F449355

General Info

Members Datasets Scaffolds Average Seq Length
464 222 928 123

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0850134|Ga0495630_0850134_173_538
Length 121
Sequence MIRQIAPQFFTADVPRTLAWYKDKLGFDCLGTWQDPPVYAIVARDRQAIHFRCADPAVQIAKYEEELLDAYFHVEDADALYAEFAANGVDFTRRPADMPWHSREFVVKDCDGRLLAFGSQI

Samples

Sample ID Description Type Environment
1 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
168 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.23
Rhizosphere 93.53
Stem 0
Stem Tuber 0
Unclassified 29.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495630_0850134 3300046517 Bacteria 696
2 rootH1_10296731 3300003323 Bacteria 3280
3 rootH1_10305078 3300003323 Bacteria 1832
4 Ga0058863_10839963 3300004799 Bacteria 505
5 Ga0065715_10007766 3300005293 Bacteria 3270
6 Ga0065715_10329644 3300005293 Unclassified 986
7 Ga0065715_10999841 3300005293 Unclassified 536
8 Ga0065707_10462265 3300005295 Unclassified 790
9 Ga0065707_10649489 3300005295 Unclassified 664
10 Ga0070658_10836696 3300005327 Bacteria 800
11 Ga0070676_11017933 3300005328 Bacteria 622
12 Ga0070683_100022705 3300005329 Bacteria 5611
13 Ga0070683_100136702 3300005329 Unclassified 2321
14 Ga0070683_100334139 3300005329 Bacteria 1443
15 Ga0070683_100366438 3300005329 Bacteria 1372
16 Ga0068869_100380481 3300005334 Bacteria 1157
17 Ga0068869_100486150 3300005334 Unclassified 1029
18 Ga0070666_10037266 3300005335 Bacteria 3232
19 Ga0070666_10327963 3300005335 Bacteria 1093
20 Ga0070682_100229045 3300005337 Bacteria 1327
21 Ga0070682_100571216 3300005337 Bacteria 888
22 Ga0068868_100182453 3300005338 Unclassified 1742
23 Ga0068868_100326868 3300005338 Bacteria 1308
24 Ga0068868_100622346 3300005338 Bacteria 958
25 Ga0068868_100734037 3300005338 Unclassified 886
26 Ga0070660_100039279 3300005339 Unclassified 3597
27 Ga0070661_100004826 3300005344 Bacteria 9280
28 Ga0070661_100102549 3300005344 Bacteria 2130
29 Ga0070668_101794320 3300005347 Unclassified 564
30 Ga0070675_100746967 3300005354 Bacteria 893
31 Ga0070671_100196919 3300005355 Bacteria 1708
32 Ga0070671_100612920 3300005355 Bacteria 941
33 Ga0070671_101653835 3300005355 Bacteria 568
34 Ga0070673_100377866 3300005364 Bacteria 1263
35 Ga0070688_100452600 3300005365 Bacteria 960
36 Ga0070659_100212867 3300005366 Bacteria 1593
37 Ga0070667_100029891 3300005367 Bacteria 4542
38 Ga0070667_100124749 3300005367 Bacteria 2243
39 Ga0070667_100337803 3300005367 Bacteria 1362
40 Ga0070667_100690390 3300005367 Unclassified 944
41 Ga0070709_10325819 3300005434 Bacteria 1129
42 Ga0070709_10674524 3300005434 Unclassified 802
43 Ga0070709_11550515 3300005434 Unclassified 539
44 Ga0070714_100131586 3300005435 Bacteria 2236
45 Ga0070714_101446484 3300005435 Bacteria 671
46 Ga0070713_101107684 3300005436 Unclassified 765
47 Ga0070710_10421654 3300005437 Bacteria 899
48 Ga0070710_10782918 3300005437 Unclassified 680
49 Ga0070711_100070304 3300005439 Unclassified 2464
50 Ga0070711_100073950 3300005439 Bacteria 2410
51 Ga0070711_100486327 3300005439 Unclassified 1015
52 Ga0070711_100567113 3300005439 Bacteria 943
53 Ga0070708_100187305 3300005445 Bacteria 1935
54 Ga0070663_101998907 3300005455 Bacteria 522
55 Ga0070678_100029160 3300005456 Bacteria 3776
56 Ga0070678_100175698 3300005456 Bacteria 1748
57 Ga0070681_11015941 3300005458 Unclassified 749
58 Ga0068867_101765936 3300005459 Bacteria 581
59 Ga0070707_100132584 3300005468 Bacteria 2423
60 Ga0070679_100015557 3300005530 Bacteria 7310
61 Ga0070679_100520608 3300005530 Unclassified 1133
62 Ga0070679_101561130 3300005530 Bacteria 607
63 Ga0070684_100072974 3300005535 Unclassified 3023
64 Ga0070684_100313307 3300005535 Unclassified 1441
65 Ga0070684_102125566 3300005535 Unclassified 530
66 Ga0068853_100002475 3300005539 Bacteria 13835
67 Ga0068853_100021095 3300005539 Bacteria 5424
68 Ga0068853_100029271 3300005539 Bacteria 4641
69 Ga0068853_100043881 3300005539 Bacteria 3826
70 Ga0068853_100045783 3300005539 Unclassified 3749
71 Ga0068853_100242767 3300005539 Bacteria 1651
72 Ga0068853_100446227 3300005539 Bacteria 1216
73 Ga0068853_101702966 3300005539 Unclassified 611
74 Ga0070672_100099274 3300005543 Bacteria 2359
75 Ga0070665_100144449 3300005548 Bacteria 2383
76 Ga0070665_100415118 3300005548 Bacteria 1355
77 Ga0070665_101198299 3300005548 Unclassified 770
78 Ga0070665_101585963 3300005548 Bacteria 662
79 Ga0070704_101161965 3300005549 Unclassified 703
80 Ga0068855_100010381 3300005563 Bacteria 11235
81 Ga0068855_100022897 3300005563 Bacteria 7487
82 Ga0068855_100055521 3300005563 Bacteria 4651
83 Ga0068855_100384847 3300005563 Bacteria 1540
84 Ga0068855_102183993 3300005563 Unclassified 556
85 Ga0070664_100255431 3300005564 Bacteria 1576
86 Ga0070664_100379546 3300005564 Unclassified 1290
87 Ga0070664_101144152 3300005564 Unclassified 734
88 Ga0068857_100012397 3300005577 Bacteria 7420
89 Ga0068857_100116080 3300005577 Unclassified 2408
90 Ga0068854_100042622 3300005578 Bacteria 3213
91 Ga0068854_100202550 3300005578 Bacteria 1561
92 Ga0068854_100392021 3300005578 Bacteria 1147
93 Ga0068854_100569573 3300005578 Unclassified 963
94 Ga0068856_100001537 3300005614 Bacteria 24181
95 Ga0068856_100006703 3300005614 Bacteria 11291
96 Ga0068856_100019393 3300005614 Bacteria 6601
97 Ga0068856_100180791 3300005614 Bacteria 2122
98 Ga0068856_100236169 3300005614 Bacteria 1843
99 Ga0068856_100276242 3300005614 Bacteria 1696
100 Ga0068856_100461915 3300005614 Unclassified 1290
101 Ga0068856_101114506 3300005614 Unclassified 806
102 Ga0068852_100000414 3300005616 Bacteria 28489
103 Ga0068852_100526419 3300005616 Unclassified 1180
104 Ga0068864_101154276 3300005618 Unclassified 772
105 Ga0068851_10020867 3300005834 Bacteria 3176
106 Ga0068851_10031435 3300005834 Bacteria 2637
107 Ga0068851_10058994 3300005834 Bacteria 1962
108 Ga0068863_100146131 3300005841 Bacteria 2261
109 Ga0068863_102572551 3300005841 Unclassified 518
110 Ga0068860_101124652 3300005843 Bacteria 805
111 Ga0068860_102831896 3300005843 Unclassified 503
112 Ga0068862_100085148 3300005844 Unclassified 2747
113 Ga0081455_10004203 3300005937 Bacteria 16225
114 Ga0081540_1001892 3300005983 Bacteria 17520
115 Ga0070717_10014231 3300006028 Bacteria 6117
116 Ga0070717_10246788 3300006028 Unclassified 1576
117 Ga0070716_100809556 3300006173 Unclassified 726
118 Ga0070712_100040999 3300006175 Unclassified 3176
119 Ga0070712_100646408 3300006175 Unclassified 898
120 Ga0097621_100030425 3300006237 Bacteria 4273
121 Ga0097621_100420654 3300006237 Bacteria 1199
122 Ga0097621_100871176 3300006237 Unclassified 837
123 Ga0097621_101907533 3300006237 Unclassified 567
124 Ga0068871_100050518 3300006358 Bacteria 3364
125 Ga0068871_100056046 3300006358 Bacteria 3202
126 Ga0075428_102204443 3300006844 Unclassified 568
127 Ga0075430_100009310 3300006846 Bacteria 8302
128 Ga0075431_100049764 3300006847 Bacteria 4321
129 Ga0075431_100099366 3300006847 Unclassified 3003
130 Ga0068865_100159586 3300006881 Bacteria 1719
131 Ga0075436_100096367 3300006914 Unclassified 2058
132 Ga0075436_100111214 3300006914 Bacteria 1912
133 Ga0099794_10524915 3300007265 Unclassified 624
134 Ga0099795_10265526 3300007788 Bacteria 745
135 Ga0105250_10034793 3300009092 Unclassified 2021
136 Ga0105240_10019961 3300009093 Bacteria 8948
137 Ga0105240_10025512 3300009093 Bacteria 7765
138 Ga0105240_10204593 3300009093 Bacteria 2311
139 Ga0105240_10314652 3300009093 Unclassified 1786
140 Ga0105240_10635327 3300009093 Bacteria 1172
141 Ga0105240_11656020 3300009093 Bacteria 669
142 Ga0105240_12089711 3300009093 Unclassified 588
143 Ga0111539_11193127 3300009094 Bacteria 884
144 Ga0105245_10097300 3300009098 Bacteria 2718
145 Ga0105247_10213858 3300009101 Bacteria 1301
146 Ga0114129_10480473 3300009147 Bacteria 1626
147 Ga0105243_10898287 3300009148 Unclassified 881
148 Ga0105241_10010987 3300009174 Bacteria 6639
149 Ga0105241_10092186 3300009174 Bacteria 2392
150 Ga0105241_10131145 3300009174 Bacteria 2029
151 Ga0105241_10289992 3300009174 Bacteria 1401
152 Ga0105241_11716835 3300009174 Bacteria 610
153 Ga0105241_12577768 3300009174 Unclassified 510
154 Ga0105242_10157079 3300009176 Bacteria 1988
155 Ga0105242_11424304 3300009176 Unclassified 721
156 Ga0105242_12939476 3300009176 Bacteria 527
157 Ga0105248_10405197 3300009177 Unclassified 1536
158 Ga0105248_10475469 3300009177 Bacteria 1409
159 Ga0105248_10685022 3300009177 Unclassified 1156
160 Ga0105248_10938726 3300009177 Unclassified 977
161 Ga0105248_11888607 3300009177 Bacteria 678
162 Ga0105237_10000665 3300009545 Bacteria 47532
163 Ga0105237_10091395 3300009545 Bacteria 3033
164 Ga0105237_10306826 3300009545 Unclassified 1590
165 Ga0105237_10430311 3300009545 Unclassified 1325
166 Ga0105237_10699419 3300009545 Unclassified 1020
167 Ga0105237_11407620 3300009545 Unclassified 704
168 Ga0105238_10000049 3300009551 Bacteria 145016
169 Ga0105238_10047230 3300009551 Unclassified 4343
170 Ga0105238_10221658 3300009551 Bacteria 1867
171 Ga0105238_11362406 3300009551 Bacteria 736
172 Ga0105249_10223494 3300009553 Unclassified 1854
173 Ga0099796_10126665 3300010159 Bacteria 986
174 Ga0105239_10007274 3300010375 Bacteria 12713
175 Ga0105239_12397077 3300010375 Unclassified 615
176 Ga0105239_12461419 3300010375 Unclassified 606
177 Ga0105239_13632648 3300010375 Unclassified 501
178 Ga0105246_10188709 3300011119 Bacteria 1594
179 Ga0105246_10425341 3300011119 Bacteria 1110
180 Ga0157373_10127261 3300013100 Bacteria 1791
181 Ga0157373_10328695 3300013100 Bacteria 1088
182 Ga0157373_10527813 3300013100 Bacteria 854
183 Ga0157373_10616020 3300013100 Unclassified 791
184 Ga0157370_10446954 3300013104 Bacteria 1188
185 Ga0157369_10008100 3300013105 Bacteria 12046
186 Ga0157369_10008769 3300013105 Bacteria 11585
187 Ga0157369_10053499 3300013105 Bacteria 4363
188 Ga0157369_10087027 3300013105 Bacteria 3336
189 Ga0157369_10119301 3300013105 Bacteria 2799
190 Ga0157369_10155762 3300013105 Bacteria 2413
191 Ga0157369_10229736 3300013105 Unclassified 1940
192 Ga0157369_10812082 3300013105 Bacteria 961
193 Ga0157369_11828239 3300013105 Unclassified 617
194 Ga0157374_10003780 3300013296 Bacteria 12736
195 Ga0157374_10080410 3300013296 Unclassified 3091
196 Ga0157374_10145768 3300013296 Bacteria 2299
197 Ga0157374_10523184 3300013296 Unclassified 1192
198 Ga0157374_10572300 3300013296 Unclassified 1138
199 Ga0157374_11094266 3300013296 Bacteria 817
200 Ga0157378_10167615 3300013297 Bacteria 2058
201 Ga0157378_10247962 3300013297 Bacteria 1704
202 Ga0157378_12011528 3300013297 Unclassified 628
203 Ga0163162_10017561 3300013306 Bacteria 7002
204 Ga0163162_10534821 3300013306 Bacteria 1301
205 Ga0163162_10758630 3300013306 Bacteria 1089
206 Ga0163162_11791737 3300013306 Bacteria 702
207 Ga0163162_12734869 3300013306 Unclassified 568
208 Ga0157372_10002082 3300013307 Bacteria 21731
209 Ga0157372_10002987 3300013307 Bacteria 18226
210 Ga0157372_10104341 3300013307 Bacteria 3240
211 Ga0157372_10210280 3300013307 Bacteria 2254
212 Ga0157372_10297337 3300013307 Bacteria 1878
213 Ga0157372_10780181 3300013307 Bacteria 1111
214 Ga0157372_10794310 3300013307 Bacteria 1100
215 Ga0157372_11789270 3300013307 Bacteria 706
216 Ga0157372_11826988 3300013307 Unclassified 699
217 Ga0157372_12671550 3300013307 Unclassified 573
218 Ga0157375_10352028 3300013308 Bacteria 1639
219 Ga0157375_10962355 3300013308 Unclassified 995
220 Ga0157375_11340284 3300013308 Bacteria 842
221 Ga0157375_12189633 3300013308 Unclassified 658
222 Ga0163163_10032768 3300014325 Bacteria 5021
223 Ga0163163_10041785 3300014325 Bacteria 4486
224 Ga0163163_10368070 3300014325 Bacteria 1494
225 Ga0163163_10620062 3300014325 Unclassified 1145
226 Ga0163163_10726384 3300014325 Unclassified 1057
227 Ga0157377_10133780 3300014745 Bacteria 1517
228 Ga0157377_10692350 3300014745 Bacteria 739
229 Ga0157377_11748260 3300014745 Bacteria 503
230 Ga0157379_10937474 3300014968 Unclassified 823
231 Ga0157376_10045013 3300014969 Bacteria 3631
232 Ga0157376_10056952 3300014969 Bacteria 3268
233 Ga0157376_10172579 3300014969 Bacteria 1970
234 Ga0157376_10752735 3300014969 Bacteria 984
235 Ga0157376_11117964 3300014969 Bacteria 814
236 Ga0163161_10099731 3300017792 Bacteria 2160
237 Ga0213872_10011818 3300021361 Bacteria 4126
238 Ga0213874_10109129 3300021377 Bacteria 928
239 Ga0213874_10205836 3300021377 Bacteria 710
240 Ga0213875_10008281 3300021388 Bacteria 5332
241 Ga0213871_10000510 3300021441 Bacteria 5341
242 Ga0207656_10323670 3300025321 Bacteria 766
243 Ga0207710_10386544 3300025900 Bacteria 717
244 Ga0207680_10242958 3300025903 Bacteria 1241
245 Ga0207680_10632110 3300025903 Unclassified 766
246 Ga0207647_10455438 3300025904 Unclassified 717
247 Ga0207685_10156850 3300025905 Unclassified 1035
248 Ga0207699_10157344 3300025906 Bacteria 1509
249 Ga0207645_10055691 3300025907 Bacteria 2525
250 Ga0207684_10023332 3300025910 Bacteria 5283
251 Ga0207654_10106581 3300025911 Bacteria 1736
252 Ga0207654_10485226 3300025911 Unclassified 871
253 Ga0207707_10115838 3300025912 Unclassified 2342
254 Ga0207695_10000154 3300025913 Bacteria 206200
255 Ga0207695_10041519 3300025913 Bacteria 4923
256 Ga0207695_10709756 3300025913 Unclassified 886
257 Ga0207671_10000220 3300025914 Bacteria 85769
258 Ga0207671_10384185 3300025914 Bacteria 1116
259 Ga0207671_11412185 3300025914 Unclassified 539
260 Ga0207693_10051389 3300025915 Bacteria 3234
261 Ga0207693_10351966 3300025915 Bacteria 1152
262 Ga0207693_10543152 3300025915 Bacteria 906
263 Ga0207663_10483565 3300025916 Bacteria 960
264 Ga0207663_10607109 3300025916 Bacteria 860
265 Ga0207660_10204882 3300025917 Bacteria 1542
266 Ga0207649_10002080 3300025920 Bacteria 11374
267 Ga0207649_10186162 3300025920 Bacteria 1457
268 Ga0207652_10022389 3300025921 Bacteria 5228
269 Ga0207652_10274693 3300025921 Bacteria 1520
270 Ga0207652_11188019 3300025921 Unclassified 664
271 Ga0207694_10000009 3300025924 Bacteria 460687
272 Ga0207694_10000040 3300025924 Bacteria 184281
273 Ga0207694_10000143 3300025924 Bacteria 74060
274 Ga0207694_10145486 3300025924 Unclassified 1908
275 Ga0207694_11226073 3300025924 Bacteria 635
276 Ga0207659_10089463 3300025926 Bacteria 2296
277 Ga0207700_10360193 3300025928 Bacteria 1268
278 Ga0207700_10980277 3300025928 Unclassified 756
279 Ga0207704_10251333 3300025938 Bacteria 1327
280 Ga0207704_10894136 3300025938 Bacteria 746
281 Ga0207665_10903346 3300025939 Unclassified 701
282 Ga0207691_10023770 3300025940 Bacteria 5768
283 Ga0207711_10137235 3300025941 Bacteria 2198
284 Ga0207711_10287325 3300025941 Bacteria 1515
285 Ga0207711_10689823 3300025941 Unclassified 952
286 Ga0207689_10073604 3300025942 Bacteria 2807
287 Ga0207661_10021136 3300025944 Bacteria 4876
288 Ga0207661_10143711 3300025944 Unclassified 2056
289 Ga0207679_10327318 3300025945 Bacteria 1329
290 Ga0207679_10550438 3300025945 Unclassified 1035
291 Ga0207679_10975609 3300025945 Bacteria 776
292 Ga0207667_10022854 3300025949 Bacteria 6897
293 Ga0207667_10087335 3300025949 Bacteria 3226
294 Ga0207667_10125239 3300025949 Unclassified 2646
295 Ga0207667_10554235 3300025949 Bacteria 1162
296 Ga0207651_10985585 3300025960 Bacteria 753
297 Ga0207712_10138626 3300025961 Bacteria 1863
298 Ga0207640_10011658 3300025981 Bacteria 4983
299 Ga0207640_11133691 3300025981 Bacteria 693
300 Ga0207640_11654224 3300025981 Unclassified 577
301 Ga0207677_10031147 3300026023 Bacteria 3414
302 Ga0207677_10151581 3300026023 Bacteria 1789
303 Ga0207703_10202305 3300026035 Bacteria 1765
304 Ga0207639_10001233 3300026041 Bacteria 17346
305 Ga0207639_10036190 3300026041 Bacteria 3657
306 Ga0207639_10037533 3300026041 Bacteria 3599
307 Ga0207639_10057236 3300026041 Unclassified 2992
308 Ga0207639_11903904 3300026041 Unclassified 556
309 Ga0207639_12081403 3300026041 Unclassified 529
310 Ga0207678_10419774 3300026067 Bacteria 1160
311 Ga0207702_10000675 3300026078 Bacteria 37100
312 Ga0207702_10016516 3300026078 Bacteria 6110
313 Ga0207702_10338053 3300026078 Bacteria 1438
314 Ga0207702_10520003 3300026078 Bacteria 1162
315 Ga0207641_10390827 3300026088 Bacteria 1334
316 Ga0207641_10909701 3300026088 Bacteria 874
317 Ga0207674_10000249 3300026116 Bacteria 67066
318 Ga0207674_12173377 3300026116 Bacteria 518
319 Ga0207675_100482932 3300026118 Unclassified 1232
320 Ga0207683_10111006 3300026121 Bacteria 2455
321 Ga0207683_10275572 3300026121 Unclassified 1537
322 Ga0207683_10314744 3300026121 Bacteria 1433
323 Ga0207698_10001122 3300026142 Bacteria 15598
324 Ga0207698_11031004 3300026142 Unclassified 834
325 Ga0268266_10498880 3300028379 Bacteria 1162
326 Ga0268266_11106004 3300028379 Bacteria 767
327 Ga0268265_10042507 3300028380 Unclassified 3373
328 Ga0268264_10077110 3300028381 Unclassified 2838
329 Ga0268264_10309716 3300028381 Bacteria 1489
330 Ga0265330_10315927 3300031235 Unclassified 659
331 Ga0265330_10416124 3300031235 Bacteria 569
332 Ga0265332_10382766 3300031238 Unclassified 581
333 Ga0265339_10047406 3300031249 Bacteria 2359
334 Ga0265339_10235328 3300031249 Bacteria 891
335 Ga0265331_10269307 3300031250 Unclassified 764
336 Ga0265316_10008129 3300031344 Bacteria 9770
337 Ga0265314_10673385 3300031711 Unclassified 526
338 Ga0265314_10725220 3300031711 Bacteria 501
339 Ga0265342_10138264 3300031712 Bacteria 1360
340 Ga0307416_102490835 3300032002 Bacteria 616
341 Ga0307416_102984924 3300032002 Unclassified 566
342 Ga0373934_0274454 3300035086 Unclassified 698
343 Ga0373923_0017304 3300035111 Unclassified 2756
344 Ga0373923_0391444 3300035111 Bacteria 668
345 Ga0373953_0092973 3300035117 Unclassified 1263
346 Ga0373956_0038070 3300035119 Bacteria 2127
347 Ga0373956_0597303 3300035119 Bacteria 527
348 Ga0373957_0038534 3300035120 Bacteria 1790
349 Ga0373943_0623744 3300035170 Bacteria 636
