 3300046694 | Ga0495649_0285280 | Ga0495649_0285280_101_403 | 100 |
| 453 | 3300046810 | Ga0495660_0472722 | Ga0495660_0472722_107_409 | 100 |
| 454 | 3300047443 | Ga0495687_111976 | Ga0495687_111976_423_725 | 100 |
| 455 | 3300047469 | Ga0495673_0029088 | Ga0495673_0029088_374_691 | 100 |
| 456 | 3300047472 | Ga0495686_0001276 | Ga0495686_0001276_11058_11360 | 100 |
| 457 | 3300048923 | Ga0496120_0024742 | Ga0496120_0024742_579_881 | 100 |
| 458 | 3300048924 | Ga0496121_0024764 | Ga0496121_0024764_3890_4192 | 100 |
| 459 | 3300048926 | Ga0496123_0202751 | Ga0496123_0202751_22_339 | 100 |
| 460 | 3300048928 | Ga0496125_0309512 | Ga0496125_0309512_213_530 | 100 |
| 461 | 3300049671 | Ga0501238_077597 | Ga0501238_077597_58_363 | 100 |
| 462 | 3300049742 | Ga0501080_1019217 | Ga0501080_1019217_303_605 | 100 |
| 463 | 3300049758 | Ga0501241_004217 | Ga0501241_004217_741_1043 | 100 |
| 464 | 3300049773 | Ga0501276_015292 | Ga0501276_015292_278_580 | 100 |
| 465 | 3300050496 | nmdc:mga07m45_118528_c1 | nmdc:mga07m45_118528_c1_473_775 | 100 |
| 466 | 3300053739 | Ga0500587_001316 | Ga0500587_001316_2112_2423 | 100 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kym-assembly1.cif.gz_B-2 | crystal structure of the marr family transcriptional regulator from bradyrhizobium japonicum | 0.916 | 12 | 84 |
| 5f7p-assembly1.cif.gz_A | rok repressor lmo0178 from listeria monocytogenes | 0.9063 | 13 | 56 |
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.8918 | 12 | 76 |
| 5aiq-assembly2.cif.gz_B | crystal structure of ligand-free nadr | 0.8908 | 8 | 89 |
| 3f22-assembly2.cif.gz_C | crystal structure of zalpha in complex with d(cgtacg) | 0.8859 | 10 | 75 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3bp8A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8919 | 13 | 56 | 1.10.10.10 |
| 4lb5A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8918 | 12 | 76 | 1.10.10.10 |
| af_Q58088_26_109_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8915 | 9 | 84 | 1.10.10.10 |
| 5aipB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.882 | 8 | 89 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8787 | 7 | 74 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520JQY9-F1-model_v4 | PadR family transcriptional regulator | 0.945 | 11 | 90 |
|
| AF-A0A4P6FHT0-F1-model_v4 | PadR family transcriptional regulator | 0.9448 | 11 | 90 |
|
| AF-A0A534P2N4-F1-model_v4 | PadR family transcriptional regulator | 0.9316 | 1 | 90 |
|
| AF-A0A175XZQ0-F1-model_v4 | Transcriptional regulator | 0.9246 | 11 | 90 |
|
| AF-A0A523F374-F1-model_v4 | deleted | 0.9192 | 5 | 90 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar