F449614

General Info

Members Datasets Scaffolds Average Seq Length
466 234 460 97

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_102071054|Ga0070668_1020710541
Length 103
Sequence MVRSRTLSAPARKALAIMAGASARWWHGYELCQQAGIKSGTLYPLLMRLAAQRYLEAEWQPPEEPGRPARHAYRLTAAGRQLAHENPPARAGERXXXPEERLA

Samples

Sample ID Description Type Environment
1 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
2 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
3 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
4 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
88 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
89 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
90 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
158 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
159 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
160 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
161 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
162 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
163 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
164 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
165 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
166 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
167 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
168 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
169 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
170 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
171 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
172 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
173 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
174 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
175 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
176 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
177 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
178 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
179 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
180 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
181 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
197 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
198 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
201 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
202 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
203 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
204 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
205 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
206 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
224 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
228 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
229 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
230 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
231 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
232 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
233 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 0
Isolates 1.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.52
Nodule 0
Rhizoplane 1.29
Rhizosphere 77.68
Stem 0
Stem Tuber 0
Unclassified 7.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1009892 3300001904 Bacteria 1565
2 JGI24736J21556_1079632 3300001904 Bacteria 514
3 JGI24740J21852_10064426 3300001979 Bacteria 1000
4 JGI24740J21852_10099809 3300001979 Bacteria 740
5 JGI24739J22299_10000613 3300001989 Bacteria 12785
6 JGI24739J22299_10019069 3300001989 Bacteria 2459
7 JGI24739J22299_10019365 3300001989 Bacteria 2436
8 JGI24739J22299_10255130 3300001989 Bacteria 514
9 JGI24737J22298_10000132 3300001990 Bacteria 22883
10 JGI24737J22298_10019340 3300001990 Bacteria 2178
11 JGI24737J22298_10021304 3300001990 Bacteria 2067
12 JGI24737J22298_10047246 3300001990 Unclassified 1312
13 JGI24743J22301_10023050 3300001991 Unclassified 1197
14 JGI24735J21928_10000391 3300002067 Bacteria 15267
15 JGI24735J21928_10001784 3300002067 Bacteria 7557
16 JGI24735J21928_10009812 3300002067 Bacteria 3066
17 JGI24735J21928_10013733 3300002067 Bacteria 2541
18 JGI24735J21928_10014956 3300002067 Bacteria 2425
19 JGI24735J21928_10053430 3300002067 Bacteria 1165
20 JGI24735J21928_10074498 3300002067 Bacteria 972
21 JGI24738J21930_10000280 3300002075 Bacteria 13977
22 JGI24738J21930_10002675 3300002075 Bacteria 4591
23 JGI24744J21845_10008009 3300002077 Bacteria 2182
24 JGI25150J39212_1024134 3300002774 Bacteria 896
25 JGI25151J46595_10091510 3300003187 Bacteria 845
26 JGI25165J46597_1000173 3300003214 Bacteria 100834
27 JGI25153J46596_10000231 3300003215 Bacteria 47177
28 rootH1_10000365 3300003316 Bacteria 8254
29 rootH1_10173631 3300003316 Bacteria 1320
30 rootH2_10171796 3300003320 Bacteria 1447
31 rootL2_10136660 3300003322 Bacteria 1251
32 rootL2_10189986 3300003322 Bacteria 2304
33 Ga0055525_1000086 3300003759 Bacteria 150228
34 Ga0055542_1000041 3300003762 Bacteria 208892
35 Ga0055542_1005909 3300003762 Bacteria 2684
36 Ga0055529_1000040 3300003763 Bacteria 230562
37 Ga0055524_1000118 3300003775 Bacteria 93202
38 Ga0055536_1006364 3300003781 Bacteria 5539
39 Ga0055536_1010731 3300003781 Bacteria 3595
40 Ga0055528_1034854 3300003790 Bacteria 1232
41 Ga0055530_10000074 3300003791 Bacteria 85116
42 Ga0055540_1001746 3300003792 Bacteria 12453
43 Ga0055531_10001454 3300003794 Bacteria 17456
44 Ga0055531_10001624 3300003794 Bacteria 16296
45 Ga0055543_1018388 3300004625 Bacteria 1304
46 Ga0065165_1004490 3300005262 Bacteria 8586
47 Ga0070658_10003160 3300005327 Bacteria 13594
48 Ga0070658_10026308 3300005327 Bacteria 4667
49 Ga0070658_10201127 3300005327 Bacteria 1681
50 Ga0070658_11497691 3300005327 Bacteria 585
51 Ga0070670_100104754 3300005331 Bacteria 2437
52 Ga0070677_10242088 3300005333 Bacteria 891
53 Ga0070660_100001071 3300005339 Bacteria 18386
54 Ga0070660_100008989 3300005339 Bacteria 7009
55 Ga0070660_100025697 3300005339 Bacteria 4379
56 Ga0070660_100571541 3300005339 Bacteria 944
57 Ga0070660_100704082 3300005339 Bacteria 847
58 Ga0070661_100000189 3300005344 Bacteria 51018
59 Ga0070661_101163218 3300005344 Unclassified 644
60 Ga0070668_102071054 3300005347 Unclassified 525
61 Ga0070669_100088096 3300005353 Bacteria 2323
62 Ga0070669_100298042 3300005353 Bacteria 1296
63 Ga0070675_100010770 3300005354 Bacteria 7153
64 Ga0070675_100990794 3300005354 Bacteria 771
65 Ga0070675_101253981 3300005354 Bacteria 683
66 Ga0070671_100027923 3300005355 Bacteria 4646
67 Ga0070671_100048789 3300005355 Bacteria 3522
68 Ga0070674_101048865 3300005356 Bacteria 718
69 Ga0070674_101516180 3300005356 Unclassified 603
70 Ga0070673_101100561 3300005364 Bacteria 742
71 Ga0070673_102315462 3300005364 Bacteria 511
72 Ga0070659_100151038 3300005366 Bacteria 1895
73 Ga0070659_100274712 3300005366 Bacteria 1401
74 Ga0070659_100307128 3300005366 Unclassified 1324
75 Ga0070659_100323797 3300005366 Bacteria 1289
