F449345

General Info

Members Datasets Scaffolds Average Seq Length
464 269 414 152

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_2101012|Ga0466967_2101012_45_500
Length 151
Sequence MPDLRPILLVEDNPRDVELTLAALARCQLANEIVVARDGAEALDLLLGQGASHNRPLVPAVVLLDLKLPKIDGLEVLEKVKSDPKRSHIPVVMLTSSREERDLIRSYDLGVNAFVVKPVDFSDFFAAIQDLGMFWAVLNEPAPEARSTDDT

Samples

Sample ID Description Type Environment
1 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
4 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
5 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
6 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
7 2643221558 Rhizobium sp. Root149 Isolate Unclassified
8 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
9 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
10 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
11 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
12 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
13 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
14 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
15 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
16 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
17 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
18 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
19 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
20 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
21 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
22 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
23 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
24 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
25 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
26 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
27 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
28 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
29 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
30 2919085039 Luteibacter sp. 1214 Isolate Unclassified
31 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
32 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
33 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
34 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
35 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
36 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
37 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
38 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
39 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
40 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
41 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
42 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
43 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
44 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
45 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
46 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
47 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
48 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
49 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
50 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
51 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
52 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
53 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
54 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
55 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
56 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
57 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
58 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
59 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
60 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
61 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
62 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
63 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
64 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
65 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
66 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
67 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
