F449486

General Info

Members Datasets Scaffolds Average Seq Length
465 274 320 269

Family's Representative Sequence

Representative Sequence 3300015265|Ga0182005_1012312|Ga0182005_10123123
Length 310
Sequence MPRRVSKPDRLIIDPGRGAWCASAWIDCALQRRSPTWQGCLIVNAEALKDSEFKQFQSWLYRAAGINLSPAKKALVAGRLSKRLKHHQLNSYGDYFQMIMGHGATAELQIALDLLTTNETYFFREPKHFDFLRQQVLPKAAPGKIFRLWSAASSSGEEPYSLAMTLADGLGSTPWEIIGSDISSQVLAKARTGHYPIERASHIAQPLLARHCLKGTGSQEGTFLIERNLRSRVHFMPINLNESLPNIGEFEVIFLRNVMIYFDQETKRKVVARMLPLLKPGGYFIVSHSESLNGITDGLKLISPSIYRKP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
3 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
4 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
5 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
6 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
7 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
8 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
9 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
10 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
11 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
12 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
13 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
14 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
15 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
16 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
17 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
18 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
19 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
20 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
21 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
22 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
23 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
24 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
25 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
26 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
27 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
28 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
29 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
30 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
31 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
32 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
33 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
34 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
35 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
36 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
37 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
38 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
39 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
40 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
41 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
42 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
43 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
44 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
45 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
46 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
47 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
48 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
49 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
50 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
51 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
52 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
53 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
54 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
55 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
56 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
57 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
58 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
59 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
60 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
61 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
62 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
63 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
64 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
65 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
66 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
67 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
68 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
69 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
70 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
71 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
72 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
73 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
74 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
75 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
76 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
77 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
78 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
79 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
80 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
81 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
82 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
83 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
84 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
85 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
86 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
87 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
88 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
89 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
90 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
91 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
92 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
93 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
94 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
95 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
96 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
97 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
98 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
99 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
100 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
101 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
102 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
103 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
104 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
105 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
106 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
107 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
108 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
109 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
110 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
111 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
112 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
113 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
114 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
115 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
116 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
117 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
118 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
119 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
120 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
121 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
124 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
125 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
126 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
127 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
140 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
141 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
165 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
172 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
173 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
192 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
193 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
194 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
195 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
196 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
197 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
198 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
199 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
200 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
201 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
202 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
203 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
204 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
205 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
206 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
207 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
208 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
209 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
210 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
218 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
219 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
220 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
221 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
222 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
223 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
224 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
225 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
226 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
227 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
228 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
229 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
230 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
231 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
232 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
233 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
234 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
235 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
236 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
237 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
238 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
239 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
240 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
241 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
242 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
243 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
244 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
245 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
246 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
247 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
248 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
249 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
250 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
251 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
252 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
253 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
254 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
255 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
258 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
259 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
260 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
263 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
264 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
268 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
271 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
272 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
273 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
274 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.03
Metatranscriptomes 0
Isolates 30.97

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 1.94
Nodule 1.29
Rhizoplane 13.98
Rhizosphere 70.11
Stem 0
Stem Tuber 0
Unclassified 12.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3834392 2162886007 Bacteria 7000
2 rootH1_10396375 3300003323 Bacteria 1337
3 Ga0055540_1000358 3300003792 Bacteria 38808
4 Ga0065714_10003146 3300005288 Bacteria 15707
5 Ga0065714_10106188 3300005288 Bacteria 1553
6 Ga0065704_10000531 3300005289 Bacteria 21770
7 Ga0065704_10017805 3300005289 Bacteria 3350
8 Ga0065712_10078233 3300005290 Bacteria 3376
9 Ga0065712_10109001 3300005290 Bacteria 1863
10 Ga0070670_100000017 3300005331 Bacteria 224429
11 Ga0070670_100000250 3300005331 Bacteria 48480
12 Ga0070666_10037023 3300005335 Bacteria 3242
13 Ga0070661_100000091 3300005344 Bacteria 73554
14 Ga0070661_100000233 3300005344 Bacteria 46159
15 Ga0070669_100000322 3300005353 Bacteria 37474
16 Ga0070669_100000420 3300005353 Bacteria 32410
17 Ga0070671_100000173 3300005355 Bacteria 42660
18 Ga0070688_100004605 3300005365 Bacteria 7195
19 Ga0070667_100000203 3300005367 Bacteria 70031
20 Ga0070708_100344174 3300005445 Bacteria 1405
21 Ga0070662_100000227 3300005457 Bacteria 33126
22 Ga0070685_10000026 3300005466 Bacteria 98490
23 Ga0070706_100081992 3300005467 Bacteria 2988
24 Ga0068853_100000499 3300005539 Bacteria 26876
25 Ga0070665_100023167 3300005548 Bacteria 6254
26 Ga0070665_100114483 3300005548 Bacteria 2700
27 Ga0070664_100000053 3300005564 Bacteria 69415
28 Ga0070664_100000125 3300005564 Bacteria 51348
29 Ga0068854_100003662 3300005578 Bacteria 9614
30 Ga0068859_100140740 3300005617 Bacteria 2486
31 Ga0068864_100000029 3300005618 Bacteria 224429
32 Ga0068851_10000520 3300005834 Bacteria 16854
33 Ga0068863_100195325 3300005841 Bacteria 1945
34 Ga0068858_100010971 3300005842 Bacteria 8562
35 Ga0068860_100010514 3300005843 Bacteria 9150
36 Ga0068862_100005773 3300005844 Bacteria 10321
37 Ga0075364_10085575 3300006051 Bacteria 2088
38 Ga0075370_10139669 3300006353 Bacteria 1416
39 Ga0097620_100140744 3300006931 Bacteria 2486
40 Ga0079104_1000041 3300006946 Bacteria 186297
41 Ga0079104_1018239 3300006946 Unclassified 1994
42 Ga0099826_10046540 3300006948 Bacteria 2955
43 Ga0105251_10006241 3300009011 Bacteria 7641
44 Ga0105251_10008253 3300009011 Bacteria 6294
45 Ga0105251_10031786 3300009011 Bacteria 2637
46 Ga0105244_10000756 3300009036 Bacteria 27613
47 Ga0105244_10006204 3300009036 Bacteria 7795
48 Ga0105244_10012788 3300009036 Bacteria 4948
49 Ga0105244_10017346 3300009036 Bacteria 4070
50 Ga0105250_10000015 3300009092 Bacteria 262683
51 Ga0105250_10000199 3300009092 Bacteria 51075
52 Ga0105242_10001830 3300009176 Bacteria 16700
53 Ga0105242_10008757 3300009176 Bacteria 7764
54 Ga0105248_10109156 3300009177 Bacteria 3119
55 Ga0105248_10126883 3300009177 Bacteria 2878
56 Ga0105237_10000455 3300009545 Bacteria 58035
57 Ga0105237_10001233 3300009545 Bacteria 34098
58 Ga0105237_10202372 3300009545 Bacteria 1986
59 Ga0157373_10003737 3300013100 Bacteria 11514
60 Ga0157373_10077612 3300013100 Bacteria 2343
61 Ga0157370_10009977 3300013104 Bacteria 10048
62 Ga0157370_10044630 3300013104 Bacteria 4258
63 Ga0157370_10152668 3300013104 Bacteria 2149
64 Ga0157369_10001081 3300013105 Bacteria 34115
65 Ga0157369_10014068 3300013105 Bacteria 9040
66 Ga0157369_10020695 3300013105 Bacteria 7355
67 Ga0157374_10002026 3300013296 Bacteria 17007
68 Ga0163162_10171998 3300013306 Bacteria 2291
69 Ga0163162_10295191 3300013306 Bacteria 1752
70 Ga0157372_10817918 3300013307 Bacteria 1082
71 Ga0157375_10000996 3300013308 Bacteria 24450
72 Ga0157375_10117609 3300013308 Bacteria 2764
73 Ga0163163_10000658 3300014325 Bacteria 29560
74 Ga0182008_10102569 3300014497 Bacteria 1415
75 Ga0182008_10105011 3300014497 Bacteria 1397
76 Ga0182006_1000143 3300015261 Bacteria 76634
77 Ga0182006_1000842 3300015261 Bacteria 20632
78 Ga0182006_1057790 3300015261 Bacteria 1473
79 Ga0182005_1012312 3300015265 Bacteria 2418
80 Ga0163161_10000581 3300017792 Bacteria 29441
81 Ga0163161_10045934 3300017792 Bacteria 3150
82 Ga0163161_10130399 3300017792 Bacteria 1896
83 Ga0209050_1000009 3300025298 Bacteria 1047265
84 Ga0209051_1000438 3300025303 Bacteria 56435
85 Ga0209257_1004767 3300025304 Bacteria 10124
86 Ga0207656_10000410 3300025321 Bacteria 14409
87 Ga0207696_1000090 3300025711 Bacteria 188474
88 Ga0207696_1000176 3300025711 Bacteria 100134
89 Ga0207696_1000177 3300025711 Bacteria 100134
90 Ga0207696_1000371 3300025711 Bacteria 44425
91 Ga0207655_1000006 3300025728 Bacteria 861092
92 Ga0207655_1000390 3300025728 Bacteria 61299
93 Ga0207655_1000457 3300025728 Bacteria 53535
94 Ga0207713_1001136 3300025735 Bacteria 22587
95 Ga0207680_10318459 3300025903 Bacteria 1087
96 Ga0207684_10107458 3300025910 Bacteria 2387
97 Ga0207671_10001022 3300025914 Bacteria 34106
98 Ga0207671_10001360 3300025914 Bacteria 28567
99 Ga0207649_10000095 3300025920 Bacteria 73954
100 Ga0207649_10000375 3300025920 Bacteria 33434
101 Ga0207681_10000401 3300025923 Bacteria 30136
102 Ga0207681_10000936 3300025923 Bacteria 19006
103 Ga0207650_10000003 3300025925 Bacteria 1123235
104 Ga0207650_10000727 3300025925 Bacteria 25549
105 Ga0207644_10000057 3300025931 Bacteria 83320
106 Ga0207706_10000501 3300025933 Bacteria 41713
107 Ga0207711_10000472 3300025941 Bacteria 41502
108 Ga0207679_10000008 3300025945 Bacteria 412057
109 Ga0207679_10000180 3300025945 Bacteria 52169
110 Ga0207679_10065275 3300025945 Bacteria 2723
111 Ga0207640_10050878 3300025981 Bacteria 2690
112 Ga0207658_10000012 3300025986 Bacteria 224402
113 Ga0207639_10208583 3300026041 Bacteria 1680
114 Ga0207676_10000003 3300026095 Bacteria 1123235
115 Ga0209281_1000073 3300027111 Bacteria 269036
116 Ga0209371_1007889 3300027312 Bacteria 3622
117 Ga0209282_1062416 3300027666 Bacteria 2069
118 Ga0268266_10044960 3300028379 Bacteria 3775
119 Ga0268266_10196838 3300028379 Bacteria 1843
120 Ga0268265_10001254 3300028380 Bacteria 21916
121 Ga0268264_10000009 3300028381 Bacteria 724972
122 Ga0307515_10000188 3300028794 Bacteria 151439
123 Ga0268256_1008175 3300030500 Bacteria 3622
124 Ga0314311_1257646 3300030733 Bacteria 2755
125 Ga0265328_10002140 3300031239 Bacteria 8914
126 Ga0265328_10015079 3300031239 Bacteria 3033
127 Ga0265325_10187418 3300031241 Bacteria 960
128 Ga0265340_10001854 3300031247 Bacteria 12060
129 Ga0265331_10000390 3300031250 Bacteria 45388
130 Ga0265331_10081617 3300031250 Bacteria 1501
131 Ga0265327_10000085 3300031251 Bacteria 203068
132 Ga0265327_10000721 3300031251 Bacteria 51910
133 Ga0265327_10000859 3300031251 Bacteria 45360
134 Ga0265327_10001585 3300031251 Bacteria 27716
135 Ga0265327_10004037 3300031251 Bacteria 13331
136 Ga0265327_10020519 3300031251 Bacteria 4022
137 Ga0265327_10056602 3300031251 Unclassified 2020
138 Ga0265327_10088683 3300031251 Bacteria 1512
139 Ga0265316_10025563 3300031344 Bacteria 4926
140 Ga0265316_10130663 3300031344 Bacteria 1892
141 Ga0307408_100000465 3300031548 Bacteria 35428
142 Ga0307408_100025889 3300031548 Bacteria 4021
143 Ga0307408_100051972 3300031548 Bacteria 2954
144 Ga0307514_10147400 3300031649 Bacteria 1587
145 Ga0307405_10000149 3300031731 Bacteria 26581
146 Ga0307405_10011196 3300031731 Bacteria 4685
147 Ga0307405_10060372 3300031731 Bacteria 2392
148 Ga0307405_10103358 3300031731 Bacteria 1915
149 Ga0307413_10020257 3300031824 Bacteria 3533
150 Ga0307406_10020661 3300031901 Bacteria 3881
151 Ga0307406_10459393 3300031901 Bacteria 1023
152 Ga0307407_10037215 3300031903 Bacteria 2687
153 Ga0307407_10336175 3300031903 Bacteria 1065
154 Ga0307412_10006494 3300031911 Bacteria 6615
155 Ga0307412_10009858 3300031911 Bacteria 5489
156 Ga0307412_10029013 3300031911 Bacteria 3468
157 Ga0307409_100049451 3300031995 Bacteria 3206
158 Ga0307414_10081528 3300032004 Bacteria 2369
159 Ga0307414_10085831 3300032004 Bacteria 2320
160 Ga0307411_10023258 3300032005 Bacteria 3667
161 Ga0307411_10090203 3300032005 Bacteria 2137
162 Ga0307411_10315837 3300032005 Bacteria 1259
163 Ga0373927_0009450 3300035695 Bacteria 6539
164 Ga0395905_0002481 3300037471 Bacteria 20416
165 Ga0439438_000073 3300041405 Bacteria 46619
166 Ga0439438_004269 3300041405 Bacteria 5545
167 Ga0439438_012785 3300041405 Bacteria 2558
168 Ga0439438_014856 3300041405 Bacteria 2307
169 Ga0439447_000031 3300041407 Bacteria 49687
170 Ga0439447_007014 3300041407 Bacteria 3610
171 Ga0439453_0016751 3300041408 Bacteria 1281
172 Ga0439466_0000288 3300041411 Bacteria 19602
173 Ga0439466_0000477 3300041411 Bacteria 15276
174 Ga0439466_0000740 3300041411 Bacteria 12372
175 Ga0439466_0014041 3300041411 Bacteria 2923
176 Ga0439466_0031131 3300041411 Bacteria 1826
177 Ga0439431_0003418 3300041997 Bacteria 3495
178 Ga0439437_000096 3300042000 Bacteria 6473
179 Ga0439432_000025 3300042006 Bacteria 50525
180 Ga0439432_011151 3300042006 Bacteria 3097
181 Ga0439432_020094 3300042006 Bacteria 2222
182 Ga0439432_020717 3300042006 Bacteria 2183
183 Ga0439432_024088 3300042006 Bacteria 2001
184 Ga0439452_000155 3300042010 Bacteria 50710
185 Ga0439452_005043 3300042010 Bacteria 4311
186 Ga0439452_041699 3300042010 Bacteria 1078
187 Ga0439456_001031 3300042013 Bacteria 5532
188 Ga0450911_000007 3300042115 Bacteria 212322
189 Ga0450913_001782 3300042117 Bacteria 1240
190 Ga0450894_002072 3300042131 Bacteria 2752
191 Ga0450898_000017 3300042134 Bacteria 13617
192 Ga0450899_003376 3300042135 Bacteria 1718
193 Ga0439446_0000014 3300042156 Bacteria 39067
194 Ga0439446_0001805 3300042156 Bacteria 4996
195 Ga0439446_0022668 3300042156 Bacteria 1781
196 Ga0439434_0006003 3300042435 Bacteria 3545
197 Ga0439459_0004302 3300042438 Bacteria 2287
198 Ga0439464_0040481 3300042439 Bacteria 1327
199 Ga0450916_000020 3300042530 Bacteria 7935
200 Ga0450916_002541 3300042530 Bacteria 1947
201 Ga0450893_0000299 3300042532 Bacteria 6826
202 Ga0451577_0000395 3300042876 Bacteria 80169
203 Ga0451577_0319831 3300042876 Bacteria 1407
204 Ga0466969_0016994 3300044656 Bacteria 3801
205 Ga0466961_0005920 3300044693 Bacteria 7749
206 Ga0453684_0000354 3300044712 Bacteria 190599
207 Ga0453684_0001464 3300044712 Bacteria 66894
208 Ga0453684_0001598 3300044712 Bacteria 62237
209 Ga0453684_0291227 3300044712 Bacteria 1859
210 Ga0453684_0791515 3300044712 Bacteria 1023
211 Ga0453684_0923786 3300044712 Bacteria 933
212 Ga0453684_1160364 3300044712 Bacteria 813
213 Ga0466959_0176299 3300045049 Bacteria 1497
214 Ga0451576_0000013 3300045051 Bacteria 665120
215 Ga0451576_0195917 3300045051 Bacteria 2110
216 Ga0495617_012890 3300046452 Bacteria 2849
217 Ga0495617_038755 3300046452 Bacteria 1594
218 Ga0495627_000009 3300046453 Bacteria 463964
219 Ga0495627_024961 3300046453 Bacteria 1942
220 Ga0495591_000002 3300046458 Bacteria 455013
221 Ga0495591_006456 3300046458 Bacteria 5184
222 Ga0495591_013161 3300046458 Bacteria 3042
223 Ga0495650_0010305 3300046471 Bacteria 5225
224 Ga0495605_0000007 3300046474 Bacteria 358289
225 Ga0495605_0001110 3300046474 Bacteria 17928
226 Ga0495605_0001750 3300046474 Bacteria 13910
227 Ga0495605_0005366 3300046474 Bacteria 7468
228 Ga0495605_0075218 3300046474 Bacteria 1588
229 Ga0495584_0000134 3300046491 Bacteria 50765
230 Ga0495584_0001249 3300046491 Bacteria 15526
231 Ga0495584_0074378 3300046491 Bacteria 1707
232 Ga0495607_0000045 3300046501 Bacteria 125217
233 Ga0495607_0002449 3300046501 Bacteria 15097
234 Ga0495607_0004589 3300046501 Bacteria 10120
235 Ga0495607_0006369 3300046501 Bacteria 8312
236 Ga0495583_0000007 3300046506 Bacteria 434661
237 Ga0495606_0003629 3300046507 Bacteria 16209
238 Ga0495606_0015798 3300046507 Bacteria 5794
239 Ga0495606_0091505 3300046507 Bacteria 1870
240 Ga0495610_0026211 3300046512 Bacteria 3115
241 Ga0495610_0105880 3300046512 Bacteria 1253
242 Ga0495616_0004719 3300046513 Bacteria 8542
243 Ga0495620_0000014 3300046515 Bacteria 157890
244 Ga0495620_0012299 3300046515 Bacteria 4431
245 Ga0495631_0000733 3300046518 Bacteria 21060
246 Ga0495631_0066536 3300046518 Bacteria 1559
247 Ga0495632_0013988 3300046519 Bacteria 4557
248 Ga0495637_0013802 3300046520 Bacteria 3827
249 Ga0495637_0014617 3300046520 Bacteria 3700
250 Ga0495637_0034998 3300046520 Bacteria 2196
251 Ga0495643_0002331 3300046522 Bacteria 15255
252 Ga0495648_0033129 3300046524 Bacteria 3379
253 Ga0495654_0004087 3300046530 Bacteria 8757
254 Ga0495654_0009834 3300046530 Bacteria 5226
255 Ga0495609_0000004 3300046538 Bacteria 697346
256 Ga0495609_0062141 3300046538 Bacteria 1649
257 Ga0495597_0000023 3300046542 Bacteria 149302
258 Ga0495633_0000135 3300046558 Bacteria 97871
259 Ga0495633_0001755 3300046558 Bacteria 16096
260 Ga0495668_0083309 3300046616 Bacteria 1754
261 Ga0495611_0001820 3300046648 Bacteria 10221
262 Ga0495625_0004716 3300046660 Bacteria 12765
263 Ga0495625_0123207 3300046660 Bacteria 1762
264 Ga0495661_0000106 3300046665 Bacteria 100351
265 Ga0495661_0057454 3300046665 Bacteria 2323
266 Ga0495661_0107847 3300046665 Bacteria 1556
267 Ga0495671_0000212 3300046692 Bacteria 50878
268 Ga0495671_0010183 3300046692 Bacteria 5223
269 Ga0495671_0052163 3300046692 Bacteria 2033
270 Ga0495649_0000030 3300046694 Bacteria 152164
271 Ga0495649_0054362 3300046694 Bacteria 2165
272 Ga0495589_0000966 3300046794 Bacteria 17567
273 Ga0495589_0117649 3300046794 Bacteria 1280
274 Ga0495660_0000560 3300046810 Bacteria 30334
275 Ga0495660_0001006 3300046810 Bacteria 20524
276 Ga0495660_0191247 3300046810 Bacteria 983
277 Ga0495672_0001668 3300047320 Bacteria 21529
278 Ga0495672_0101301 3300047320 Bacteria 1561
279 Ga0495683_0000004 3300047323 Bacteria 321136
280 Ga0495683_0000924 3300047323 Bacteria 20706
281 Ga0495679_006593 3300047446 Bacteria 4971
282 Ga0495673_0000198 3300047469 Bacteria 93985
283 Ga0495673_0000400 3300047469 Bacteria 50787
284 Ga0495673_0005159 3300047469 Bacteria 7958
285 Ga0495681_0002504 3300047470 Bacteria 13088
286 Ga0495686_0090922 3300047472 Bacteria 1853
287 Ga0495626_0000355 3300048091 Bacteria 47898
288 Ga0496117_0013153 3300048920 Bacteria 7238
289 Ga0496118_0014910 3300048921 Bacteria 7238
290 Ga0496120_0034130 3300048923 Bacteria 3051
291 Ga0496121_0192983 3300048924 Bacteria 1458
292 Ga0496122_0012130 3300048925 Bacteria 8629
293 Ga0496122_0054517 3300048925 Bacteria 3002
294 Ga0496122_0107874 3300048925 Bacteria 1838
295 Ga0496123_0043768 3300048926 Bacteria 3070
296 Ga0496123_0046916 3300048926 Bacteria 2924
297 Ga0496124_0000035 3300048927 Bacteria 318099
298 Ga0496124_0004476 3300048927 Bacteria 16305
299 Ga0496124_0025869 3300048927 Bacteria 5304
300 Ga0496124_0040811 3300048927 Bacteria 4010
301 Ga0496125_0002115 3300048928 Bacteria 26689
302 Ga0496125_0011521 3300048928 Bacteria 8835
303 Ga0496125_0017443 3300048928 Bacteria 6843
304 Ga0496125_0018446 3300048928 Bacteria 6626
305 Ga0496126_0002105 3300048929 Bacteria 27873
306 Ga0496126_0002519 3300048929 Bacteria 24534
307 Ga0496126_0058687 3300048929 Bacteria 3468
308 Ga0496126_0221759 3300048929 Bacteria 1588
309 Ga0495678_000014 3300049459 Bacteria 313755
310 Ga0495678_001501 3300049459 Bacteria 18158
311 Ga0495678_001568 3300049459 Bacteria 17564
312 Ga0495682_0009853 3300049460 Bacteria 3719
313 Ga0501033_0201011 3300049570 Bacteria 1423
314 Ga0501034_0059282 3300049571 Bacteria 3845
315 Ga0501038_0104416 3300049574 Bacteria 2355
316 Ga0501209_000080 3300049656 Bacteria 9592
317 Ga0501226_000022 3300049853 Bacteria 111874
318 nmdc:mga07m45_128063_c1 3300050496 Bacteria 1468
319 Ga0500650_0000319 3300053098 Bacteria 11594
320 Ga0500595_025070 3300053119 Bacteria 2074

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031251 Ga0265327_10001585 Ga0265327_100015857 235
2 3300031251 Ga0265327_10056602 Ga0265327_100566022 235
3 3300044712 Ga0453684_1160364 Ga0453684_1160364_12_722 235
4 iso_pu_bacteria 2894510363 2894514560 247
5 3300044656 Ga0466969_0016994 Ga0466969_0016994_2248_3006 250
6 3300044693 Ga0466961_0005920 Ga0466961_0005920_5704_6462 250
7 3300045049 Ga0466959_0176299 Ga0466959_0176299_472_1230 250
8 3300046660 Ga0495625_0123207 Ga0495625_0123207_821_1597 258
9 iso_pu_bacteria 2511231156 2511825545 261
10 iso_pu_bacteria 2599185212 2599614262 261
11 iso_pu_bacteria 2599185248 2599768696 261
12 iso_pu_bacteria 2599185288 2599881515 261
13 iso_pu_bacteria 2599185289 2599884450 261
14 iso_pu_bacteria 2599185291 2599896371 261
15 iso_pu_bacteria 2599185302 2599941370 261
16 iso_pu_bacteria 2599185303 2599946486 261
17 iso_pu_bacteria 2599185304 2599953110 261
18 iso_pu_bacteria 2599185305 2599958278 261
19 iso_pu_bacteria 2599185309 2599982637 261
20 iso_pu_bacteria 2599185310 2599989762 261
21 iso_pu_bacteria 2599185312 2599998658 261
22 iso_pu_bacteria 2599185313 2600003657 261
23 iso_pu_bacteria 2599185315 2600015980 261
24 iso_pu_bacteria 2599185317 2600029359 261
25 iso_pu_bacteria 2599185318 2600036147 261
26 iso_pu_bacteria 2599185319 2600040852 261
27 iso_pu_bacteria 2599185320 2600047338 261
28 iso_pu_bacteria 2599185321 2600051186 261
29 iso_pu_bacteria 2599185322 2600059650 261
30 iso_pu_bacteria 2599185323 2600065804 261
31 iso_pu_bacteria 2599185324 2600069292 261
32 iso_pu_bacteria 2600254930 2600358734 261
33 iso_pu_bacteria 2619619299 2621300618 261
34 iso_pu_bacteria 2643221571 2643870209 261
35 iso_pu_bacteria 2643221650 2644280958 261
36 iso_pu_bacteria 2667528170 2671089066 261
37 iso_pu_bacteria 2667528176 2671126729 261
38 iso_pu_bacteria 2738541265 2738673282 261
39 iso_pu_bacteria 2738541282 2738751675 261
40 iso_pu_bacteria 2738541294 2738810702 261
41 iso_pu_bacteria 2738541303 2738860716 261
42 iso_pu_bacteria 2738541309 2738898062 261
43 iso_pu_bacteria 2808606385 2808980664 261
44 iso_pu_bacteria 2808606388 2808996385 261
45 iso_pu_bacteria 2816332298 2817490122 261
46 iso_pu_bacteria 2825651385 2825652419 261
47 iso_pu_bacteria 2852612431 2852614675 261
48 iso_pu_bacteria 2852667396 2852667587 261
49 iso_pu_bacteria 2913036834 2913039079 261
50 iso_pu_bacteria 2947233263 2947237176 261
51 iso_pu_bacteria 2510065053 2510285165 262
52 iso_pu_bacteria 2510065055 2510293998 262
53 iso_pu_bacteria 2510065058 2510313032 262
54 iso_pu_bacteria 2599185306 2599964110 262
55 iso_pu_bacteria 2599185308 2599976408 262
56 iso_pu_bacteria 2599185314 2600009820 262
57 iso_pu_bacteria 2643221639 2644222526 262
58 iso_pu_bacteria 2773857672 2774128256 262
59 iso_pu_bacteria 2808606361 2808855269 262
60 iso_pu_bacteria 2808606376 2808922991 262
61 iso_pu_bacteria 2808606378 2808935155 262
62 iso_pu_bacteria 2808606380 2808945135 262
63 iso_pu_bacteria 2808606382 2808960974 262
64 iso_pu_bacteria 2808606383 2808963774 262
65 iso_pu_bacteria 2808606389 2808998662 262
66 iso_pu_bacteria 2852657418 2852660167 262
67 iso_pu_bacteria 2917832318 2917835387 262
68 iso_pu_bacteria 2919125081 2919129276 262
69 iso_pu_bacteria 2974298342 2974299587 262
70 iso_pu_bacteria 2984499530 2984501943 262
71 iso_pu_bacteria 2984504281 2984504561 262
72 iso_pu_bacteria 3007419365 3007422433 262
73 iso_pu_bacteria 8016728285 8016733628 262
74 3300046491 Ga0495584_0000134 Ga0495584_0000134_39752_40546 264
75 3300046692 Ga0495671_0000212 Ga0495671_0000212_39790_40584 264
76 3300046810 Ga0495660_0000560 Ga0495660_0000560_12639_13433 264
77 3300047469 Ga0495673_0000400 Ga0495673_0000400_10321_11115 264
78 3300049459 Ga0495678_001568 Ga0495678_001568_3840_4634 264
79 iso_pu_bacteria 2619619299 2621300632 264
80 iso_pu_bacteria 2738541265 2738673296 264
81 iso_pu_bacteria 2738541282 2738751689 264
82 iso_pu_bacteria 2738541303 2738860730 264
83 iso_pu_bacteria 2808606379 2808943507 264
84 iso_pu_bacteria 2816332298 2817490108 264
85 iso_pu_bacteria 2919456309 2919456751 264
86 iso_pu_bacteria 2919481497 2919485182 264
87 iso_pu_bacteria 2923586266 2923586681 264
88 3300005288 Ga0065714_10003146 Ga0065714_100031465 265
89 3300005290 Ga0065712_10078233 Ga0065712_100782333 265
90 3300005344 Ga0070661_100000233 Ga0070661_10000023314 265
91 3300005564 Ga0070664_100000125 Ga0070664_10000012529 265
92 3300006051 Ga0075364_10085575 Ga0075364_100855753 265
93 3300009011 Ga0105251_10006241 Ga0105251_100062414 265
94 3300009011 Ga0105251_10031786 Ga0105251_100317864 265
95 3300009036 Ga0105244_10000756 Ga0105244_1000075610 265
96 3300009092 Ga0105250_10000015 Ga0105250_1000001516 265
97 3300009176 Ga0105242_10001830 Ga0105242_1000183010 265
98 3300009545 Ga0105237_10001233 Ga0105237_1000123314 265
99 3300013100 Ga0157373_10003737 Ga0157373_100037377 265
100 3300013104 Ga0157370_10009977 Ga0157370_100099773 265
101 3300013105 Ga0157369_10001081 Ga0157369_1000108117 265
102 3300013306 Ga0163162_10295191 Ga0163162_102951911 265
103 3300013308 Ga0157375_10000996 Ga0157375_100009968 265
104 3300014497 Ga0182008_10105011 Ga0182008_101050112 265
105 3300015261 Ga0182006_1000143 Ga0182006_100014358 265
106 3300015261 Ga0182006_1000842 Ga0182006_10008427 265
107 3300017792 Ga0163161_10000581 Ga0163161_1000058116 265
108 3300025711 Ga0207696_1000371 Ga0207696_100037116 265
109 3300025728 Ga0207655_1000390 Ga0207655_100039022 265
110 3300025735 Ga0207713_1001136 Ga0207713_100113613 265
111 3300025914 Ga0207671_10001022 Ga0207671_1000102217 265
112 3300025920 Ga0207649_10000375 Ga0207649_1000037514 265
113 3300025945 Ga0207679_10000180 Ga0207679_1000018015 265
114 3300031239 Ga0265328_10015079 Ga0265328_100150792 265
115 3300031251 Ga0265327_10000085 Ga0265327_10000085155 265
116 3300031731 Ga0307405_10000149 Ga0307405_100001496 265
117 3300041405 Ga0439438_014856 Ga0439438_014856_1064_1861 265
118 3300042006 Ga0439432_020094 Ga0439432_020094_1216_2013 265
119 3300042010 Ga0439452_041699 Ga0439452_041699_208_1005 265
120 3300042131 Ga0450894_002072 Ga0450894_002072_80_883 265
121 3300042134 Ga0450898_000017 Ga0450898_000017_12204_13007 265
122 3300042135 Ga0450899_003376 Ga0450899_003376_138_941 265
123 3300046507 Ga0495606_0003629 Ga0495606_0003629_12273_13076 265
124 3300048920 Ga0496117_0013153 Ga0496117_0013153_5638_6441 265
125 3300048921 Ga0496118_0014910 Ga0496118_0014910_5638_6441 265
126 3300048923 Ga0496120_0034130 Ga0496120_0034130_2082_2885 265
127 3300048924 Ga0496121_0192983 Ga0496121_0192983_88_891 265
128 3300048925 Ga0496122_0054517 Ga0496122_0054517_1626_2429 265
129 3300048925 Ga0496122_0107874 Ga0496122_0107874_439_1242 265
130 3300048926 Ga0496123_0046916 Ga0496123_0046916_29_832 265
131 3300048927 Ga0496124_0004476 Ga0496124_0004476_14577_15380 265
132 3300048928 Ga0496125_0002115 Ga0496125_0002115_12351_13154 265
133 3300048929 Ga0496126_0002105 Ga0496126_0002105_6920_7723 265
134 3300048929 Ga0496126_0002519 Ga0496126_0002519_2225_3028 265
135 3300048929 Ga0496126_0221759 Ga0496126_0221759_134_937 265
136 iso_pu_bacteria 2599185167 2599399792 265
137 iso_pu_bacteria 2599185179 2599454492 265
138 iso_pu_bacteria 2599185190 2599515665 265
139 iso_pu_bacteria 2599185191 2599522228 265
140 iso_pu_bacteria 2599185288 2599880711 265
141 iso_pu_bacteria 2599185290 2599895043 265
142 iso_pu_bacteria 2599185303 2599949762 265
143 iso_pu_bacteria 2675903420 2677899705 265
144 iso_pu_bacteria 2738541271 2738687836 265
145 iso_pu_bacteria 2738541294 2738806168 265
146 iso_pu_bacteria 2738541309 2738893528 265
147 iso_pu_bacteria 2738543016 2739263729 265
148 iso_pu_bacteria 2808606385 2808980311 265
149 iso_pu_bacteria 2808606388 2808996032 265
150 iso_pu_bacteria 2852612431 2852613907 265
151 iso_pu_bacteria 2852667396 2852668357 265
152 iso_pu_bacteria 2931390751 2931395662 265
153 iso_pu_bacteria 3007419365 3007422447 265
154 iso_pu_bacteria 8054285046 8054290904 265
155 3300006353 Ga0075370_10139669 Ga0075370_101396692 266
156 3300009036 Ga0105244_10012788 Ga0105244_100127883 266
157 3300013105 Ga0157369_10014068 Ga0157369_100140683 266
158 3300013307 Ga0157372_10817918 Ga0157372_108179182 266
159 3300027312 Ga0209371_1007889 Ga0209371_10078893 266
160 3300030500 Ga0268256_1008175 Ga0268256_10081753 266
161 3300037471 Ga0395905_0002481 Ga0395905_0002481_11604_12407 266
162 3300041405 Ga0439438_000073 Ga0439438_000073_33025_33831 266
163 3300041407 Ga0439447_000031 Ga0439447_000031_15972_16778 266
164 3300041411 Ga0439466_0000477 Ga0439466_0000477_10553_11359 266
165 3300041411 Ga0439466_0000740 Ga0439466_0000740_375_1181 266
166 3300042006 Ga0439432_000025 Ga0439432_000025_43502_44308 266
167 3300042006 Ga0439432_011151 Ga0439432_011151_362_1168 266
168 3300042010 Ga0439452_000155 Ga0439452_000155_34875_35681 266
169 3300042010 Ga0439452_005043 Ga0439452_005043_3132_3938 266
170 3300042156 Ga0439446_0000014 Ga0439446_0000014_3556_4362 266
171 3300046474 Ga0495605_0001110 Ga0495605_0001110_13062_13868 266
172 3300046474 Ga0495605_0075218 Ga0495605_0075218_70_876 266
173 3300046491 Ga0495584_0001249 Ga0495584_0001249_4096_4902 266
174 3300046519 Ga0495632_0013988 Ga0495632_0013988_231_1037 266
175 3300046522 Ga0495643_0002331 Ga0495643_0002331_4374_5180 266
176 3300046694 Ga0495649_0000030 Ga0495649_0000030_77616_78422 266
177 3300047320 Ga0495672_0001668 Ga0495672_0001668_10076_10882 266
178 3300048091 Ga0495626_0000355 Ga0495626_0000355_36441_37247 266
179 3300049459 Ga0495678_001501 Ga0495678_001501_13257_14063 266
180 3300050496 nmdc:mga07m45_128063_c1 nmdc:mga07m45_128063_c1_103_906 266
181 3300005331 Ga0070670_100000017 Ga0070670_100000017157 267
182 3300005335 Ga0070666_10037023 Ga0070666_100370234 267
183 3300005353 Ga0070669_100000420 Ga0070669_10000042019 267
184 3300005355 Ga0070671_100000173 Ga0070671_10000017321 267
185 3300005365 Ga0070688_100004605 Ga0070688_1000046057 267
186 3300005367 Ga0070667_100000203 Ga0070667_1000002035 267
187 3300005445 Ga0070708_100344174 Ga0070708_1003441742 267
188 3300005466 Ga0070685_10000026 Ga0070685_1000002620 267
189 3300005467 Ga0070706_100081992 Ga0070706_1000819922 267
190 3300005548 Ga0070665_100023167 Ga0070665_1000231674 267
191 3300005617 Ga0068859_100140740 Ga0068859_1001407403 267
192 3300005618 Ga0068864_100000029 Ga0068864_10000002957 267
193 3300005841 Ga0068863_100195325 Ga0068863_1001953253 267
194 3300005842 Ga0068858_100010971 Ga0068858_1000109717 267
195 3300005843 Ga0068860_100010514 Ga0068860_1000105147 267
196 3300005844 Ga0068862_100005773 Ga0068862_1000057737 267
197 3300006931 Ga0097620_100140744 Ga0097620_1001407443 267
198 3300006946 Ga0079104_1018239 Ga0079104_10182392 267
199 3300009177 Ga0105248_10126883 Ga0105248_101268832 267
200 3300013306 Ga0163162_10171998 Ga0163162_101719983 267
201 3300014325 Ga0163163_10000658 Ga0163163_100006584 267
202 3300025903 Ga0207680_10318459 Ga0207680_103184592 267
203 3300025910 Ga0207684_10107458 Ga0207684_101074583 267
204 3300025923 Ga0207681_10000936 Ga0207681_1000093614 267
205 3300025925 Ga0207650_10000003 Ga0207650_1000000357 267
206 3300025931 Ga0207644_10000057 Ga0207644_100000576 267
207 3300025941 Ga0207711_10000472 Ga0207711_1000047233 267
208 3300025986 Ga0207658_10000012 Ga0207658_1000001257 267
209 3300026095 Ga0207676_10000003 Ga0207676_100000031038 267
210 3300028379 Ga0268266_10044960 Ga0268266_100449604 267
211 3300028380 Ga0268265_10001254 Ga0268265_1000125411 267
212 3300028381 Ga0268264_10000009 Ga0268264_10000009581 267
213 3300031250 Ga0265331_10081617 Ga0265331_100816173 267
214 3300031251 Ga0265327_10000721 Ga0265327_1000072116 267
215 3300048928 Ga0496125_0018446 Ga0496125_0018446_2096_2902 267
216 3300049570 Ga0501033_0201011 Ga0501033_0201011_250_1059 267
217 3300049571 Ga0501034_0059282 Ga0501034_0059282_2798_3607 267
218 3300049574 Ga0501038_0104416 Ga0501038_0104416_1304_2113 267
219 3300053098 Ga0500650_0000319 Ga0500650_0000319_1521_2327 267
220 3300053119 Ga0500595_025070 Ga0500595_025070_1162_1965 267
221 3300031251 Ga0265327_10020519 Ga0265327_100205194 268
222 3300031344 Ga0265316_10130663 Ga0265316_101306632 268
223 3300041408 Ga0439453_0016751 Ga0439453_0016751_207_1016 268
224 3300041411 Ga0439466_0000288 Ga0439466_0000288_8453_9259 268
225 3300041997 Ga0439431_0003418 Ga0439431_0003418_1902_2711 268
226 3300042000 Ga0439437_000096 Ga0439437_000096_5230_6039 268
227 3300042013 Ga0439456_001031 Ga0439456_001031_523_1332 268
228 3300042115 Ga0450911_000007 Ga0450911_000007_79870_80679 268
229 3300042117 Ga0450913_001782 Ga0450913_001782_200_1009 268
230 3300042156 Ga0439446_0022668 Ga0439446_0022668_200_1009 268
231 3300042438 Ga0439459_0004302 Ga0439459_0004302_848_1657 268
232 3300042439 Ga0439464_0040481 Ga0439464_0040481_270_1079 268
233 3300042530 Ga0450916_002541 Ga0450916_002541_643_1452 268
234 3300042532 Ga0450893_0000299 Ga0450893_0000299_2053_2862 268
235 3300044712 Ga0453684_0923786 Ga0453684_0923786_105_914 268
236 3300046452 Ga0495617_038755 Ga0495617_038755_466_1272 268
237 3300046453 Ga0495627_000009 Ga0495627_000009_157863_158669 268
238 3300046453 Ga0495627_024961 Ga0495627_024961_1010_1816 268
239 3300046458 Ga0495591_000002 Ga0495591_000002_56231_57037 268
240 3300046458 Ga0495591_013161 Ga0495591_013161_514_1320 268
241 3300046474 Ga0495605_0000007 Ga0495605_0000007_312147_312953 268
242 3300046474 Ga0495605_0005366 Ga0495605_0005366_5612_6418 268
243 3300046501 Ga0495607_0000045 Ga0495607_0000045_49617_50423 268
244 3300046501 Ga0495607_0002449 Ga0495607_0002449_900_1706 268
245 3300046501 Ga0495607_0004589 Ga0495607_0004589_2282_3088 268
246 3300046506 Ga0495583_0000007 Ga0495583_0000007_270612_271418 268
247 3300046507 Ga0495606_0091505 Ga0495606_0091505_361_1167 268
248 3300046512 Ga0495610_0026211 Ga0495610_0026211_1668_2474 268
249 3300046515 Ga0495620_0000014 Ga0495620_0000014_105399_106205 268
250 3300046518 Ga0495631_0066536 Ga0495631_0066536_98_904 268
251 3300046520 Ga0495637_0013802 Ga0495637_0013802_1004_1810 268
252 3300046520 Ga0495637_0034998 Ga0495637_0034998_480_1286 268
253 3300046530 Ga0495654_0004087 Ga0495654_0004087_635_1441 268
254 3300046538 Ga0495609_0000004 Ga0495609_0000004_314372_315178 268
255 3300046538 Ga0495609_0062141 Ga0495609_0062141_181_987 268
256 3300046542 Ga0495597_0000023 Ga0495597_0000023_49335_50141 268
257 3300046558 Ga0495633_0000135 Ga0495633_0000135_1205_2011 268
258 3300046558 Ga0495633_0001755 Ga0495633_0001755_7356_8162 268
259 3300046616 Ga0495668_0083309 Ga0495668_0083309_733_1539 268
260 3300046648 Ga0495611_0001820 Ga0495611_0001820_1244_2050 268
261 3300046665 Ga0495661_0000106 Ga0495661_0000106_8444_9250 268
262 3300046665 Ga0495661_0057454 Ga0495661_0057454_671_1477 268
263 3300046692 Ga0495671_0010183 Ga0495671_0010183_1082_1888 268
264 3300046692 Ga0495671_0052163 Ga0495671_0052163_23_829 268
265 3300046794 Ga0495589_0000966 Ga0495589_0000966_2806_3612 268
266 3300046810 Ga0495660_0001006 Ga0495660_0001006_10190_10996 268
267 3300046810 Ga0495660_0191247 Ga0495660_0191247_46_852 268
268 3300047320 Ga0495672_0101301 Ga0495672_0101301_87_893 268
269 3300047323 Ga0495683_0000004 Ga0495683_0000004_110154_110960 268
270 3300047446 Ga0495679_006593 Ga0495679_006593_2865_3671 268
271 3300047469 Ga0495673_0000198 Ga0495673_0000198_85166_85972 268
272 3300047469 Ga0495673_0005159 Ga0495673_0005159_121_927 268
273 3300048925 Ga0496122_0012130 Ga0496122_0012130_6737_7543 268
274 3300048926 Ga0496123_0043768 Ga0496123_0043768_1021_1827 268
275 3300048929 Ga0496126_0002105 Ga0496126_0002105_22921_23727 268
276 3300049459 Ga0495678_000014 Ga0495678_000014_203424_204230 268
277 3300003323 rootH1_10396375 rootH1_103963752 269
278 3300005288 Ga0065714_10106188 Ga0065714_101061882 269
279 3300005289 Ga0065704_10017805 Ga0065704_100178053 269
280 3300005290 Ga0065712_10109001 Ga0065712_101090012 269
281 3300005331 Ga0070670_100000250 Ga0070670_10000025048 269
282 3300005344 Ga0070661_100000091 Ga0070661_10000009156 269
283 3300005353 Ga0070669_100000322 Ga0070669_10000032232 269
284 3300005457 Ga0070662_100000227 Ga0070662_10000022728 269
285 3300005539 Ga0068853_100000499 Ga0068853_10000049919 269
286 3300005548 Ga0070665_100114483 Ga0070665_1001144832 269
287 3300005564 Ga0070664_100000053 Ga0070664_10000005310 269
288 3300005578 Ga0068854_100003662 Ga0068854_1000036624 269
289 3300005834 Ga0068851_10000520 Ga0068851_1000052010 269
290 3300009011 Ga0105251_10008253 Ga0105251_100082536 269
291 3300009036 Ga0105244_10006204 Ga0105244_100062045 269
292 3300009036 Ga0105244_10017346 Ga0105244_100173463 269
293 3300009092 Ga0105250_10000199 Ga0105250_100001998 269
294 3300009176 Ga0105242_10008757 Ga0105242_100087573 269
295 3300009177 Ga0105248_10109156 Ga0105248_101091563 269
296 3300009545 Ga0105237_10000455 Ga0105237_1000045513 269
297 3300009545 Ga0105237_10202372 Ga0105237_102023722 269
298 3300013100 Ga0157373_10077612 Ga0157373_100776123 269
299 3300013104 Ga0157370_10044630 Ga0157370_100446304 269
300 3300013105 Ga0157369_10020695 Ga0157369_100206953 269
301 3300013308 Ga0157375_10117609 Ga0157375_101176093 269
302 3300017792 Ga0163161_10045934 Ga0163161_100459343 269
303 3300017792 Ga0163161_10130399 Ga0163161_101303992 269
304 3300025321 Ga0207656_10000410 Ga0207656_1000041010 269
305 3300025711 Ga0207696_1000090 Ga0207696_1000090120 269
306 3300025711 Ga0207696_1000176 Ga0207696_10001768 269
307 3300025711 Ga0207696_1000177 Ga0207696_1000177101 269
308 3300025728 Ga0207655_1000006 Ga0207655_100000624 269
309 3300025728 Ga0207655_1000457 Ga0207655_100045734 269
310 3300025914 Ga0207671_10001360 Ga0207671_1000136013 269
311 3300025920 Ga0207649_10000095 Ga0207649_100000958 269
312 3300025923 Ga0207681_10000401 Ga0207681_1000040118 269
313 3300025925 Ga0207650_10000727 Ga0207650_1000072713 269
314 3300025933 Ga0207706_10000501 Ga0207706_1000050136 269
315 3300025945 Ga0207679_10000008 Ga0207679_1000000855 269
316 3300025945 Ga0207679_10065275 Ga0207679_100652752 269
317 3300025981 Ga0207640_10050878 Ga0207640_100508784 269
318 3300026041 Ga0207639_10208583 Ga0207639_102085832 269
319 3300028379 Ga0268266_10196838 Ga0268266_101968383 269
320 3300031251 Ga0265327_10088683 Ga0265327_100886832 269
321 3300031344 Ga0265316_10025563 Ga0265316_100255636 269
322 3300031649 Ga0307514_10147400 Ga0307514_101474002 269
323 3300042530 Ga0450916_000020 Ga0450916_000020_3544_4356 269
324 3300044712 Ga0453684_0291227 Ga0453684_0291227_359_1174 269
325 3300045051 Ga0451576_0195917 Ga0451576_0195917_301_1116 269
326 3300048927 Ga0496124_0000035 Ga0496124_0000035_189091_189900 269
327 3300048927 Ga0496124_0040811 Ga0496124_0040811_603_1412 269
328 3300048928 Ga0496125_0011521 Ga0496125_0011521_1130_1939 269
329 3300049460 Ga0495682_0009853 Ga0495682_0009853_251_1084 269
330 3300049853 Ga0501226_000022 Ga0501226_000022_19942_20754 269
331 3300013104 Ga0157370_10152668 Ga0157370_101526683 270
332 3300013296 Ga0157374_10002026 Ga0157374_1000202611 270
333 3300014497 Ga0182008_10102569 Ga0182008_101025692 270
334 3300028794 Ga0307515_10000188 Ga0307515_100001886 270
335 3300031241 Ga0265325_10187418 Ga0265325_101874181 270
336 3300044712 Ga0453684_0791515 Ga0453684_0791515_19_840 270
337 3300046452 Ga0495617_012890 Ga0495617_012890_1954_2766 270
338 3300046458 Ga0495591_006456 Ga0495591_006456_95_907 270
339 3300046471 Ga0495650_0010305 Ga0495650_0010305_3163_3975 270
340 3300046474 Ga0495605_0001750 Ga0495605_0001750_8943_9755 270
341 3300046491 Ga0495584_0074378 Ga0495584_0074378_728_1540 270
342 3300046501 Ga0495607_0006369 Ga0495607_0006369_4284_5096 270
343 3300046507 Ga0495606_0015798 Ga0495606_0015798_1657_2469 270
344 3300046512 Ga0495610_0105880 Ga0495610_0105880_239_1051 270
345 3300046513 Ga0495616_0004719 Ga0495616_0004719_3737_4549 270
346 3300046515 Ga0495620_0012299 Ga0495620_0012299_994_1806 270
347 3300046518 Ga0495631_0000733 Ga0495631_0000733_15766_16578 270
348 3300046520 Ga0495637_0014617 Ga0495637_0014617_1070_1882 270
349 3300046524 Ga0495648_0033129 Ga0495648_0033129_47_859 270
350 3300046530 Ga0495654_0009834 Ga0495654_0009834_405_1217 270
351 3300046660 Ga0495625_0004716 Ga0495625_0004716_2137_2949 270
352 3300046665 Ga0495661_0107847 Ga0495661_0107847_62_874 270
353 3300046694 Ga0495649_0054362 Ga0495649_0054362_28_840 270
354 3300046794 Ga0495589_0117649 Ga0495589_0117649_27_839 270
355 3300047323 Ga0495683_0000924 Ga0495683_0000924_15539_16351 270
356 3300047470 Ga0495681_0002504 Ga0495681_0002504_4313_5125 270
357 3300047472 Ga0495686_0090922 Ga0495686_0090922_153_965 270
358 3300048927 Ga0496124_0025869 Ga0496124_0025869_3882_4694 270
359 3300048928 Ga0496125_0017443 Ga0496125_0017443_4467_5279 270
360 3300031239 Ga0265328_10002140 Ga0265328_100021407 271
361 3300031250 Ga0265331_10000390 Ga0265331_1000039012 271
362 3300031251 Ga0265327_10000859 Ga0265327_1000085912 271
363 3300031247 Ga0265340_10001854 Ga0265340_100018547 272
364 3300035695 Ga0373927_0009450 Ga0373927_0009450_1145_2035 272
365 3300045051 Ga0451576_0000013 Ga0451576_0000013_52206_53033 272
366 3300042876 Ga0451577_0000395 Ga0451577_0000395_74195_75019 273
367 3300044712 Ga0453684_0001464 Ga0453684_0001464_20868_21692 273
368 3300031251 Ga0265327_10004037 Ga0265327_1000403710 274
369 3300042876 Ga0451577_0319831 Ga0451577_0319831_197_1111 274
370 3300044712 Ga0453684_0000354 Ga0453684_0000354_111768_112682 274
371 3300048929 Ga0496126_0058687 Ga0496126_0058687_1219_2046 274
372 3300049656 Ga0501209_000080 Ga0501209_000080_5008_5835 274
373 iso_pu_bacteria 2511231156 2511824277 274
374 iso_pu_bacteria 2599185212 2599611142 274
375 iso_pu_bacteria 2599185248 2599770036 274
376 iso_pu_bacteria 2599185289 2599887360 274
377 iso_pu_bacteria 2599185291 2599898475 274
378 iso_pu_bacteria 2599185300 2599932835 274
379 iso_pu_bacteria 2599185302 2599942591 274
380 iso_pu_bacteria 2599185304 2599953340 274
381 iso_pu_bacteria 2599185305 2599958934 274
382 iso_pu_bacteria 2599185306 2599968988 274
383 iso_pu_bacteria 2599185308 2599980245 274
384 iso_pu_bacteria 2599185309 2599982486 274
385 iso_pu_bacteria 2599185310 2599992218 274
386 iso_pu_bacteria 2599185311 2599994476 274
387 iso_pu_bacteria 2599185312 2599999321 274
388 iso_pu_bacteria 2599185313 2600006072 274
389 iso_pu_bacteria 2599185314 2600009445 274
390 iso_pu_bacteria 2599185315 2600017222 274
391 iso_pu_bacteria 2599185316 2600023411 274
392 iso_pu_bacteria 2599185317 2600028319 274
393 iso_pu_bacteria 2599185318 2600035680 274
394 iso_pu_bacteria 2599185319 2600044954 274
395 iso_pu_bacteria 2599185320 2600047156 274
396 iso_pu_bacteria 2599185321 2600052045 274
397 iso_pu_bacteria 2599185322 2600057084 274
398 iso_pu_bacteria 2599185323 2600064995 274
399 iso_pu_bacteria 2599185324 2600069737 274
400 iso_pu_bacteria 2599185325 2600077432 274
401 iso_pu_bacteria 2600254930 2600357232 274
402 iso_pu_bacteria 2643221650 2644284751 274
403 iso_pu_bacteria 2651869719 2652546378 274
404 iso_pu_bacteria 2667528170 2671090967 274
405 iso_pu_bacteria 2667528176 2671124715 274
406 iso_pu_bacteria 2675903515 2678263992 274
407 iso_pu_bacteria 2744054620 2745004448 274
408 iso_pu_bacteria 2791355520 2794597879 274
409 iso_pu_bacteria 2808606361 2808854800 274
410 iso_pu_bacteria 2808606376 2808925155 274
411 iso_pu_bacteria 2808606378 2808935005 274
412 iso_pu_bacteria 2808606380 2808947239 274
413 iso_pu_bacteria 2808606383 2808963402 274
414 iso_pu_bacteria 2808606389 2808998193 274
415 iso_pu_bacteria 2825651385 2825657229 274
416 iso_pu_bacteria 2842854478 2842859924 274
417 iso_pu_bacteria 2913036834 2913039167 274
418 iso_pu_bacteria 2929144301 2929146443 274
419 iso_pu_bacteria 2931369376 2931369885 274
420 iso_pu_bacteria 2988728565 2988729558 274
421 iso_pu_bacteria 3007866637 3007869823 274
422 iso_pu_bacteria 8056143049 8056145462 274
423 3300015265 Ga0182005_1012312 Ga0182005_10123123 275
424 3300041405 Ga0439438_004269 Ga0439438_004269_958_1821 275
425 3300041407 Ga0439447_007014 Ga0439447_007014_1896_2759 275
426 3300041411 Ga0439466_0014041 Ga0439466_0014041_485_1348 275
427 3300042006 Ga0439432_020717 Ga0439432_020717_778_1641 275
428 3300042156 Ga0439446_0001805 Ga0439446_0001805_956_1819 275
429 3300042435 Ga0439434_0006003 Ga0439434_0006003_1958_2821 275
430 3300044712 Ga0453684_0001598 Ga0453684_0001598_971_1846 277
431 2162886007 SwRhRL2b_contig_3834392 SwRhRL2b_0986.00006240 278
432 3300003792 Ga0055540_1000358 Ga0055540_100035829 278
433 3300005289 Ga0065704_10000531 Ga0065704_100005318 278
434 3300006946 Ga0079104_1000041 Ga0079104_100004182 278
435 3300006948 Ga0099826_10046540 Ga0099826_100465403 278
436 3300015261 Ga0182006_1057790 Ga0182006_10577902 278
437 3300025298 Ga0209050_1000009 Ga0209050_1000009912 278
438 3300025303 Ga0209051_1000438 Ga0209051_100043821 278
439 3300025304 Ga0209257_1004767 Ga0209257_10047677 278
440 3300027111 Ga0209281_1000073 Ga0209281_100007382 278
441 3300027666 Ga0209282_1062416 Ga0209282_10624163 278
442 3300030733 Ga0314311_1257646 Ga0314311_12576463 278
443 3300031548 Ga0307408_100000465 Ga0307408_10000046542 278
444 3300031548 Ga0307408_100025889 Ga0307408_1000258896 278
445 3300031548 Ga0307408_100051972 Ga0307408_1000519723 278
446 3300031731 Ga0307405_10011196 Ga0307405_100111963 278
447 3300031731 Ga0307405_10060372 Ga0307405_100603723 278
448 3300031731 Ga0307405_10103358 Ga0307405_101033582 278
449 3300031824 Ga0307413_10020257 Ga0307413_100202573 278
450 3300031901 Ga0307406_10020661 Ga0307406_100206613 278
451 3300031901 Ga0307406_10459393 Ga0307406_104593932 278
452 3300031903 Ga0307407_10037215 Ga0307407_100372153 278
453 3300031903 Ga0307407_10336175 Ga0307407_103361751 278
454 3300031911 Ga0307412_10006494 Ga0307412_100064946 278
455 3300031911 Ga0307412_10009858 Ga0307412_100098583 278
456 3300031911 Ga0307412_10029013 Ga0307412_100290133 278
457 3300031995 Ga0307409_100049451 Ga0307409_1000494513 278
458 3300032004 Ga0307414_10081528 Ga0307414_100815282 278
459 3300032004 Ga0307414_10085831 Ga0307414_100858313 278
460 3300032005 Ga0307411_10023258 Ga0307411_100232584 278
461 3300032005 Ga0307411_10090203 Ga0307411_100902032 278
462 3300032005 Ga0307411_10315837 Ga0307411_103158372 278
463 3300041405 Ga0439438_012785 Ga0439438_012785_1177_2013 278
464 3300041411 Ga0439466_0031131 Ga0439466_0031131_679_1515 278
465 3300042006 Ga0439432_024088 Ga0439432_024088_487_1323 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03705