76 Ga0070659_100370906 3300005366 Bacteria 1204
77 Ga0070659_100784187 3300005366 Bacteria 828
78 Ga0070663_100001458 3300005455 Bacteria 12998
79 Ga0070663_100166444 3300005455 Bacteria 1701
80 Ga0070678_100005285 3300005456 Bacteria 7442
81 Ga0070662_100028503 3300005457 Bacteria 3886
82 Ga0070662_100151535 3300005457 Bacteria 1806
83 Ga0070662_100455749 3300005457 Bacteria 1062
84 Ga0070662_100558159 3300005457 Bacteria 960
85 Ga0070681_10012761 3300005458 Bacteria 8337
86 Ga0070679_100000019 3300005530 Bacteria 127108
87 Ga0070679_100380610 3300005530 Unclassified 1358
88 Ga0068853_100006801 3300005539 Bacteria 9119
89 Ga0068853_101341364 3300005539 Bacteria 692
90 Ga0070672_100199065 3300005543 Bacteria 1675
91 Ga0070693_100527914 3300005547 Bacteria 841
92 Ga0070665_100000564 3300005548 Bacteria 51696
93 Ga0070665_101857790 3300005548 Unclassified 608
94 Ga0068855_100000007 3300005563 Bacteria 273676
95 Ga0068855_100031458 3300005563 Bacteria 6336
96 Ga0068855_100177510 3300005563 Bacteria 2409
97 Ga0068855_101554324 3300005563 Bacteria 678
98 Ga0070664_100319288 3300005564 Bacteria 1407
99 Ga0068857_100150492 3300005577 Unclassified 2108
100 Ga0068854_100000263 3300005578 Bacteria 35721
101 Ga0068854_100006607 3300005578 Bacteria 7386
102 Ga0068854_100035323 3300005578 Bacteria 3497
103 Ga0068854_100250188 3300005578 Bacteria 1415
104 Ga0068854_101931083 3300005578 Bacteria 543
105 Ga0068856_100343936 3300005614 Bacteria 1510
106 Ga0068856_100362726 3300005614 Bacteria 1467
107 Ga0068856_100753968 3300005614 Unclassified 993
108 Ga0068856_101984760 3300005614 Unclassified 592
109 Ga0068852_100002646 3300005616 Bacteria 12375
110 Ga0068852_100345616 3300005616 Bacteria 1451
111 Ga0068852_100468277 3300005616 Unclassified 1250
112 Ga0068852_102442119 3300005616 Bacteria 543
113 Ga0068859_100031328 3300005617 Bacteria 5340
114 Ga0068851_10064832 3300005834 Bacteria 1878
115 Ga0068860_100012470 3300005843 Bacteria 8370
116 Ga0068862_101128051 3300005844 Bacteria 780
117 Ga0081539_10020671 3300005985 Bacteria 4435
118 Ga0097621_100017199 3300006237 Bacteria 5488
119 Ga0075370_10312673 3300006353 Unclassified 935
120 Ga0068871_100049146 3300006358 Bacteria 3408
121 Ga0097620_100031327 3300006931 Bacteria 5340
122 Ga0105240_10009918 3300009093 Bacteria 13429
123 Ga0105240_10294499 3300009093 Bacteria 1859
124 Ga0105240_10987838 3300009093 Bacteria 901
125 Ga0105243_11964048 3300009148 Bacteria 619
126 Ga0105241_10046419 3300009174 Bacteria 3299
127 Ga0105237_10000699 3300009545 Bacteria 46489
128 Ga0105237_10194431 3300009545 Bacteria 2028
129 Ga0105237_10426153 3300009545 Bacteria 1332
130 Ga0105237_10735971 3300009545 Bacteria 993
131 Ga0105238_10282194 3300009551 Bacteria 1642
132 Ga0105239_10032266 3300010375 Bacteria 5756
133 Ga0105239_10309939 3300010375 Bacteria 1779
134 Ga0105239_10386347 3300010375 Bacteria 1583
135 Ga0105239_13000822 3300010375 Unclassified 550
136 Ga0105239_13091563 3300010375 Bacteria 542
137 Ga0105246_10108712 3300011119 Bacteria 2033
138 Ga0157373_10043395 3300013100 Bacteria 3212
139 Ga0157373_10101379 3300013100 Bacteria 2026
140 Ga0157373_10451556 3300013100 Bacteria 925
141 Ga0157371_10085752 3300013102 Bacteria 2231
142 Ga0157371_10343177 3300013102 Bacteria 1086
143 Ga0157371_10675467 3300013102 Bacteria 772
144 Ga0157371_11494187 3300013102 Bacteria 527
145 Ga0157370_10000095 3300013104 Bacteria 100727
146 Ga0157370_10423627 3300013104 Bacteria 1224
147 Ga0157370_10550533 3300013104 Bacteria 1058
148 Ga0157370_12143614 3300013104 Bacteria 501
149 Ga0157369_10001136 3300013105 Bacteria 33292
150 Ga0157369_10046364 3300013105 Bacteria 4724
151 Ga0157369_10075134 3300013105 Bacteria 3624
152 Ga0157369_10324607 3300013105 Bacteria 1600
153 Ga0157369_10638402 3300013105 Bacteria 1098
154 Ga0157369_11427938 3300013105 Unclassified 704
155 Ga0157369_11448113 3300013105 Bacteria 699
156 Ga0157374_10014640 3300013296 Bacteria 6865
157 Ga0157372_10013535 3300013307 Bacteria 8718
158 Ga0157372_10096974 3300013307 Bacteria 3361
159 Ga0157372_10160072 3300013307 Bacteria 2602
160 Ga0157372_10170674 3300013307 Bacteria 2516
161 Ga0157372_10204405 3300013307 Bacteria 2288
162 Ga0157372_10273824 3300013307 Bacteria 1962
163 Ga0157372_10493955 3300013307 Bacteria 1427
164 Ga0157372_13188496 3300013307 Unclassified 523
165 Ga0157375_13339979 3300013308 Unclassified 535
166 Ga0157380_10144440 3300014326 Bacteria 2049
167 Ga0157380_10792295 3300014326 Bacteria 964
168 Ga0157380_11570052 3300014326 Unclassified 713
169 Ga0163161_10067589 3300017792 Bacteria 2610
170 Ga0213876_10000617 3300021384 Bacteria 26182
171 Ga0209674_106476 3300025226 Bacteria 1593
172 Ga0209563_100024 3300025230 Bacteria 601155
173 Ga0209563_100125 3300025230 Bacteria 113854
174 Ga0207427_100701 3300025231 Bacteria 15709
175 Ga0209437_122103 3300025233 Bacteria 752
176 Ga0207425_1000088 3300025245 Bacteria 91367
177 Ga0209026_1003219 3300025250 Bacteria 5502
178 Ga0209677_106522 3300025253 Bacteria 2740
179 Ga0209148_1000008 3300025254 Bacteria 1504371
180 Ga0209148_1000355 3300025254 Bacteria 59062
181 Ga0209148_1003190 3300025254 Bacteria 4705
182 Ga0209129_1003978 3300025258 Bacteria 6089
183 Ga0209233_1000003 3300025261 Bacteria 1607366
184 Ga0209565_1013173 3300025263 Bacteria 1944
185 Ga0209455_1000002 3300025272 Bacteria 1505459
186 Ga0209455_1000423 3300025272 Bacteria 33215
187 Ga0209455_1049840 3300025272 Unclassified 591
188 Ga0209676_1000187 3300025292 Bacteria 141338
189 Ga0209676_1016315 3300025292 Bacteria 2687
190 Ga0209025_1001369 3300025294 Bacteria 32728
191 Ga0209758_1000007 3300025297 Bacteria 1270410
192 Ga0209758_1000009 3300025297 Bacteria 1123483
193 Ga0209050_1000005 3300025298 Bacteria 1557793
194 Ga0209050_1000039 3300025298 Bacteria 410069
195 Ga0207426_1077786 3300025302 Bacteria 907
196 Ga0209051_1000727 3300025303 Bacteria 35760
197 Ga0209257_1000051 3300025304 Bacteria 434166
198 Ga0209257_1003342 3300025304 Bacteria 13875
199 Ga0209257_1003939 3300025304 Bacteria 12060
200 Ga0209257_1004514 3300025304 Bacteria 10710
201 Ga0209257_1032423 3300025304 Bacteria 1657
202 Ga0209257_1099808 3300025304 Unclassified 710
203 Ga0207656_10235944 3300025321 Bacteria 893
204 Ga0207682_10034549 3300025893 Bacteria 2038
205 Ga0207688_10019118 3300025901 Bacteria 3729
206 Ga0207688_10460173 3300025901 Bacteria 794
207 Ga0207647_10001674 3300025904 Bacteria 17073
208 Ga0207647_10011674 3300025904 Bacteria 6148
209 Ga0207647_10016218 3300025904 Bacteria 5086
210 Ga0207647_10033758 3300025904 Bacteria 3273
211 Ga0207647_10043810 3300025904 Bacteria 2798
212 Ga0207647_10515910 3300025904 Bacteria 665
213 Ga0207705_10030679 3300025909 Bacteria 3836
214 Ga0207705_10091578 3300025909 Unclassified 2227
215 Ga0207705_11190414 3300025909 Bacteria 585
216 Ga0207654_10164360 3300025911 Bacteria 1436
217 Ga0207707_10024148 3300025912 Bacteria 5318
218 Ga0207695_10017354 3300025913 Bacteria 8376
219 Ga0207671_10034401 3300025914 Bacteria 3764
220 Ga0207671_10476785 3300025914 Bacteria 994
221 Ga0207660_10000452 3300025917 Bacteria 27021
222 Ga0207660_11642153 3300025917 Unclassified 517
223 Ga0207657_10001208 3300025919 Bacteria 27508
224 Ga0207657_10009838 3300025919 Bacteria 9577
225 Ga0207657_10020998 3300025919 Bacteria 6157
226 Ga0207657_10033235 3300025919 Bacteria 4651
227 Ga0207657_10373851 3300025919 Unclassified 1123
228 Ga0207649_10000055 3300025920 Bacteria 103054
229 Ga0207649_11205265 3300025920 Unclassified 598
230 Ga0207649_11411535 3300025920 Unclassified 551
231 Ga0207652_10000004 3300025921 Bacteria 436303
232 Ga0207652_11187840 3300025921 Bacteria 664
233 Ga0207681_10386678 3300025923 Bacteria 1127
234 Ga0207681_10673706 3300025923 Bacteria 859
235 Ga0207681_11379228 3300025923 Bacteria 592
236 Ga0207694_10217435 3300025924 Bacteria 1558
237 Ga0207650_10095219 3300025925 Unclassified 2282
238 Ga0207659_10063052 3300025926 Bacteria 2678
239 Ga0207659_10734322 3300025926 Bacteria 846
240 Ga0207644_10009173 3300025931 Bacteria 6488
241 Ga0207644_10087596 3300025931 Bacteria 2314
242 Ga0207690_10105979 3300025932 Bacteria 2016
243 Ga0207690_10267577 3300025932 Unclassified 1327
244 Ga0207690_10284058 3300025932 Bacteria 1290
245 Ga0207690_10658619 3300025932 Bacteria 858
246 Ga0207690_10712390 3300025932 Unclassified 826
247 Ga0207706_10006577 3300025933 Bacteria 10765
248 Ga0207706_10058745 3300025933 Bacteria 3387
249 Ga0207706_10407405 3300025933 Bacteria 1179
250 Ga0207706_10552403 3300025933 Bacteria 991
251 Ga0207709_10169775 3300025935 Bacteria 1529
252 Ga0207669_11223404 3300025937 Unclassified 637
253 Ga0207669_11702846 3300025937 Unclassified 538
254 Ga0207691_10177291 3300025940 Bacteria 1863
255 Ga0207691_10340432 3300025940 Bacteria 1284
256 Ga0207679_10686331 3300025945 Bacteria 928
257 Ga0207667_10000038 3300025949 Bacteria 280720
258 Ga0207667_10067601 3300025949 Bacteria 3722
259 Ga0207667_12129811 3300025949 Bacteria 519
260 Ga0207651_10603492 3300025960 Bacteria 960
261 Ga0207651_11995512 3300025960 Bacteria 521
262 Ga0207640_10001332 3300025981 Bacteria 13406
263 Ga0207640_10026503 3300025981 Bacteria 3521
264 Ga0207640_10031613 3300025981 Bacteria 3273
265 Ga0207640_10210994 3300025981 Bacteria 1479
266 Ga0207677_11733089 3300026023 Bacteria 579
267 Ga0207639_10003636 3300026041 Bacteria 10359
268 Ga0207639_10013915 3300026041 Bacteria 5643
269 Ga0207639_10077304 3300026041 Bacteria 2623
270 Ga0207639_11751469 3300026041 Bacteria 582
271 Ga0207678_10004209 3300026067 Bacteria 12911
272 Ga0207678_10091419 3300026067 Bacteria 2601
273 Ga0207678_11458861 3300026067 Unclassified 604
274 Ga0207702_10056450 3300026078 Bacteria 3334
275 Ga0207702_10132077 3300026078 Bacteria 2248
276 Ga0207641_10353318 3300026088 Unclassified 1401
277 Ga0207674_10049898 3300026116 Bacteria 4277
278 Ga0207674_10873142 3300026116 Bacteria 867
279 Ga0207683_10019962 3300026121 Bacteria 5725
280 Ga0207698_10000404 3300026142 Bacteria 24885
281 Ga0207698_10301865 3300026142 Bacteria 1491
282 Ga0207698_11569733 3300026142 Bacteria 673
283 Ga0268266_10003466 3300028379 Bacteria 15738
284 Ga0268265_10838407 3300028380 Bacteria 899
285 Ga0268264_10197719 3300028381 Bacteria 1837
286 Ga0307405_11828634 3300031731 Unclassified 540
287 Ga0307413_10016736 3300031824 Bacteria 3798
288 Ga0307410_10019211 3300031852 Bacteria 4151
289 Ga0307407_10170114 3300031903 Unclassified 1434
290 Ga0307409_100007226 3300031995 Bacteria 6622
291 Ga0307414_10045706 3300032004 Bacteria 3000
292 Ga0307414_10330451 3300032004 Bacteria 1301
293 Ga0307414_11687693 3300032004 Unclassified 591
294 Ga0307411_10102698 3300032005 Bacteria 2026
295 Ga0307411_10339155 3300032005 Bacteria 1221
296 Ga0307411_12000740 3300032005 Unclassified 541
297 Ga0307415_100729408 3300032126 Unclassified 897
298 Ga0307415_100958496 3300032126 Unclassified 792
299 Ga0395899_0058868 3300037312 Bacteria 2832
300 Ga0395900_0051263 3300037418 Bacteria 4252
301 Ga0395900_0093484 3300037418 Bacteria 3089
302 Ga0395900_1320168 3300037418 Bacteria 635
303 Ga0395900_1475869 3300037418 Unclassified 592
304 Ga0395898_1165622 3300037466 Unclassified 702
305 Ga0395905_0036479 3300037471 Bacteria 4618
306 Ga0395905_0103885 3300037471 Bacteria 2667
307 Ga0395905_0202658 3300037471 Bacteria 1860
308 Ga0395905_0409354 3300037471 Bacteria 1252
309 Ga0395905_0803885 3300037471 Unclassified 843
310 Ga0436364_0184680 3300037853 Unclassified 660
311 Ga0395901_0072959 3300038443 Bacteria 3579
312 Ga0395901_0163929 3300038443 Bacteria 2334
313 Ga0436365_1161979 3300039437 Bacteria 35526
314 Ga0436365_1722611 3300039437 Bacteria 934
315 Ga0436363_0673488 3300039450 Bacteria 566
316 Ga0439436_0025671 3300041404 Bacteria 1730
317 Ga0439436_0053221 3300041404 Bacteria 1140
318 Ga0439436_0109351 3300041404 Bacteria 771
319 Ga0439439_0040773 3300041406 Bacteria 1202
320 Ga0439439_0241816 3300041406 Bacteria 533
321 Ga0439447_082409 3300041407 Bacteria 742
322 Ga0439461_0000800 3300041410 Bacteria 4631
323 Ga0439461_0003244 3300041410 Bacteria 2666
324 Ga0439461_0009372 3300041410 Bacteria 1774
325 Ga0439466_0060653 3300041411 Bacteria 1219
326 Ga0439466_0125618 3300041411 Bacteria 791
327 Ga0439465_0000058 3300041413 Bacteria 23896
328 Ga0439465_0006192 3300041413 Bacteria 3803
329 Ga0439465_0006371 3300041413 Bacteria 3748
330 Ga0439465_0022170 3300041413 Bacteria 1994
331 Ga0439465_0030071 3300041413 Bacteria 1726
332 Ga0451789_0553014 3300041443 Bacteria 608
333 Ga0451793_1319936 3300041452 Bacteria 822
334 Ga0451795_1411884 3300041456 Unclassified 589
335 Ga0451833_0807197 3300041491 Unclassified 553
336 Ga0439431_0000427 3300041997 Bacteria 8943
337 Ga0439431_0002599 3300041997 Bacteria 3985
338 Ga0439431_0004172 3300041997 Bacteria 3170
339 Ga0439431_0020289 3300041997 Bacteria 1586
340 Ga0439431_0108406 3300041997 Bacteria 767
341 Ga0439442_009923 3300042002 Bacteria 1927
342 Ga0439442_104367 3300042002 Bacteria 615
343 Ga0439445_0001262 3300042004 Bacteria 5480
344 Ga0439445_0002858 3300042004 Bacteria 3857
345 Ga0439445_0015374 3300042004 Bacteria 1873
346 Ga0439445_0020326 3300042004 Bacteria 1661
347 Ga0439445_0024172 3300042004 Bacteria 1542
348 Ga0439445_0026300 3300042004 Bacteria 1489
349 Ga0439445_0028946 3300042004 Bacteria 1430
350 Ga0439448_0001347 3300042005 Bacteria 6292
351 Ga0439448_0022082 3300042005 Bacteria 1975
352 Ga0439448_0024162 3300042005 Bacteria 1899
353 Ga0439448_0029731 3300042005 Bacteria 1730
354 Ga0439432_001007 3300042006 Bacteria 10647
355 Ga0439432_003123 3300042006 Bacteria 6169
356 Ga0439432_015958 3300042006 Bacteria 2530
357 Ga0439449_0305722 3300042007 Bacteria 600
358 Ga0439450_078111 3300042008 Bacteria 820