68 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
69 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
70 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
71 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
72 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
73 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
74 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
75 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
76 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
77 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
78 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
79 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
80 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
81 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
82 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
83 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
84 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
99 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
107 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
108 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
130 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
131 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
132 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
133 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
165 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
170 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
171 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
180 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
181 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
184 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
192 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
197 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
198 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
199 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
200 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
201 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
207 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
229 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
251 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
252 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
253 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
254 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
255 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
256 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
257 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
258 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
259 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
260 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
261 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
262 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
263 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
264 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
265 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
266 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
267 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
268 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
269 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.01
Metatranscriptomes 0.22
Isolates 10.78

Biome Distribution

Category Percentage (%)
Aerial Root 1.08
Bulb 0
Endosphere 26.51
Nodule 4.09
Rhizoplane 4.09
Rhizosphere 38.58
Stem 0
Stem Tuber 0
Unclassified 25.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10160645 3300001989 Bacteria 663
2 JGI25158J39367_1000044 3300002739 Bacteria 28385
3 JGI25157J39369_1015824 3300002741 Bacteria 927
4 JGI25152J39213_1000303 3300002773 Bacteria 31868
5 JGI25152J39213_1000307 3300002773 Bacteria 31606
6 JGI25150J39212_1000215 3300002774 Bacteria 31515
7 JGI25159J45721_1000067 3300002987 Bacteria 51228
8 JGI25159J45721_1028823 3300002987 Bacteria 922
9 JGI25151J46595_10000068 3300003187 Bacteria 140039
10 JGI25153J46596_10000051 3300003215 Bacteria 140039
11 JGI25153J46596_10000245 3300003215 Bacteria 45345
12 rootH1_10004706 3300003316 Bacteria 2304
13 rootH2_10030123 3300003320 Bacteria 7134
14 rootH2_10095370 3300003320 Bacteria 2997
15 rootH2_10098947 3300003320 Bacteria 3744
16 rootL2_10066715 3300003322 Bacteria 2476
17 rootH1_10216064 3300003323 Bacteria 2586
18 JGI25160J50197_1000297 3300003354 Bacteria 35620
19 JGI25161J50226_1000045 3300003374 Bacteria 116781
20 Ga0006562J51391_1018820 3300003578 Bacteria 761
21 Ga0055526_1000824 3300003771 Bacteria 23130
22 Ga0055526_1001795 3300003771 Bacteria 14858
23 Ga0055537_1000252 3300003773 Bacteria 39046
24 Ga0055524_1000902 3300003775 Bacteria 19233
25 Ga0055524_1047974 3300003775 Bacteria 1001
26 Ga0055536_1002980 3300003781 Bacteria 9271
27 Ga0055534_1000075 3300003784 Bacteria 77072
28 Ga0055528_1000271 3300003790 Bacteria 43963
29 Ga0055528_1003154 3300003790 Bacteria 8446
30 Ga0055528_1043905 3300003790 Bacteria 967
31 Ga0055530_10000771 3300003791 Bacteria 26703
32 Ga0055530_10000810 3300003791 Bacteria 25993
33 Ga0055540_1001005 3300003792 Bacteria 18208
34 Ga0055531_10013004 3300003794 Bacteria 3870
35 Ga0055531_10027771 3300003794 Bacteria 1974
36 Ga0055531_10041179 3300003794 Bacteria 1342
37 Ga0058692_1000044 3300003856 Bacteria 115648
38 Ga0058692_1003142 3300003856 Bacteria 5237
39 Ga0055543_1000142 3300004625 Bacteria 59886
40 Ga0065165_1000456 3300005262 Bacteria 64217
41 Ga0065165_1006668 3300005262 Bacteria 5956
42 Ga0065165_1084230 3300005262 Bacteria 820
43 Ga0065165_1115965 3300005262 Bacteria 654
44 Ga0070670_100000246 3300005331 Bacteria 48778
45 Ga0070677_10101269 3300005333 Bacteria 1270
46 Ga0070666_10057638 3300005335 Bacteria 2625
47 Ga0070666_10364830 3300005335 Bacteria 1035
48 Ga0070682_100023654 3300005337 Bacteria 3649
49 Ga0070668_100001369 3300005347 Bacteria 17469
50 Ga0070668_100349331 3300005347 Bacteria 1251
51 Ga0070669_100829183 3300005353 Bacteria 787
52 Ga0070667_100000206 3300005367 Bacteria 69487
53 Ga0070694_100658405 3300005444 Bacteria 848
54 Ga0070685_10009822 3300005466 Bacteria 4962
55 Ga0070665_100002062 3300005548 Bacteria 22580
56 Ga0070665_100019103 3300005548 Bacteria 6876
57 Ga0070665_100046804 3300005548 Bacteria 4342
58 Ga0070665_100125502 3300005548 Bacteria 2569
59 Ga0070665_101014516 3300005548 Bacteria 842
60 Ga0070665_101541522 3300005548 Bacteria 673
61 Ga0070664_100795442 3300005564 Bacteria 884
62 Ga0068857_100382471 3300005577 Bacteria 1307
63 Ga0068856_100968775 3300005614 Bacteria 869
64 Ga0068859_100163742 3300005617 Bacteria 2303
65 Ga0068864_100000167 3300005618 Bacteria 60640
66 Ga0068864_100082128 3300005618 Bacteria 2827
67 Ga0068861_100655471 3300005719 Bacteria 970
68 Ga0068863_100000562 3300005841 Bacteria 37687
69 Ga0068863_102450535 3300005841 Bacteria 531
70 Ga0068858_100026687 3300005842 Bacteria 5365
71 Ga0068860_100000851 3300005843 Bacteria 34076
72 Ga0068862_100000445 3300005844 Bacteria 44965
73 Ga0081540_1002610 3300005983 Bacteria 14645
74 Ga0081540_1160956 3300005983 Bacteria 871
75 Ga0081539_10084810 3300005985 Bacteria 1654
76 Ga0075365_10009640 3300006038 Bacteria 5571
77 Ga0075365_10016388 3300006038 Bacteria 4507
78 Ga0075368_10003410 3300006042 Bacteria 5304
79 Ga0075368_10318568 3300006042 Bacteria 673
80 Ga0075363_100011210 3300006048 Bacteria 4287
81 Ga0075364_10002070 3300006051 Bacteria 11202
82 Ga0075364_10030037 3300006051 Bacteria 3487
83 Ga0075364_10120601 3300006051 Bacteria 1755
84 Ga0075364_10524637 3300006051 Bacteria 810
85 Ga0075364_10773248 3300006051 Bacteria 655
86 Ga0075367_10013316 3300006178 Bacteria 4417
87 Ga0075367_10028106 3300006178 Bacteria 3206
88 Ga0075367_10181087 3300006178 Bacteria 1314
89 Ga0075369_10000346 3300006186 Bacteria 13807
90 Ga0075369_10023370 3300006186 Bacteria 2555
91 Ga0075369_10230920 3300006186 Bacteria 857
92 Ga0075369_10252502 3300006186 Bacteria 819
93 Ga0075366_10106349 3300006195 Bacteria 1687
94 Ga0075370_10014175 3300006353 Bacteria 4247
95 Ga0097620_100163742 3300006931 Bacteria 2303
96 Ga0099826_10000098 3300006948 Bacteria 41270
97 Ga0099826_10118639 3300006948 Bacteria 1562
98 Ga0105251_10021575 3300009011 Bacteria 3360