CheR_N

CheR methyltransferase, all-alpha domain

51

103

0.96

PF01739

CheR

CheR methyltransferase, SAM binding domain

118

307

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bc5-assembly1.cif.gz_A chemotaxis receptor recognition by protein methyltransferase cher 0.9237 14 278
5xlx-assembly1.cif.gz_D crystal structure of the c-terminal domain of cher1 containing sah 0.9139 88 278
1bc5-assembly1.cif.gz_A chemotaxis receptor recognition by protein methyltransferase cher 0.9073 14 278
5xlx-assembly1.cif.gz_D crystal structure of the c-terminal domain of cher1 containing sah 0.8661 88 278
5ftw-assembly1.cif.gz_A crystal structure of glutamate o-methyltransferase in complex with s- adenosyl-l-homocysteine (sah) from bacillus subtilis 0.8239 20 278
ID Description Score Start End Superfamily
1af7A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9396 85 278 3.40.50.150
1af7A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.935 85 278 3.40.50.150
5ftwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9115 86 278 3.40.50.150
5ftwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9024 86 278 3.40.50.150
1bc5A01 Mainly Alpha;Orthogonal Bundle;Chemotaxis Receptor Methyltransferase Cher; domain 1;Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.8978 14 84 1.10.155.10
ID Description Score Start End GO Terms
AF-A0A3M5LP99-F1-model_v4 Chemotaxis protein methyltransferase CheR 0.9934 104 278 GO:0008757
GO:0009288
GO:0032259
AF-A0A1J5PH97-F1-model_v4 Chemotaxis protein methyltransferase (EC 2.1.1.80) 0.9867 134 278 GO:0008983
GO:0032259
AF-A0A349L650-F1-model_v4 SAM-dependent methyltransferase 0.9831 109 278 GO:0008757
GO:0032259
AF-A0A080M6H3-F1-model_v4 Chemotaxis protein methyltransferase (EC 2.1.1.80) 0.9823 131 278 GO:0008983
GO:0032259
AF-A0A8B3G486-F1-model_v4 protein-glutamate O-methyltransferase (EC 2.1.1.80) 0.9804 15 243 GO:0008757
GO:0032259

Feature Viewer

pLDDT pTM Quality
90.99 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map