359 Ga0439452_013772 3300042010 Bacteria 2262
360 Ga0439452_028380 3300042010 Bacteria 1396
361 Ga0439455_0000530 3300042012 Bacteria 5353
362 Ga0439455_0001694 3300042012 Bacteria 3800
363 Ga0439455_0003084 3300042012 Bacteria 3133
364 Ga0439455_0004893 3300042012 Bacteria 2686
365 Ga0439455_0017039 3300042012 Bacteria 1687
366 Ga0439457_010560 3300042014 Bacteria 2120
367 Ga0439462_0001356 3300042015 Bacteria 5408
368 Ga0439462_0005516 3300042015 Bacteria 3120
369 Ga0439462_0059858 3300042015 Bacteria 1030
370 Ga0439462_0158330 3300042015 Bacteria 638
371 Ga0450898_045443 3300042134 Bacteria 839
372 Ga0439446_0003091 3300042156 Bacteria 4087
373 Ga0439458_0000212 3300042157 Bacteria 13647
374 Ga0439458_0000552 3300042157 Bacteria 9632
375 Ga0439458_0000641 3300042157 Bacteria 9030
376 Ga0439434_0001645 3300042435 Bacteria 6464
377 Ga0439434_0003993 3300042435 Bacteria 4307
378 Ga0439434_0022902 3300042435 Bacteria 1879
379 Ga0439434_0024727 3300042435 Bacteria 1812
380 Ga0439434_0108064 3300042435 Bacteria 899
381 Ga0466972_0494928 3300044658 Bacteria 575
382 Ga0466966_0030483 3300044684 Plasmid 3503
383 Ga0466961_0001163 3300044693 Bacteria 16194
384 Ga0466963_0104570 3300044694 Bacteria 1940
385 Ga0466963_0901067 3300044694 Bacteria 623
386 Ga0466963_0983525 3300044694 Unclassified 594
387 Ga0466964_0034465 3300044706 Bacteria 2020
388 Ga0466968_0115395 3300044735 Bacteria 1211
389 Ga0466970_0002019 3300044765 Bacteria 9821
390 Ga0466957_0110692 3300044842 Bacteria 1741
391 Ga0466960_0054187 3300044901 Unclassified 1946
392 Ga0466959_0023694 3300045049 Bacteria 4543
393 Ga0466958_0052741 3300045836 Bacteria 2466
394 Ga0466958_0161785 3300045836 Bacteria 1414
395 Ga0466958_0640145 3300045836 Bacteria 692
396 Ga0466967_0096341 3300045976 Bacteria 2699
397 Ga0466967_0501251 3300045976 Unclassified 1191
398 Ga0466967_0966490 3300045976 Bacteria 848
399 Ga0495627_012033 3300046453 Bacteria 3081
400 Ga0495650_0237181 3300046471 Unclassified 624
401 Ga0495606_0002862 3300046507 Bacteria 19095
402 Ga0495606_0128361 3300046507 Bacteria 1510
403 Ga0495642_0009737 3300046528 Bacteria 3680
404 Ga0495668_0456933 3300046616 Bacteria 703
405 Ga0495625_0109130 3300046660 Bacteria 1893
406 Ga0495670_0000037 3300046691 Bacteria 77395
407 Ga0495671_0399285 3300046692 Unclassified 658
408 Ga0495649_0285280 3300046694 Bacteria 843
409 Ga0495660_0472722 3300046810 Bacteria 539
410 Ga0495687_111976 3300047443 Bacteria 1001
411 Ga0495673_0029088 3300047469 Bacteria 2611
412 Ga0495681_0033013 3300047470 Bacteria 2598
413 Ga0495681_0287806 3300047470 Unclassified 639
414 Ga0495686_0001276 3300047472 Bacteria 28479
415 Ga0496102_0418265 3300048905 Bacteria 1259
416 Ga0496102_0840891 3300048905 Bacteria 840
417 Ga0496115_0741624 3300048918 Bacteria 769
418 Ga0496117_0014693 3300048920 Bacteria 6727
419 Ga0496117_0419840 3300048920 Unclassified 669
420 Ga0496118_0011963 3300048921 Bacteria 8387
421 Ga0496118_0173168 3300048921 Bacteria 1315
422 Ga0496120_0024742 3300048923 Bacteria 3738
423 Ga0496121_0024764 3300048924 Bacteria 5726
424 Ga0496121_0174328 3300048924 Bacteria 1559
425 Ga0496122_0011314 3300048925 Bacteria 9058
426 Ga0496122_0066088 3300048925 Bacteria 2616
427 Ga0496123_0007037 3300048926 Bacteria 10709
428 Ga0496123_0025194 3300048926 Bacteria 4492
429 Ga0496123_0087132 3300048926 Bacteria 1869
430 Ga0496123_0202751 3300048926 Unclassified 1015
431 Ga0496124_0001368 3300048927 Bacteria 36509
432 Ga0496124_0005887 3300048927 Bacteria 13575
433 Ga0496124_0059884 3300048927 Bacteria 3197
434 Ga0496124_0562992 3300048927 Bacteria 750
435 Ga0496125_0264837 3300048928 Bacteria 1075
436 Ga0496125_0309512 3300048928 Bacteria 963
437 Ga0496125_0402128 3300048928 Bacteria 800
438 Ga0496126_0323782 3300048929 Bacteria 1266
439 Ga0501033_0386161 3300049570 Unclassified 978
440 Ga0501034_0858927 3300049571 Bacteria 797
441 Ga0501238_077597 3300049671 Unclassified 521
442 Ga0501080_0568948 3300049742 Bacteria 1008
443 Ga0501080_1019217 3300049742 Bacteria 717
444 Ga0501241_004217 3300049758 Bacteria 2699
445 Ga0501276_015292 3300049773 Unclassified 689
446 Ga0501035_0054257 3300049822 Bacteria 3582
447 nmdc:mga07m45_118528_c1 3300050496 Unclassified 1528
448 Ga0500643_001018 3300053087 Bacteria 17087
449 Ga0500643_004787 3300053087 Bacteria 5989
450 Ga0500643_010613 3300053087 Bacteria 3415
451 Ga0500643_109862 3300053087 Unclassified 745
452 Ga0500643_188816 3300053087 Bacteria 552
453 Ga0500566_0140795 3300053094 Bacteria 1280
454 Ga0500650_0363648 3300053098 Bacteria 631
455 Ga0500655_062209 3300053133 Bacteria 753
456 Ga0500658_0001792 3300053134 Bacteria 8477
457 Ga0500658_0014110 3300053134 Bacteria 2956
458 Ga0500568_0038949 3300053139 Bacteria 1922
459 Ga0500587_001316 3300053739 Bacteria 3486
460 Ga0466962_0232672 3300061719 Bacteria 904

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041452 Ga0451793_1319936 Ga0451793_1319936_153_416 84
2 3300044842 Ga0466957_0110692 Ga0466957_0110692_175_477 86
3 iso_pu_bacteria 2818991466 2819716595 86
4 iso_pu_bacteria 2879163058 2879165410 86
5 3300003759 Ga0055525_1000086 Ga0055525_1000086147 88
6 3300003762 Ga0055542_1000041 Ga0055542_1000041110 88
7 3300003762 Ga0055542_1005909 Ga0055542_10059096 88
8 3300003763 Ga0055529_1000040 Ga0055529_1000040135 88
9 3300025230 Ga0209563_100024 Ga0209563_100024228 88
10 3300025254 Ga0209148_1000008 Ga0209148_1000008185 88
11 3300025272 Ga0209455_1000002 Ga0209455_10000021239 88
12 3300025297 Ga0209758_1000007 Ga0209758_1000007388 88
13 3300025920 Ga0207649_11205265 Ga0207649_112052652 88
14 3300032126 Ga0307415_100958496 Ga0307415_1009584962 88
15 3300005339 Ga0070660_100001071 Ga0070660_1000010714 89
16 3300021384 Ga0213876_10000617 Ga0213876_100006172 89
17 3300025226 Ga0209674_106476 Ga0209674_1064762 89
18 3300039437 Ga0436365_1161979 Ga0436365_1161979_330_599 89
19 3300039437 Ga0436365_1722611 Ga0436365_1722611_620_889 89
20 3300039450 Ga0436363_0673488 Ga0436363_0673488_247_516 89
21 3300046692 Ga0495671_0399285 Ga0495671_0399285_202_471 89
22 3300001979 JGI24740J21852_10099809 JGI24740J21852_100998092 90
23 3300002067 JGI24735J21928_10013733 JGI24735J21928_100137331 90
24 3300003316 rootH1_10173631 rootH1_101736312 90
25 3300003320 rootH2_10171796 rootH2_101717962 90
26 3300003781 Ga0055536_1006364 Ga0055536_10063642 90
27 3300005339 Ga0070660_100704082 Ga0070660_1007040821 90
28 3300005353 Ga0070669_100088096 Ga0070669_1000880965 90
29 3300005354 Ga0070675_101253981 Ga0070675_1012539812 90
30 3300005355 Ga0070671_100027923 Ga0070671_1000279233 90
31 3300005356 Ga0070674_101048865 Ga0070674_1010488651 90
32 3300005455 Ga0070663_100166444 Ga0070663_1001664441 90
33 3300005563 Ga0068855_100177510 Ga0068855_1001775103 90
34 3300005578 Ga0068854_100006607 Ga0068854_1000066072 90
35 3300005614 Ga0068856_101984760 Ga0068856_1019847602 90
36 3300006931 Ga0097620_100031327 Ga0097620_1000313275 90
37 3300009093 Ga0105240_10009918 Ga0105240_1000991812 90
38 3300009093 Ga0105240_10294499 Ga0105240_102944991 90
39 3300009148 Ga0105243_11964048 Ga0105243_119640482 90
40 3300009545 Ga0105237_10000699 Ga0105237_100006994 90
41 3300009545 Ga0105237_10194431 Ga0105237_101944313 90
42 3300010375 Ga0105239_10309939 Ga0105239_103099393 90
43 3300010375 Ga0105239_10386347 Ga0105239_103863471 90
44 3300011119 Ga0105246_10108712 Ga0105246_101087122 90
45 3300013100 Ga0157373_10043395 Ga0157373_100433952 90
46 3300013102 Ga0157371_10085752 Ga0157371_100857521 90
47 3300013102 Ga0157371_11494187 Ga0157371_114941871 90
48 3300013104 Ga0157370_10000095 Ga0157370_1000009549 90
49 3300013104 Ga0157370_10550533 Ga0157370_105505332 90
50 3300013104 Ga0157370_12143614 Ga0157370_121436142 90
51 3300013105 Ga0157369_10046364 Ga0157369_100463646 90
52 3300013105 Ga0157369_10075134 Ga0157369_100751344 90
53 3300013307 Ga0157372_10013535 Ga0157372_100135354 90
54 3300013307 Ga0157372_10096974 Ga0157372_100969744 90
55 3300013307 Ga0157372_10170674 Ga0157372_101706743 90
56 3300013307 Ga0157372_10273824 Ga0157372_102738242 90
57 3300013307 Ga0157372_13188496 Ga0157372_131884961 90
58 3300014326 Ga0157380_10144440 Ga0157380_101444403 90
59 3300014326 Ga0157380_10792295 Ga0157380_107922952 90
60 3300014326 Ga0157380_11570052 Ga0157380_115700521 90
61 3300025254 Ga0209148_1000355 Ga0209148_100035544 90
62 3300025272 Ga0209455_1049840 Ga0209455_10498402 90
63 3300025292 Ga0209676_1000187 Ga0209676_100018795 90
64 3300025298 Ga0209050_1000039 Ga0209050_1000039155 90
65 3300025302 Ga0207426_1077786 Ga0207426_10777862 90
66 3300025304 Ga0209257_1000051 Ga0209257_1000051155 90
67 3300025304 Ga0209257_1032423 Ga0209257_10324233 90
68 3300025901 Ga0207688_10460173 Ga0207688_104601731 90
69 3300025919 Ga0207657_10009838 Ga0207657_100098386 90
70 3300025921 Ga0207652_11187840 Ga0207652_111878401 90
71 3300025925 Ga0207650_10095219 Ga0207650_100952193 90
72 3300025926 Ga0207659_10734322 Ga0207659_107343221 90
73 3300025931 Ga0207644_10087596 Ga0207644_100875963 90
74 3300025932 Ga0207690_10712390 Ga0207690_107123902 90
75 3300025949 Ga0207667_10067601 Ga0207667_100676013 90
76 3300025981 Ga0207640_10031613 Ga0207640_100316135 90
77 3300026041 Ga0207639_10013915 Ga0207639_100139156 90
78 3300026067 Ga0207678_10091419 Ga0207678_100914193 90
79 3300026116 Ga0207674_10873142 Ga0207674_108731422 90
80 3300032005 Ga0307411_10339155 Ga0307411_103391551 90
81 3300037418 Ga0395900_0051263 Ga0395900_0051263_3425_3697 90
82 3300037418 Ga0395900_1320168 Ga0395900_1320168_147_419 90
83 3300037471 Ga0395905_0202658 Ga0395905_0202658_721_993 90
84 3300037471 Ga0395905_0803885 Ga0395905_0803885_171_443 90
85 3300038443 Ga0395901_0072959 Ga0395901_0072959_3050_3322 90
86 3300041404 Ga0439436_0025671 Ga0439436_0025671_1342_1617 90
87 3300041404 Ga0439436_0109351 Ga0439436_0109351_461_733 90
88 3300041406 Ga0439439_0241816 Ga0439439_0241816_229_501 90
89 3300041407 Ga0439447_082409 Ga0439447_082409_73_345 90
90 3300041410 Ga0439461_0000800 Ga0439461_0000800_3970_4242 90
91 3300041410 Ga0439461_0003244 Ga0439461_0003244_73_345 90
92 3300041413 Ga0439465_0000058 Ga0439465_0000058_12040_12315 90
93 3300041413 Ga0439465_0022170 Ga0439465_0022170_397_669 90
94 3300041413 Ga0439465_0030071 Ga0439465_0030071_25_297 90
95 3300041997 Ga0439431_0002599 Ga0439431_0002599_869_1144 90
96 3300041997 Ga0439431_0004172 Ga0439431_0004172_1341_1613 90
97 3300042002 Ga0439442_104367 Ga0439442_104367_154_426 90
98 3300042004 Ga0439445_0001262 Ga0439445_0001262_4811_5086 90
99 3300042004 Ga0439445_0020326 Ga0439445_0020326_304_576 90
100 3300042004 Ga0439445_0028946 Ga0439445_0028946_279_551 90
101 3300042005 Ga0439448_0024162 Ga0439448_0024162_914_1186 90
102 3300042006 Ga0439432_001007 Ga0439432_001007_4851_5123 90
103 3300042006 Ga0439432_003123 Ga0439432_003123_3164_3436 90
104 3300042010 Ga0439452_028380 Ga0439452_028380_226_498 90
105 3300042012 Ga0439455_0000530 Ga0439455_0000530_4342_4614 90
106 3300042014 Ga0439457_010560 Ga0439457_010560_1583_1855 90
107 3300042015 Ga0439462_0001356 Ga0439462_0001356_2419_2691 90
108 3300042015 Ga0439462_0005516 Ga0439462_0005516_2301_2573 90
109 3300042134 Ga0450898_045443 Ga0450898_045443_58_330 90
110 3300042156 Ga0439446_0003091 Ga0439446_0003091_771_1043 90
111 3300042435 Ga0439434_0001645 Ga0439434_0001645_5473_5745 90
112 3300042435 Ga0439434_0003993 Ga0439434_0003993_1557_1829 90
113 3300044658 Ga0466972_0494928 Ga0466972_0494928_129_401 90
114 3300044684 Ga0466966_0030483 Ga0466966_0030483_3177_3449 90
115 3300044693 Ga0466961_0001163 Ga0466961_0001163_10682_10954 90
116 3300044694 Ga0466963_0901067 Ga0466963_0901067_19_291 90
117 3300044694 Ga0466963_0983525 Ga0466963_0983525_177_452 90
118 3300044706 Ga0466964_0034465 Ga0466964_0034465_828_1100 90
119 3300044735 Ga0466968_0115395 Ga0466968_0115395_238_510 90
120 3300044765 Ga0466970_0002019 Ga0466970_0002019_3471_3743 90
121 3300044901 Ga0466960_0054187 Ga0466960_0054187_1514_1786 90
122 3300045049 Ga0466959_0023694 Ga0466959_0023694_3382_3654 90
123 3300045836 Ga0466958_0052741 Ga0466958_0052741_752_1027 90
124 3300045836 Ga0466958_0161785 Ga0466958_0161785_147_419 90
125 3300045836 Ga0466958_0640145 Ga0466958_0640145_337_609 90
126 3300045976 Ga0466967_0501251 Ga0466967_0501251_575_847 90
127 3300045976 Ga0466967_0966490 Ga0466967_0966490_228_500 90
128 3300046453 Ga0495627_012033 Ga0495627_012033_790_1062 90
129 3300046507 Ga0495606_0002862 Ga0495606_0002862_18057_18329 90
130 3300046691 Ga0495670_0000037 Ga0495670_0000037_48649_48921 90
131 3300047470 Ga0495681_0033013 Ga0495681_0033013_471_743 90
132 3300047470 Ga0495681_0287806 Ga0495681_0287806_278_550 90
133 3300048905 Ga0496102_0840891 Ga0496102_0840891_533_805 90
134 3300048918 Ga0496115_0741624 Ga0496115_0741624_12_284 90
135 3300048920 Ga0496117_0014693 Ga0496117_0014693_886_1158 90
136 3300048920 Ga0496117_0419840 Ga0496117_0419840_132_404 90
137 3300048921 Ga0496118_0011963 Ga0496118_0011963_3779_4051 90
138 3300048921 Ga0496118_0173168 Ga0496118_0173168_338_610 90
139 3300048924 Ga0496121_0174328 Ga0496121_0174328_978_1250 90
140 3300048925 Ga0496122_0011314 Ga0496122_0011314_360_632 90
141 3300048925 Ga0496122_0066088 Ga0496122_0066088_1945_2217 90
142 3300048926 Ga0496123_0007037 Ga0496123_0007037_2034_2306 90
143 3300048926 Ga0496123_0025194 Ga0496123_0025194_1706_1978 90
144 3300048926 Ga0496123_0087132 Ga0496123_0087132_1453_1731 90
145 3300048927 Ga0496124_0001368 Ga0496124_0001368_16874_17146 90
146 3300048927 Ga0496124_0005887 Ga0496124_0005887_7715_7987 90
147 3300048927 Ga0496124_0059884 Ga0496124_0059884_247_525 90
148 3300048927 Ga0496124_0562992 Ga0496124_0562992_181_453 90
149 3300048928 Ga0496125_0264837 Ga0496125_0264837_466_738 90
150 3300048928 Ga0496125_0402128 Ga0496125_0402128_363_635 90
151 3300048929 Ga0496126_0323782 Ga0496126_0323782_877_1149 90
152 3300049570 Ga0501033_0386161 Ga0501033_0386161_560_832 90
153 3300049571 Ga0501034_0858927 Ga0501034_0858927_196_468 90
154 3300049742 Ga0501080_0568948 Ga0501080_0568948_138_410 90
155 3300049822 Ga0501035_0054257 Ga0501035_0054257_2690_2962 90
156 3300053087 Ga0500643_001018 Ga0500643_001018_12357_12629 90
157 3300053087 Ga0500643_004787 Ga0500643_004787_5661_5939 90
158 3300053087 Ga0500643_010613 Ga0500643_010613_1103_1375 90
159 3300053087 Ga0500643_109862 Ga0500643_109862_352_624 90
160 3300053087 Ga0500643_188816 Ga0500643_188816_224_502 90
161 3300053094 Ga0500566_0140795 Ga0500566_0140795_146_424 90
162 3300053098 Ga0500650_0363648 Ga0500650_0363648_52_327 90
163 3300053133 Ga0500655_062209 Ga0500655_062209_93_365 90
164 3300053134 Ga0500658_0001792 Ga0500658_0001792_4116_4391 90
165 3300053134 Ga0500658_0014110 Ga0500658_0014110_1546_1818 90
166 3300053139 Ga0500568_0038949 Ga0500568_0038949_1386_1658 90
167 3300061719 Ga0466962_0232672 Ga0466962_0232672_408_683 90
168 3300025917 Ga0207660_11642153 Ga0207660_116421531 93
169 3300005333 Ga0070677_10242088 Ga0070677_102420882 94
170 3300013307 Ga0157372_10204405 Ga0157372_102044053 94
171 3300025893 Ga0207682_10034549 Ga0207682_100345492 94
172 3300031731 Ga0307405_11828634 Ga0307405_118286341 95
173 3300031824 Ga0307413_10016736 Ga0307413_100167363 95
174 3300031852 Ga0307410_10019211 Ga0307410_100192112 95
175 3300031903 Ga0307407_10170114 Ga0307407_101701143 95
176 3300031995 Ga0307409_100007226 Ga0307409_1000072263 95
177 3300032004 Ga0307414_10045706 Ga0307414_100457062 95
178 3300032005 Ga0307411_10102698 Ga0307411_101026983 95
179 3300032126 Ga0307415_100729408 Ga0307415_1007294081 95
180 iso_pu_bacteria 2818991466 2819713786 96
181 iso_pu_bacteria 2928526807 2928527437 96
182 iso_pu_bacteria 2928526807 2928528244 96
183 iso_pu_bacteria 2946787523 2946791455 96
184 3300003187 JGI25151J46595_10091510 JGI25151J46595_100915102 98
185 3300003215 JGI25153J46596_10000231 JGI25153J46596_1000023120 98
186 3300003781 Ga0055536_1010731 Ga0055536_10107313 98
187 3300003792 Ga0055540_1001746 Ga0055540_100174610 98
188 3300025245 Ga0207425_1000088 Ga0207425_100008814 98
189 3300025258 Ga0209129_1003978 Ga0209129_10039786 98
190 3300025263 Ga0209565_1013173 Ga0209565_10131733 98
191 3300025292 Ga0209676_1016315 Ga0209676_10163152 98
192 3300025294 Ga0209025_1001369 Ga0209025_100136914 98
193 3300025297 Ga0209758_1000009 Ga0209758_1000009552 98
194 3300025298 Ga0209050_1000005 Ga0209050_1000005618 98
195 3300025303 Ga0209051_1000727 Ga0209051_100072722 98
196 3300025304 Ga0209257_1003939 Ga0209257_10039397 98
197 3300025304 Ga0209257_1004514 Ga0209257_10045146 98
198 3300048905 Ga0496102_0418265 Ga0496102_0418265_369_665 98
199 3300005327 Ga0070658_10003160 Ga0070658_100031607 99
200 3300005366 Ga0070659_100784187 Ga0070659_1007841872 99
201 3300013104 Ga0157370_10423627 Ga0157370_104236272 99
202 3300013105 Ga0157369_11427938 Ga0157369_114279381 99
203 3300013308 Ga0157375_13339979 Ga0157375_133399792 99
204 3300025233 Ga0209437_122103 Ga0209437_1221031 99
205 3300025253 Ga0209677_106522 Ga0209677_1065224 99
206 3300025909 Ga0207705_10091578 Ga0207705_100915783 99
207 3300025919 Ga0207657_10001208 Ga0207657_1000120825 99
208 3300025960 Ga0207651_10603492 Ga0207651_106034922 99
209 3300046616 Ga0495668_0456933 Ga0495668_0456933_306_614 99
210 3300046660 Ga0495625_0109130 Ga0495625_0109130_507_815 99
211 3300001904 JGI24736J21556_1009892 JGI24736J21556_10098922 100
212 3300001904 JGI24736J21556_1079632 JGI24736J21556_10796321 100
213 3300001979 JGI24740J21852_10064426 JGI24740J21852_100644262 100
214 3300001989 JGI24739J22299_10000613 JGI24739J22299_100006137 100
215 3300001989 JGI24739J22299_10019069 JGI24739J22299_100190693 100
216 3300001989 JGI24739J22299_10019365 JGI24739J22299_100193654 100
217 3300001989 JGI24739J22299_10255130 JGI24739J22299_102551302 100
218 3300001990 JGI24737J22298_10000132 JGI24737J22298_100001326 100
219 3300001990 JGI24737J22298_10019340 JGI24737J22298_100193402 100
220 3300001990 JGI24737J22298_10021304 JGI24737J22298_100213043 100
221 3300001990 JGI24737J22298_10047246 JGI24737J22298_100472462 100
222 3300001991 JGI24743J22301_10023050 JGI24743J22301_100230502 100
223 3300002067 JGI24735J21928_10000391 JGI24735J21928_1000039113 100
224 3300002067 JGI24735J21928_10001784 JGI24735J21928_100017843 100
225 3300002067 JGI24735J21928_10009812 JGI24735J21928_100098123 100
226 3300002067 JGI24735J21928_10014956 JGI24735J21928_100149564 100
227 3300002067 JGI24735J21928_10053430 JGI24735J21928_100534302 100
228 3300002067 JGI24735J21928_10074498 JGI24735J21928_100744982 100
229 3300002075 JGI24738J21930_10000280 JGI24738J21930_100002806 100
230 3300002075 JGI24738J21930_10002675 JGI24738J21930_100026754 100
231 3300002077 JGI24744J21845_10008009 JGI24744J21845_100080093 100
232 3300002774 JGI25150J39212_1024134 JGI25150J39212_10241341 100
233 3300003214 JGI25165J46597_1000173 JGI25165J46597_10001739 100
234 3300003316 rootH1_10000365 rootH1_100003652 100
235 3300003322 rootL2_10136660 rootL2_101366601 100
236 3300003322 rootL2_10189986 rootL2_101899863 100
237 3300003775 Ga0055524_1000118 Ga0055524_1000118102 100
238 3300003790 Ga0055528_1034854 Ga0055528_10348543 100
239 3300003791 Ga0055530_10000074 Ga0055530_1000007446 100
240 3300003794 Ga0055531_10001454 Ga0055531_100014543 100
241 3300003794 Ga0055531_10001624 Ga0055531_100016249 100
242 3300004625 Ga0055543_1018388 Ga0055543_10183882 100
243 3300005262 Ga0065165_1004490 Ga0065165_10044908 100
244 3300005327 Ga0070658_10026308 Ga0070658_100263087 100
245 3300005327 Ga0070658_10201127 Ga0070658_102011272 100
246 3300005327 Ga0070658_11497691 Ga0070658_114976912 100
247 3300005331 Ga0070670_100104754 Ga0070670_1001047543 100
248 3300005339 Ga0070660_100008989 Ga0070660_1000089893 100
249 3300005339 Ga0070660_100025697 Ga0070660_1000256972 100
250 3300005339 Ga0070660_100571541 Ga0070660_1005715411 100
251 3300005344 Ga0070661_100000189 Ga0070661_10000018951 100
252 3300005344 Ga0070661_101163218 Ga0070661_1011632182 100
253 3300005347 Ga0070668_102071054 Ga0070668_1020710541 100
254 3300005353 Ga0070669_100298042 Ga0070669_1002980422 100
255 3300005354 Ga0070675_100010770 Ga0070675_1000107704 100
256 3300005354 Ga0070675_100990794 Ga0070675_1009907942 100
257 3300005355 Ga0070671_100048789 Ga0070671_1000487894 100
258 3300005356 Ga0070674_101516180 Ga0070674_1015161802 100
259 3300005364 Ga0070673_101100561 Ga0070673_1011005612 100
260 3300005364 Ga0070673_102315462 Ga0070673_1023154622 100
261 3300005366 Ga0070659_100151038 Ga0070659_1001510384 100
262 3300005366 Ga0070659_100274712 Ga0070659_1002747122 100
263 3300005366 Ga0070659_100307128 Ga0070659_1003071282 100