350 Ga0373955_0196016 3300035172 Unclassified 1202
351 Ga0373955_0390593 3300035172 Unclassified 845
352 Ga0373935_0377302 3300035692 Bacteria 1015
353 Ga0373935_0404104 3300035692 Unclassified 981
354 Ga0373935_0506157 3300035692 Bacteria 877
355 Ga0373933_0149537 3300035724 Bacteria 1478
356 Ga0373933_0325937 3300035724 Bacteria 996
357 Ga0373947_1127004 3300035725 Bacteria 535
358 Ga0373937_0003334 3300036401 Bacteria 13483
359 Ga0373937_0407308 3300036401 Unclassified 1290
360 Ga0373937_1211432 3300036401 Bacteria 703
361 Ga0373937_1739248 3300036401 Bacteria 570
362 Ga0373925_0164497 3300037068 Bacteria 1749
363 Ga0395898_0399355 3300037466 Bacteria 1311
364 Ga0436364_1447060 3300037853 Bacteria 6808
365 Ga0436364_1478340 3300037853 Bacteria 5267
366 Ga0436365_0750577 3300039437 Bacteria 3050
367 Ga0436365_1045428 3300039437 Bacteria 2423
368 Ga0436365_1098587 3300039437 Bacteria 545
369 Ga0436360_0037193 3300039438 Unclassified 970
370 Ga0436360_0283294 3300039438 Bacteria 729
371 Ga0436360_0498443 3300039438 Bacteria 28098
372 Ga0436360_1140219 3300039438 Bacteria 2159
373 Ga0436361_0468688 3300039447 Bacteria 2116
374 Ga0436361_0564223 3300039447 Bacteria 15737
375 Ga0436361_0794164 3300039447 Unclassified 861
376 Ga0436361_0797635 3300039447 Bacteria 636
377 Ga0436361_0806658 3300039447 Bacteria 605
378 Ga0436363_0031826 3300039450 Bacteria 1323
379 Ga0436363_0034045 3300039450 Bacteria 583
380 Ga0436363_0452538 3300039450 Bacteria 4156
381 Ga0436363_0498317 3300039450 Unclassified 911
382 Ga0436362_0254094 3300039453 Unclassified 3315
383 Ga0436362_1020693 3300039453 Bacteria 2476
384 Ga0451845_0978325 3300041501 Unclassified 532
385 Ga0466963_0125743 3300044694 Bacteria 1768
386 Ga0466968_0231546 3300044735 Bacteria 873
387 Ga0466959_0689291 3300045049 Bacteria 685
388 Ga0451576_0531091 3300045051 Bacteria 1236
389 Ga0466958_0071546 3300045836 Bacteria 2124
390 Ga0466967_0041648 3300045976 Bacteria 3962
391 Ga0466967_0130072 3300045976 Bacteria 2336
392 Ga0466967_0276394 3300045976 Unclassified 1611
393 Ga0466967_0437974 3300045976 Bacteria 1276
394 Ga0466967_0691008 3300045976 Bacteria 1010
395 Ga0495592_0292686 3300046454 Unclassified 1061
396 Ga0495629_0706538 3300046459 Bacteria 669
397 Ga0495629_1004634 3300046459 Bacteria 543
398 Ga0495651_0008691 3300046462 Bacteria 7795
399 Ga0495651_0056201 3300046462 Bacteria 3024
400 Ga0495651_0088402 3300046462 Bacteria 2328
401 Ga0495653_0406831 3300046463 Unclassified 864
402 Ga0495653_0493210 3300046463 Bacteria 765
403 Ga0495580_0002206 3300046472 Bacteria 17034
404 Ga0495582_0293918 3300046473 Bacteria 934
405 Ga0495664_0078570 3300046477 Bacteria 1976
406 Ga0495594_0005442 3300046499 Bacteria 6545
407 Ga0495594_0230513 3300046499 Bacteria 1056
408 Ga0495608_0192699 3300046511 Unclassified 1286
409 Ga0495628_0014309 3300046516 Bacteria 6655
410 Ga0495666_0219890 3300046526 Bacteria 870
411 Ga0495652_0463424 3300046529 Unclassified 885
412 Ga0495640_0059749 3300046533 Bacteria 2594
413 Ga0495586_0155644 3300046535 Bacteria 1287
414 Ga0495587_0306123 3300046536 Bacteria 888
415 Ga0495645_0000983 3300046543 Bacteria 19437
416 Ga0495645_0054211 3300046543 Bacteria 2914
417 Ga0495667_0066797 3300046559 Bacteria 2350
418 Ga0495634_0068271 3300046642 Bacteria 2349
419 Ga0495634_0159844 3300046642 Bacteria 1421
420 Ga0495635_0212389 3300046663 Bacteria 1310
421 Ga0495657_0329534 3300046675 Unclassified 906
422 Ga0495623_0028086 3300046679 Bacteria 3622
423 Ga0495623_0072660 3300046679 Bacteria 2139
424 Ga0495646_0003095 3300046680 Bacteria 10320
425 Ga0495658_1107749 3300046683 Bacteria 505
426 Ga0495613_0128383 3300046689 Bacteria 1816
427 Ga0495624_0062520 3300046690 Bacteria 2329
428 Ga0495581_0764271 3300047315 Bacteria 555
429 Ga0495604_0046878 3300047317 Bacteria 3369
430 Ga0495674_0106689 3300047319 Bacteria 2378
431 Ga0495674_0160692 3300047319 Bacteria 1880
432 Ga0495674_0524692 3300047319 Unclassified 945
433 Ga0495676_0335893 3300047321 Bacteria 1012
434 Ga0495675_0186589 3300047444 Bacteria 1267
435 Ga0495684_0045069 3300047471 Unclassified 3375
436 Ga0495684_0047958 3300047471 Bacteria 3266
437 Ga0495684_0177424 3300047471 Bacteria 1581
438 Ga0495602_0063261 3300048088 Unclassified 3207
439 Ga0496101_0369064 3300048904 Bacteria 1129
440 Ga0496104_0025942 3300048907 Bacteria 5404
441 Ga0496104_0719308 3300048907 Bacteria 906
442 Ga0496104_0981797 3300048907 Unclassified 749
443 Ga0496105_0199218 3300048908 Bacteria 1635