99 Ga0105244_10068168 3300009036 Bacteria 1778
100 Ga0105248_10049361 3300009177 Bacteria 4720
101 Ga0105237_10413434 3300009545 Bacteria 1354
102 Ga0105237_10738604 3300009545 Bacteria 991
103 Ga0105238_10056430 3300009551 Bacteria 3940
104 Ga0105249_10000581 3300009553 Bacteria 33426
105 Ga0105239_10045424 3300010375 Bacteria 4814
106 Ga0157373_10017517 3300013100 Bacteria 5217
107 Ga0157373_10034090 3300013100 Bacteria 3657
108 Ga0157373_10831934 3300013100 Bacteria 682
109 Ga0157371_10000206 3300013102 Bacteria 86320
110 Ga0157371_10182641 3300013102 Bacteria 1500
111 Ga0157371_10500472 3300013102 Bacteria 897
112 Ga0157370_10001495 3300013104 Bacteria 28921
113 Ga0157370_10007589 3300013104 Bacteria 11783
114 Ga0157370_10138120 3300013104 Bacteria 2271
115 Ga0157369_10021447 3300013105 Bacteria 7226
116 Ga0157378_10801448 3300013297 Bacteria 968
117 Ga0163162_10059767 3300013306 Bacteria 3844
118 Ga0163162_10305446 3300013306 Bacteria 1723
119 Ga0157372_12142582 3300013307 Bacteria 642
120 Ga0163163_11393526 3300014325 Bacteria 763
121 Ga0182008_10000051 3300014497 Bacteria 103398
122 Ga0182008_10061597 3300014497 Bacteria 1850
123 Ga0182008_10074802 3300014497 Bacteria 1667
124 Ga0157379_11889148 3300014968 Bacteria 588
125 Ga0182006_1010535 3300015261 Bacteria 4109
126 Ga0182006_1024073 3300015261 Bacteria 2515
127 Ga0182006_1045751 3300015261 Bacteria 1702
128 Ga0182006_1071515 3300015261 Bacteria 1285
129 Ga0182007_10000061 3300015262 Bacteria 88102
130 Ga0182007_10048750 3300015262 Bacteria 1400
131 Ga0182005_1000019 3300015265 Bacteria 296232
132 Ga0182005_1001189 3300015265 Bacteria 10758
133 Ga0163161_10001084 3300017792 Bacteria 20622
134 Ga0163161_10014285 3300017792 Bacteria 5528
135 Ga0163161_10016445 3300017792 Bacteria 5163
136 Ga0163161_10085080 3300017792 Bacteria 2333
137 Ga0163161_10364652 3300017792 Bacteria 1151
138 Ga0163161_10808475 3300017792 Bacteria 788
139 Ga0213876_10007385 3300021384 Bacteria 5978
140 Ga0213876_10041053 3300021384 Bacteria 2445
141 Ga0213876_10166090 3300021384 Bacteria 1174
142 Ga0209436_100001 3300025208 Bacteria 304543
143 Ga0209436_100003 3300025208 Bacteria 220530
144 Ga0207425_1000011 3300025245 Bacteria 550735
145 Ga0207425_1000815 3300025245 Bacteria 15613
146 Ga0209026_1000674 3300025250 Bacteria 20578
147 Ga0209129_1000031 3300025258 Bacteria 383039
148 Ga0209129_1000405 3300025258 Bacteria 34205
149 Ga0209565_1000050 3300025263 Bacteria 213856
150 Ga0209673_1000199 3300025273 Bacteria 120904
151 Ga0209673_1000397 3300025273 Bacteria 77638
152 Ga0209673_1034855 3300025273 Bacteria 1514
153 Ga0209130_1000049 3300025284 Bacteria 226841
154 Ga0209130_1007297 3300025284 Bacteria 3432
155 Ga0209675_1000007 3300025291 Bacteria 683430
156 Ga0209675_1006525 3300025291 Bacteria 4659
157 Ga0209676_1000018 3300025292 Bacteria 631385
158 Ga0209676_1000075 3300025292 Bacteria 303609
159 Ga0209025_1000012 3300025294 Bacteria 924362
160 Ga0209025_1000416 3300025294 Bacteria 85510
161 Ga0209564_1000061 3300025295 Bacteria 322795
162 Ga0209564_1001168 3300025295 Bacteria 30545
163 Ga0209564_1009339 3300025295 Bacteria 4682
164 Ga0209758_1000018 3300025297 Bacteria 753320
165 Ga0209758_1000175 3300025297 Bacteria 145649
166 Ga0209758_1002975 3300025297 Bacteria 16245
167 Ga0209758_1018578 3300025297 Bacteria 3398
168 Ga0209050_1000424 3300025298 Bacteria 77803
169 Ga0209050_1000610 3300025298 Bacteria 56686
170 Ga0209050_1028962 3300025298 Bacteria 1784
171 Ga0209256_1000379 3300025299 Bacteria 71301
172 Ga0209256_1004229 3300025299 Bacteria 9203
173 Ga0209256_1004926 3300025299 Bacteria 8008
174 Ga0209256_1024872 3300025299 Bacteria 1755
175 Ga0207426_1000043 3300025302 Bacteria 432827
176 Ga0209051_1002213 3300025303 Bacteria 14360
177 Ga0209051_1134098 3300025303 Bacteria 607
178 Ga0209257_1000035 3300025304 Bacteria 631463
179 Ga0209257_1000667 3300025304 Bacteria 53711
180 Ga0209257_1004768 3300025304 Bacteria 10123
181 Ga0209257_1015854 3300025304 Bacteria 3095
182 Ga0209257_1016638 3300025304 Bacteria 2960
183 Ga0207697_10466025 3300025315 Bacteria 559