264 3300005366 Ga0070659_100323797 Ga0070659_1003237972 100
265 3300005366 Ga0070659_100370906 Ga0070659_1003709062 100
266 3300005455 Ga0070663_100001458 Ga0070663_1000014588 100
267 3300005456 Ga0070678_100005285 Ga0070678_1000052858 100
268 3300005457 Ga0070662_100028503 Ga0070662_1000285033 100
269 3300005457 Ga0070662_100151535 Ga0070662_1001515352 100
270 3300005457 Ga0070662_100455749 Ga0070662_1004557493 100
271 3300005457 Ga0070662_100558159 Ga0070662_1005581592 100
272 3300005458 Ga0070681_10012761 Ga0070681_100127616 100
273 3300005530 Ga0070679_100000019 Ga0070679_10000001977 100
274 3300005530 Ga0070679_100380610 Ga0070679_1003806102 100
275 3300005539 Ga0068853_100006801 Ga0068853_1000068014 100
276 3300005539 Ga0068853_101341364 Ga0068853_1013413641 100
277 3300005543 Ga0070672_100199065 Ga0070672_1001990653 100
278 3300005547 Ga0070693_100527914 Ga0070693_1005279142 100
279 3300005548 Ga0070665_100000564 Ga0070665_10000056446 100
280 3300005548 Ga0070665_101857790 Ga0070665_1018577901 100
281 3300005563 Ga0068855_100000007 Ga0068855_10000000780 100
282 3300005563 Ga0068855_100031458 Ga0068855_1000314582 100
283 3300005563 Ga0068855_101554324 Ga0068855_1015543241 100
284 3300005564 Ga0070664_100319288 Ga0070664_1003192883 100
285 3300005577 Ga0068857_100150492 Ga0068857_1001504923 100
286 3300005578 Ga0068854_100000263 Ga0068854_1000002635 100
287 3300005578 Ga0068854_100035323 Ga0068854_1000353232 100
288 3300005578 Ga0068854_100250188 Ga0068854_1002501883 100
289 3300005578 Ga0068854_101931083 Ga0068854_1019310831 100
290 3300005614 Ga0068856_100343936 Ga0068856_1003439361 100
291 3300005614 Ga0068856_100362726 Ga0068856_1003627263 100
292 3300005614 Ga0068856_100753968 Ga0068856_1007539682 100
293 3300005616 Ga0068852_100002646 Ga0068852_10000264611 100
294 3300005616 Ga0068852_100345616 Ga0068852_1003456162 100
295 3300005616 Ga0068852_100468277 Ga0068852_1004682772 100
296 3300005616 Ga0068852_102442119 Ga0068852_1024421192 100
297 3300005617 Ga0068859_100031328 Ga0068859_1000313283 100
298 3300005834 Ga0068851_10064832 Ga0068851_100648323 100
299 3300005843 Ga0068860_100012470 Ga0068860_1000124702 100
300 3300005844 Ga0068862_101128051 Ga0068862_1011280512 100
301 3300005985 Ga0081539_10020671 Ga0081539_100206712 100
302 3300006237 Ga0097621_100017199 Ga0097621_1000171994 100
303 3300006353 Ga0075370_10312673 Ga0075370_103126732 100
304 3300006358 Ga0068871_100049146 Ga0068871_1000491464 100
305 3300009093 Ga0105240_10987838 Ga0105240_109878382 100
306 3300009174 Ga0105241_10046419 Ga0105241_100464192 100
307 3300009545 Ga0105237_10426153 Ga0105237_104261533 100
308 3300009545 Ga0105237_10735971 Ga0105237_107359711 100
309 3300009551 Ga0105238_10282194 Ga0105238_102821943 100
310 3300010375 Ga0105239_10032266 Ga0105239_100322665 100
311 3300010375 Ga0105239_13000822 Ga0105239_130008222 100
312 3300010375 Ga0105239_13091563 Ga0105239_130915631 100
313 3300013100 Ga0157373_10101379 Ga0157373_101013792 100
314 3300013100 Ga0157373_10451556 Ga0157373_104515561 100
315 3300013102 Ga0157371_10343177 Ga0157371_103431772 100
316 3300013102 Ga0157371_10675467 Ga0157371_106754672 100
317 3300013105 Ga0157369_10001136 Ga0157369_1000113631 100
318 3300013105 Ga0157369_10324607 Ga0157369_103246072 100
319 3300013105 Ga0157369_10638402 Ga0157369_106384022 100
320 3300013105 Ga0157369_11448113 Ga0157369_114481131 100
321 3300013296 Ga0157374_10014640 Ga0157374_100146404 100
322 3300013307 Ga0157372_10160072 Ga0157372_101600723 100
323 3300013307 Ga0157372_10493955 Ga0157372_104939552 100
324 3300017792 Ga0163161_10067589 Ga0163161_100675895 100
325 3300025230 Ga0209563_100125 Ga0209563_10012558 100
326 3300025231 Ga0207427_100701 Ga0207427_1007014 100
327 3300025250 Ga0209026_1003219 Ga0209026_10032194 100
328 3300025254 Ga0209148_1003190 Ga0209148_10031903 100
329 3300025261 Ga0209233_1000003 Ga0209233_10000031196 100
330 3300025272 Ga0209455_1000423 Ga0209455_100042319 100
331 3300025304 Ga0209257_1003342 Ga0209257_10033422 100
332 3300025304 Ga0209257_1099808 Ga0209257_10998082 100
333 3300025321 Ga0207656_10235944 Ga0207656_102359442 100
334 3300025901 Ga0207688_10019118 Ga0207688_100191183 100
335 3300025904 Ga0207647_10001674 Ga0207647_1000167412 100
336 3300025904 Ga0207647_10011674 Ga0207647_100116746 100
337 3300025904 Ga0207647_10016218 Ga0207647_100162185 100
338 3300025904 Ga0207647_10033758 Ga0207647_100337584 100
339 3300025904 Ga0207647_10043810 Ga0207647_100438103 100
340 3300025904 Ga0207647_10515910 Ga0207647_105159101 100
341 3300025909 Ga0207705_10030679 Ga0207705_100306792 100
342 3300025909 Ga0207705_11190414 Ga0207705_111904142 100
343 3300025911 Ga0207654_10164360 Ga0207654_101643602 100
344 3300025912 Ga0207707_10024148 Ga0207707_100241485 100
345 3300025913 Ga0207695_10017354 Ga0207695_100173547 100
346 3300025914 Ga0207671_10034401 Ga0207671_100344017 100
347 3300025914 Ga0207671_10476785 Ga0207671_104767851 100
348 3300025917 Ga0207660_10000452 Ga0207660_1000045213 100
349 3300025919 Ga0207657_10020998 Ga0207657_100209983 100
350 3300025919 Ga0207657_10033235 Ga0207657_100332358 100
351 3300025919 Ga0207657_10373851 Ga0207657_103738512 100
352 3300025920 Ga0207649_10000055 Ga0207649_1000005551 100
353 3300025920 Ga0207649_11411535 Ga0207649_114115352 100
354 3300025921 Ga0207652_10000004 Ga0207652_10000004332 100
355 3300025923 Ga0207681_10386678 Ga0207681_103866782 100
356 3300025923 Ga0207681_10673706 Ga0207681_106737061 100
357 3300025923 Ga0207681_11379228 Ga0207681_113792281 100
358 3300025924 Ga0207694_10217435 Ga0207694_102174351 100
359 3300025926 Ga0207659_10063052 Ga0207659_100630523 100
360 3300025931 Ga0207644_10009173 Ga0207644_100091734 100
361 3300025932 Ga0207690_10105979 Ga0207690_101059792 100
362 3300025932 Ga0207690_10267577 Ga0207690_102675772 100
363 3300025932 Ga0207690_10284058 Ga0207690_102840583 100
364 3300025932 Ga0207690_10658619 Ga0207690_106586192 100
365 3300025933 Ga0207706_10006577 Ga0207706_100065773 100
366 3300025933 Ga0207706_10058745 Ga0207706_100587452 100
367 3300025933 Ga0207706_10407405 Ga0207706_104074051 100
368 3300025933 Ga0207706_10552403 Ga0207706_105524032 100
369 3300025935 Ga0207709_10169775 Ga0207709_101697751 100
370 3300025937 Ga0207669_11223404 Ga0207669_112234042 100
371 3300025937 Ga0207669_11702846 Ga0207669_117028461 100
372 3300025940 Ga0207691_10177291 Ga0207691_101772912 100
373 3300025940 Ga0207691_10340432 Ga0207691_103404322 100
374 3300025945 Ga0207679_10686331 Ga0207679_106863312 100
375 3300025949 Ga0207667_10000038 Ga0207667_1000003878 100
376 3300025949 Ga0207667_12129811 Ga0207667_121298111 100
377 3300025960 Ga0207651_11995512 Ga0207651_119955121 100
378 3300025981 Ga0207640_10001332 Ga0207640_1000133210 100
379 3300025981 Ga0207640_10026503 Ga0207640_100265032 100
380 3300025981 Ga0207640_10210994 Ga0207640_102109942 100