444 Ga0496105_1069155 3300048908 Bacteria 600
445 Ga0496109_0144008 3300048912 Bacteria 2229
446 Ga0496109_0403131 3300048912 Bacteria 1292
447 Ga0496110_1917525 3300048913 Bacteria 502
448 Ga0496112_0115533 3300048915 Bacteria 2654
449 Ga0496112_0370504 3300048915 Bacteria 1374
450 Ga0496112_1751746 3300048915 Unclassified 533
451 Ga0496113_0019111 3300048916 Bacteria 4788
452 Ga0496115_0029425 3300048918 Bacteria 4314
453 Ga0496115_0752711 3300048918 Bacteria 762
454 Ga0501039_0065456 3300049575 Bacteria 2820
455 Ga0501067_0097786 3300049583 Bacteria 1630
456 nmdc:mga06r32_418691_c1 3300050510 Unclassified 1321
457 nmdc:mga0n895_266791_c1 3300050512 Unclassified 1737
458 nmdc:mga0rr50_35800_c1 3300050513 Bacteria 3568
459 nmdc:mga08x19_10091_c1 3300050514 Bacteria 5664
460 nmdc:mga08x19_101003_c1 3300050514 Bacteria 1914
461 nmdc:mga08x19_505380_c1 3300050514 Unclassified 854
462 nmdc:mga08x19_82664_c1 3300050514 Unclassified 2110
463 Ga0495601_0639066 3300053077 Bacteria 681
464 Ga0590071_018053 3300059421 Bacteria 1659
465 Ga0495630_0850134
466 rootH1_10296731
467 rootH1_10305078
468 Ga0058863_10839963
469 Ga0065715_10007766
470 Ga0065715_10329644
471 Ga0065715_10999841
472 Ga0065707_10462265
473 Ga0065707_10649489
474 Ga0070658_10836696
475 Ga0070676_11017933
476 Ga0070683_100022705
477 Ga0070683_100136702
478 Ga0070683_100334139
479 Ga0070683_100366438
480 Ga0068869_100380481
481 Ga0068869_100486150
482 Ga0070666_10037266
483 Ga0070666_10327963
484 Ga0070682_100229045
485 Ga0070682_100571216
486 Ga0068868_100182453
487 Ga0068868_100326868
488 Ga0068868_100622346
489 Ga0068868_100734037
490 Ga0070660_100039279
491 Ga0070661_100004826
492 Ga0070661_100102549
493 Ga0070668_101794320
494 Ga0070675_100746967
495 Ga0070671_100196919
496 Ga0070671_100612920
497 Ga0070671_101653835
498 Ga0070673_100377866
499 Ga0070688_100452600
500 Ga0070659_100212867
501 Ga0070667_100029891
502 Ga0070667_100124749
503 Ga0070667_100337803
504 Ga0070667_100690390
505 Ga0070709_10325819
506 Ga0070709_10674524
507 Ga0070709_11550515
508 Ga0070714_100131586
509 Ga0070714_101446484
510 Ga0070713_101107684
511 Ga0070710_10421654
512 Ga0070710_10782918
513 Ga0070711_100070304
514 Ga0070711_100073950
515 Ga0070711_100486327
516 Ga0070711_100567113
517 Ga0070708_100187305
518 Ga0070663_101998907
519 Ga0070678_100029160
520 Ga0070678_100175698
521 Ga0070681_11015941
522 Ga0068867_101765936
523 Ga0070707_100132584
524 Ga0070679_100015557
525 Ga0070679_100520608
526 Ga0070679_101561130
527 Ga0070684_100072974
528 Ga0070684_100313307
529 Ga0070684_102125566
530 Ga0068853_100002475
531 Ga0068853_100021095
532 Ga0068853_100029271
533 Ga0068853_100043881
534 Ga0068853_100045783
535 Ga0068853_100242767
536 Ga0068853_100446227
537 Ga0068853_101702966
538 Ga0070672_100099274
539 Ga0070665_100144449
540 Ga0070665_100415118
541 Ga0070665_101198299
542 Ga0070665_101585963
543 Ga0070704_101161965
544 Ga0068855_100010381
545 Ga0068855_100022897
546 Ga0068855_100055521
547 Ga0068855_100384847
548 Ga0068855_102183993
549 Ga0070664_100255431
550 Ga0070664_100379546
551 Ga0070664_101144152
552 Ga0068857_100012397
553 Ga0068857_100116080
554 Ga0068854_100042622
555 Ga0068854_100202550
556 Ga0068854_100392021
557 Ga0068854_100569573
558 Ga0068856_100001537
559 Ga0068856_100006703
560 Ga0068856_100019393
561 Ga0068856_100180791
562 Ga0068856_100236169
563 Ga0068856_100276242
564 Ga0068856_100461915
565 Ga0068856_101114506
566 Ga0068852_100000414
567 Ga0068852_100526419
568 Ga0068864_101154276
569 Ga0068851_10020867
570 Ga0068851_10031435
571 Ga0068851_10058994
572 Ga0068863_100146131
573 Ga0068863_102572551
574 Ga0068860_101124652
575 Ga0068860_102831896
576 Ga0068862_100085148
577 Ga0081455_10004203
578 Ga0081540_1001892
579 Ga0070717_10014231
580 Ga0070717_10246788
581 Ga0070716_100809556
582 Ga0070712_100040999
583 Ga0070712_100646408
584 Ga0097621_100030425
585 Ga0097621_100420654
586 Ga0097621_100871176
587 Ga0097621_101907533
588 Ga0068871_100050518
589 Ga0068871_100056046
590 Ga0075428_102204443
591 Ga0075430_100009310
592 Ga0075431_100049764
593 Ga0075431_100099366
594 Ga0068865_100159586
595 Ga0075436_100096367
596 Ga0075436_100111214
597 Ga0099794_10524915
598 Ga0099795_10265526
599 Ga0105250_10034793
600 Ga0105240_10019961
601 Ga0105240_10025512
602 Ga0105240_10204593
603 Ga0105240_10314652
604 Ga0105240_10635327
605 Ga0105240_11656020
606 Ga0105240_12089711
607 Ga0111539_11193127
608 Ga0105245_10097300
609 Ga0105247_10213858
610 Ga0114129_10480473
611 Ga0105243_10898287
612 Ga0105241_10010987
613 Ga0105241_10092186
614 Ga0105241_10131145
615 Ga0105241_10289992
616 Ga0105241_11716835
617 Ga0105241_12577768
618 Ga0105242_10157079
619 Ga0105242_11424304
620 Ga0105242_12939476
621 Ga0105248_10405197
622 Ga0105248_10475469
623 Ga0105248_10685022
624 Ga0105248_10938726
625 Ga0105248_11888607
626 Ga0105237_10000665
627 Ga0105237_10091395
628 Ga0105237_10306826
629 Ga0105237_10430311
630 Ga0105237_10699419
631 Ga0105237_11407620
632 Ga0105238_10000049
633 Ga0105238_10047230
634 Ga0105238_10221658
635 Ga0105238_11362406
636 Ga0105249_10223494
637 Ga0099796_10126665
638 Ga0105239_10007274
639 Ga0105239_12397077
640 Ga0105239_12461419
641 Ga0105239_13632648
642 Ga0105246_10188709
643 Ga0105246_10425341
644 Ga0157373_10127261
645 Ga0157373_10328695
646 Ga0157373_10527813
647 Ga0157373_10616020
648 Ga0157370_10446954
649 Ga0157369_10008100
650 Ga0157369_10008769
651 Ga0157369_10053499
652 Ga0157369_10087027
653 Ga0157369_10119301
654 Ga0157369_10155762
655 Ga0157369_10229736
656 Ga0157369_10812082
657 Ga0157369_11828239
658 Ga0157374_10003780
659 Ga0157374_10080410
660 Ga0157374_10145768
661 Ga0157374_10523184
662 Ga0157374_10572300
663 Ga0157374_11094266
664 Ga0157378_10167615
665 Ga0157378_10247962
666 Ga0157378_12011528
667 Ga0163162_10017561
668 Ga0163162_10534821
669 Ga0163162_10758630
670 Ga0163162_11791737
671 Ga0163162_12734869
672 Ga0157372_10002082
673 Ga0157372_10002987
674 Ga0157372_10104341
675 Ga0157372_10210280
676 Ga0157372_10297337
677 Ga0157372_10780181
678 Ga0157372_10794310
679 Ga0157372_11789270
680 Ga0157372_11826988
681 Ga0157372_12671550
682 Ga0157375_10352028
683 Ga0157375_10962355
684 Ga0157375_11340284
685 Ga0157375_12189633
686 Ga0163163_10032768
687 Ga0163163_10041785
688 Ga0163163_10368070
689 Ga0163163_10620062
690 Ga0163163_10726384
691 Ga0157377_10133780
692 Ga0157377_10692350
693 Ga0157377_11748260
694 Ga0157379_10937474
695 Ga0157376_10045013
696 Ga0157376_10056952
697 Ga0157376_10172579
698 Ga0157376_10752735
699 Ga0157376_11117964
700 Ga0163161_10099731
701 Ga0213872_10011818
702 Ga0213874_10109129
703 Ga0213874_10205836
704 Ga0213875_10008281
705 Ga0213871_10000510
706 Ga0207656_10323670
707 Ga0207710_10386544
708 Ga0207680_10242958
709 Ga0207680_10632110
710 Ga0207647_10455438
711 Ga0207685_10156850
712 Ga0207699_10157344
713 Ga0207645_10055691
714 Ga0207684_10023332
715 Ga0207654_10106581
716 Ga0207654_10485226
717 Ga0207707_10115838
718 Ga0207695_10000154
719 Ga0207695_10041519
720 Ga0207695_10709756
721 Ga0207671_10000220
722 Ga0207671_10384185
723 Ga0207671_11412185
724 Ga0207693_10051389
725 Ga0207693_10351966
726 Ga0207693_10543152
727 Ga0207663_10483565
728 Ga0207663_10607109
729 Ga0207660_10204882
730 Ga0207649_10002080
731 Ga0207649_10186162
732 Ga0207652_10022389
733 Ga0207652_10274693
734 Ga0207652_11188019
735 Ga0207694_10000009
736 Ga0207694_10000040
737 Ga0207694_10000143
738 Ga0207694_10145486
739 Ga0207694_11226073
740 Ga0207659_10089463
741 Ga0207700_10360193
742 Ga0207700_10980277
743 Ga0207704_10251333
744 Ga0207704_10894136
745 Ga0207665_10903346
746 Ga0207691_10023770
747 Ga0207711_10137235
748 Ga0207711_10287325
749 Ga0207711_10689823
750 Ga0207689_10073604
751 Ga0207661_10021136
752 Ga0207661_10143711
753 Ga0207679_10327318
754 Ga0207679_10550438
755 Ga0207679_10975609
756 Ga0207667_10022854
757 Ga0207667_10087335
758 Ga0207667_10125239
759 Ga0207667_10554235
760 Ga0207651_10985585
761 Ga0207712_10138626
762 Ga0207640_10011658
763 Ga0207640_11133691
764 Ga0207640_11654224
765 Ga0207677_10031147
766 Ga0207677_10151581
767 Ga0207703_10202305
768 Ga0207639_10001233
769 Ga0207639_10036190
770 Ga0207639_10037533
771 Ga0207639_10057236
772 Ga0207639_11903904
773 Ga0207639_12081403
774 Ga0207678_10419774
775 Ga0207702_10000675
776 Ga0207702_10016516
777 Ga0207702_10338053
778 Ga0207702_10520003
779 Ga0207641_10390827
780 Ga0207641_10909701
781 Ga0207674_10000249
782 Ga0207674_12173377
783 Ga0207675_100482932
784 Ga0207683_10111006
785 Ga0207683_10275572
786 Ga0207683_10314744
787 Ga0207698_10001122
788 Ga0207698_11031004
789 Ga0268266_10498880
790 Ga0268266_11106004
791 Ga0268265_10042507
792 Ga0268264_10077110
793 Ga0268264_10309716
794 Ga0265330_10315927
795 Ga0265330_10416124
796 Ga0265332_10382766
797 Ga0265339_10047406
798 Ga0265339_10235328
799 Ga0265331_10269307
800 Ga0265316_10008129
801 Ga0265314_10673385
802 Ga0265314_10725220
803 Ga0265342_10138264
804 Ga0307416_102490835
805 Ga0307416_102984924
806 Ga0373934_0274454
807 Ga0373923_0017304
808 Ga0373923_0391444
809 Ga0373953_0092973
810 Ga0373956_0038070
811 Ga0373956_0597303
812 Ga0373957_0038534
813 Ga0373943_0623744
814 Ga0373955_0196016
815 Ga0373955_0390593
816 Ga0373935_0377302
817 Ga0373935_0404104
818 Ga0373935_0506157
819 Ga0373933_0149537
820 Ga0373933_0325937
821 Ga0373947_1127004
822 Ga0373937_0003334
823 Ga0373937_0407308
824 Ga0373937_1211432
825 Ga0373937_1739248
826 Ga0373925_0164497
827 Ga0395898_0399355
828 Ga0436364_1447060
829 Ga0436364_1478340
830 Ga0436365_0750577
831 Ga0436365_1045428
832 Ga0436365_1098587
833 Ga0436360_0037193
834 Ga0436360_0283294
835 Ga0436360_0498443
836 Ga0436360_1140219
837 Ga0436361_0468688
838 Ga0436361_0564223
839 Ga0436361_0794164
840 Ga0436361_0797635
841 Ga0436361_0806658
842 Ga0436363_0031826
843 Ga0436363_0034045
844 Ga0436363_0452538
845 Ga0436363_0498317
846 Ga0436362_0254094
847 Ga0436362_1020693
848 Ga0451845_0978325
849 Ga0466963_0125743
850 Ga0466968_0231546
851 Ga0466959_0689291
852 Ga0451576_0531091
853 Ga0466958_0071546
854 Ga0466967_0041648
855 Ga0466967_0130072
856 Ga0466967_0276394
857 Ga0466967_0437974
858 Ga0466967_0691008
859 Ga0495592_0292686
860 Ga0495629_0706538
861 Ga0495629_1004634
862 Ga0495651_0008691
863 Ga0495651_0056201
864 Ga0495651_0088402
865 Ga0495653_0406831
866 Ga0495653_0493210
867 Ga0495580_0002206
868 Ga0495582_0293918
869 Ga0495664_0078570
870 Ga0495594_0005442
871 Ga0495594_0230513
872 Ga0495608_0192699
873 Ga0495628_0014309
874 Ga0495666_0219890
875 Ga0495652_0463424
876 Ga0495640_0059749
877 Ga0495586_0155644
878 Ga0495587_0306123
879 Ga0495645_0000983
880 Ga0495645_0054211
881 Ga0495667_0066797
882 Ga0495634_0068271
883 Ga0495634_0159844
884 Ga0495635_0212389
885 Ga0495657_0329534
886 Ga0495623_0028086
887 Ga0495623_0072660
888 Ga0495646_0003095
889 Ga0495658_1107749
890 Ga0495613_0128383
891 Ga0495624_0062520
892 Ga0495581_0764271
893 Ga0495604_0046878
894 Ga0495674_0106689
895 Ga0495674_0160692
896 Ga0495674_0524692
897 Ga0495676_0335893
898 Ga0495675_0186589
899 Ga0495684_0045069
900 Ga0495684_0047958
901 Ga0495684_0177424
902 Ga0495602_0063261
903 Ga0496101_0369064
904 Ga0496104_0025942
905 Ga0496104_0719308
906 Ga0496104_0981797
907 Ga0496105_0199218
908 Ga0496105_1069155
909 Ga0496109_0144008
910 Ga0496109_0403131
911 Ga0496110_1917525
912 Ga0496112_0115533
913 Ga0496112_0370504
914 Ga0496112_1751746
915 Ga0496113_0019111
916 Ga0496115_0029425
917 Ga0496115_0752711
918 Ga0501039_0065456
919 Ga0501067_0097786
920 nmdc:mga06r32_418691_c1
921 nmdc:mga0n895_266791_c1
922 nmdc:mga0rr50_35800_c1
923 nmdc:mga08x19_10091_c1
924 nmdc:mga08x19_101003_c1
925 nmdc:mga08x19_505380_c1
926 nmdc:mga08x19_82664_c1
927 Ga0495601_0639066
928 Ga0590071_018053

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

2

117

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zhp-assembly1.cif.gz_B crystal structure of bleomycin-binding protein from streptoalloteichus hindustanus complexed with bleomycin derivative 0.8355 1 121
2zhp-assembly1.cif.gz_B crystal structure of bleomycin-binding protein from streptoalloteichus hindustanus complexed with bleomycin derivative 0.8216 1 121
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.8097 4 120
5cj3-assembly1.cif.gz_B crystal structure of the zorbamycin binding protein (zbma) from streptomyces flavoviridis with zorbamycin 0.8042 1 122
3bt3-assembly1.cif.gz_B crystal structure of a glyoxalase-related enzyme from clostridium phytofermentans 0.8001 1 122
ID Description Score Start End Superfamily
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8978 69 122 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.894 71 119 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8918 71 122 3.30.720.110
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8421 69 122 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8316 71 122 3.30.720.110
ID Description Score Start End GO Terms
AF-Q020R5-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9559 1 122 GO:0051213
AF-A0A2V8EUZ5-F1-model_v4 Bleomycin resistance protein 0.9412 62 122
AF-A0A6I4SVV7-F1-model_v4 VOC family protein 0.9313 1 122
AF-A0A6I4SVV7-F1-model_v4 VOC family protein 0.9241 1 122
AF-A0A0M9VH57-F1-model_v4 VOC domain-containing protein 0.9235 1 119

Map