381 3300026023 Ga0207677_11733089 Ga0207677_117330891 100
382 3300026041 Ga0207639_10003636 Ga0207639_100036366 100
383 3300026041 Ga0207639_10077304 Ga0207639_100773044 100
384 3300026041 Ga0207639_11751469 Ga0207639_117514692 100
385 3300026067 Ga0207678_10004209 Ga0207678_100042097 100
386 3300026067 Ga0207678_11458861 Ga0207678_114588612 100
387 3300026078 Ga0207702_10056450 Ga0207702_100564501 100
388 3300026078 Ga0207702_10132077 Ga0207702_101320774 100
389 3300026088 Ga0207641_10353318 Ga0207641_103533183 100
390 3300026116 Ga0207674_10049898 Ga0207674_100498983 100
391 3300026121 Ga0207683_10019962 Ga0207683_100199624 100
392 3300026142 Ga0207698_10000404 Ga0207698_100004045 100
393 3300026142 Ga0207698_10301865 Ga0207698_103018652 100
394 3300026142 Ga0207698_11569733 Ga0207698_115697331 100
395 3300028379 Ga0268266_10003466 Ga0268266_100034667 100
396 3300028380 Ga0268265_10838407 Ga0268265_108384072 100
397 3300028381 Ga0268264_10197719 Ga0268264_101977192 100
398 3300032004 Ga0307414_10330451 Ga0307414_103304512 100
399 3300032004 Ga0307414_11687693 Ga0307414_116876931 100
400 3300032005 Ga0307411_12000740 Ga0307411_120007402 100
401 3300037312 Ga0395899_0058868 Ga0395899_0058868_1405_1707 100
402 3300037418 Ga0395900_0093484 Ga0395900_0093484_2512_2820 100
403 3300037418 Ga0395900_1475869 Ga0395900_1475869_230_532 100
404 3300037466 Ga0395898_1165622 Ga0395898_1165622_112_414 100
405 3300037471 Ga0395905_0036479 Ga0395905_0036479_2094_2396 100
406 3300037471 Ga0395905_0103885 Ga0395905_0103885_2125_2433 100
407 3300037471 Ga0395905_0409354 Ga0395905_0409354_316_621 100
408 3300037853 Ga0436364_0184680 Ga0436364_0184680_260_574 100
409 3300038443 Ga0395901_0163929 Ga0395901_0163929_1487_1795 100
410 3300041404 Ga0439436_0053221 Ga0439436_0053221_358_675 100
411 3300041406 Ga0439439_0040773 Ga0439439_0040773_875_1177 100
412 3300041410 Ga0439461_0009372 Ga0439461_0009372_589_906 100
413 3300041411 Ga0439466_0060653 Ga0439466_0060653_305_622 100
414 3300041411 Ga0439466_0125618 Ga0439466_0125618_368_670 100
415 3300041413 Ga0439465_0006192 Ga0439465_0006192_3051_3368 100
416 3300041413 Ga0439465_0006371 Ga0439465_0006371_2674_2991 100
417 3300041443 Ga0451789_0553014 Ga0451789_0553014_232_534 100
418 3300041456 Ga0451795_1411884 Ga0451795_1411884_12_314 100
419 3300041491 Ga0451833_0807197 Ga0451833_0807197_125_436 100
420 3300041997 Ga0439431_0000427 Ga0439431_0000427_7672_7989 100
421 3300041997 Ga0439431_0020289 Ga0439431_0020289_862_1179 100
422 3300041997 Ga0439431_0108406 Ga0439431_0108406_118_420 100
423 3300042002 Ga0439442_009923 Ga0439442_009923_1369_1686 100
424 3300042004 Ga0439445_0002858 Ga0439445_0002858_436_753 100
425 3300042004 Ga0439445_0015374 Ga0439445_0015374_943_1260 100
426 3300042004 Ga0439445_0024172 Ga0439445_0024172_1070_1387 100
427 3300042004 Ga0439445_0026300 Ga0439445_0026300_179_481 100
428 3300042005 Ga0439448_0001347 Ga0439448_0001347_3995_4297 100
429 3300042005 Ga0439448_0022082 Ga0439448_0022082_1023_1325 100
430 3300042005 Ga0439448_0029731 Ga0439448_0029731_1261_1563 100
431 3300042006 Ga0439432_015958 Ga0439432_015958_1174_1491 100
432 3300042007 Ga0439449_0305722 Ga0439449_0305722_241_558 100
433 3300042008 Ga0439450_078111 Ga0439450_078111_85_387 100
434 3300042010 Ga0439452_013772 Ga0439452_013772_210_527 100
435 3300042012 Ga0439455_0001694 Ga0439455_0001694_579_881 100
436 3300042012 Ga0439455_0003084 Ga0439455_0003084_1017_1319 100
437 3300042012 Ga0439455_0004893 Ga0439455_0004893_1985_2287 100
438 3300042012 Ga0439455_0017039 Ga0439455_0017039_1034_1336 100
439 3300042015 Ga0439462_0059858 Ga0439462_0059858_483_800 100
440 3300042015 Ga0439462_0158330 Ga0439462_0158330_24_341 100
441 3300042157 Ga0439458_0000212 Ga0439458_0000212_8091_8393 100
442 3300042157 Ga0439458_0000552 Ga0439458_0000552_7550_7852 100
443 3300042157 Ga0439458_0000641 Ga0439458_0000641_1771_2079 100
444 3300042435 Ga0439434_0022902 Ga0439434_0022902_411_728 100
445 3300042435 Ga0439434_0024727 Ga0439434_0024727_350_667 100
446 3300042435 Ga0439434_0108064 Ga0439434_0108064_163_480 100
447 3300044694 Ga0466963_0104570 Ga0466963_0104570_1396_1701 100
448 3300045976 Ga0466967_0096341 Ga0466967_0096341_940_1242 100
449 3300046471 Ga0495650_0237181 Ga0495650_0237181_30_341 100
450 3300046507 Ga0495606_0128361 Ga0495606_0128361_82_384 100
451 3300046528 Ga0495642_0009737 Ga0495642_0009737_403_705 100
452 3300046694 Ga0495649_0285280 Ga0495649_0285280_101_403 100
453 3300046810 Ga0495660_0472722 Ga0495660_0472722_107_409 100
454 3300047443 Ga0495687_111976 Ga0495687_111976_423_725 100
455 3300047469 Ga0495673_0029088 Ga0495673_0029088_374_691 100
456 3300047472 Ga0495686_0001276 Ga0495686_0001276_11058_11360 100
457 3300048923 Ga0496120_0024742 Ga0496120_0024742_579_881 100
458 3300048924 Ga0496121_0024764 Ga0496121_0024764_3890_4192 100
459 3300048926 Ga0496123_0202751 Ga0496123_0202751_22_339 100
460 3300048928 Ga0496125_0309512 Ga0496125_0309512_213_530 100
461 3300049671 Ga0501238_077597 Ga0501238_077597_58_363 100
462 3300049742 Ga0501080_1019217 Ga0501080_1019217_303_605 100
463 3300049758 Ga0501241_004217 Ga0501241_004217_741_1043 100
464 3300049773 Ga0501276_015292 Ga0501276_015292_278_580 100
465 3300050496 nmdc:mga07m45_118528_c1 nmdc:mga07m45_118528_c1_473_775 100
466 3300053739 Ga0500587_001316 Ga0500587_001316_2112_2423 100

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

17

85

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kym-assembly1.cif.gz_B-2 crystal structure of the marr family transcriptional regulator from bradyrhizobium japonicum 0.916 12 84
5f7p-assembly1.cif.gz_A rok repressor lmo0178 from listeria monocytogenes 0.9063 13 56
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8918 12 76
5aiq-assembly2.cif.gz_B crystal structure of ligand-free nadr 0.8908 8 89
3f22-assembly2.cif.gz_C crystal structure of zalpha in complex with d(cgtacg) 0.8859 10 75
ID Description Score Start End Superfamily
3bp8A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8919 13 56 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8918 12 76 1.10.10.10
af_Q58088_26_109_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8915 9 84 1.10.10.10
5aipB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.882 8 89 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8787 7 74 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A520JQY9-F1-model_v4 PadR family transcriptional regulator 0.945 11 90
AF-A0A4P6FHT0-F1-model_v4 PadR family transcriptional regulator 0.9448 11 90
AF-A0A534P2N4-F1-model_v4 PadR family transcriptional regulator 0.9316 1 90
AF-A0A175XZQ0-F1-model_v4 Transcriptional regulator 0.9246 11 90
AF-A0A523F374-F1-model_v4 deleted 0.9192 5 90

Feature Viewer

pLDDT pTM Quality
83.13 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map