184 Ga0207713_1020455 3300025735 Bacteria 3205
185 Ga0207682_10171542 3300025893 Bacteria 987
186 Ga0207710_10066447 3300025900 Bacteria 1645
187 Ga0207680_10003381 3300025903 Bacteria 7515
188 Ga0207680_10186258 3300025903 Bacteria 1407
189 Ga0207671_10875835 3300025914 Bacteria 710
190 Ga0207694_10220182 3300025924 Bacteria 1548
191 Ga0207650_10000031 3300025925 Bacteria 230128
192 Ga0207711_10040259 3300025941 Bacteria 3975
193 Ga0207712_10002141 3300025961 Bacteria 12909
194 Ga0207668_10000978 3300025972 Bacteria 17178
195 Ga0207668_11364482 3300025972 Bacteria 639
196 Ga0207658_10000581 3300025986 Bacteria 32905
197 Ga0207703_10007540 3300026035 Bacteria 8631
198 Ga0207702_10805112 3300026078 Bacteria 929
199 Ga0207641_10000697 3300026088 Bacteria 36201
200 Ga0207641_12130053 3300026088 Bacteria 561
201 Ga0207676_10002092 3300026095 Bacteria 14460
202 Ga0207676_10015718 3300026095 Bacteria 5469
203 Ga0207675_100626578 3300026118 Bacteria 1080
204 Ga0209371_1000003 3300027312 Bacteria 1122971
205 Ga0209371_1000023 3300027312 Bacteria 519553
206 Ga0209282_1000147 3300027666 Bacteria 41275
207 Ga0209813_10024786 3300027866 Bacteria 1719
208 Ga0268266_10006655 3300028379 Bacteria 10545
209 Ga0268266_10039994 3300028379 Bacteria 3995
210 Ga0268266_10047537 3300028379 Bacteria 3677
211 Ga0268266_10064957 3300028379 Bacteria 3154
212 Ga0268266_10135160 3300028379 Bacteria 2208
213 Ga0268266_10934245 3300028379 Bacteria 839
214 Ga0268265_10000923 3300028380 Bacteria 27194
215 Ga0268264_10000361 3300028381 Bacteria 67632
216 Ga0268256_1000004 3300030500 Bacteria 1122967
217 Ga0268256_1000023 3300030500 Bacteria 519631
218 Ga0316176_1191301 3300030732 Bacteria 6552
219 Ga0316181_1262216 3300030744 Bacteria 4714
220 Ga0307412_10296001 3300031911 Bacteria 1277
221 Ga0307409_100294857 3300031995 Bacteria 1505
222 Ga0307411_10500415 3300032005 Bacteria 1027
223 Ga0307411_10931762 3300032005 Bacteria 774
224 Ga0307415_102419805 3300032126 Bacteria 516
225 Ga0436364_1485238 3300037853 Bacteria 535
226 Ga0237819_00003 3300038705 Bacteria 86904
227 Ga0436365_0752820 3300039437 Bacteria 2471
228 Ga0436365_1668047 3300039437 Bacteria 6951
229 Ga0436365_1786926 3300039437 Bacteria 1495
230 Ga0436365_1921538 3300039437 Bacteria 1833
231 Ga0439465_0000189 3300041413 Bacteria 16012
232 Ga0451837_1623979 3300041494 Bacteria 645
233 Ga0451841_0961763 3300041498 Bacteria 636
234 Ga0451853_2511842 3300041512 Bacteria 658
235 Ga0439432_002062 3300042006 Bacteria 7592
236 Ga0466965_0040153 3300044683 Bacteria 2303
237 Ga0466965_0107437 3300044683 Bacteria 1432
238 Ga0466963_0129720 3300044694 Bacteria 1741
239 Ga0466963_1156503 3300044694 Bacteria 544
240 Ga0466968_0015022 3300044735 Bacteria 3067
241 Ga0466968_0040051 3300044735 Bacteria 1975
242 Ga0466970_0288579 3300044765 Bacteria 924
243 Ga0466957_0281907 3300044842 Bacteria 1112
244 Ga0466959_1186808 3300045049 Bacteria 507
245 Ga0466967_2101012 3300045976 Bacteria 561
246 Ga0495627_001035 3300046453 Bacteria 18603
247 Ga0495591_006879 3300046458 Bacteria 4934
248 Ga0495638_0000409 3300046460 Bacteria 52476
249 Ga0495650_0024418 3300046471 Bacteria 2855
250 Ga0495594_0036449 3300046499 Bacteria 2682
251 Ga0495610_0001846 3300046512 Bacteria 18362
252 Ga0495610_0309036 3300046512 Bacteria 607
253 Ga0495620_0190053 3300046515 Bacteria 792
254 Ga0495631_0000377 3300046518 Bacteria 30621
255 Ga0495643_0000599 3300046522 Bacteria 43638
256 Ga0495648_0000068 3300046524 Bacteria 138518
257 Ga0495654_0000655 3300046530 Bacteria 27305
258 Ga0495633_0035410 3300046558 Bacteria 2397
259 Ga0495668_0113258 3300046616 Bacteria 1484
260 Ga0495625_0012191 3300046660 Bacteria 6972
261 Ga0495625_0030042 3300046660 Bacteria 4057
262 Ga0495581_0047506 3300047315 Bacteria 2481
263 Ga0495672_0000417 3300047320 Bacteria 51409
264 Ga0495672_0046219 3300047320 Bacteria 2598
265 Ga0495673_0000191 3300047469 Bacteria 96817
266 Ga0495686_0005207 3300047472 Bacteria 10346
267 Ga0495686_0007423 3300047472 Bacteria 8222
268 Ga0495686_0322687 3300047472 Bacteria 846
269 Ga0496100_0556200 3300048903 Bacteria 888
270 Ga0496101_0288731 3300048904 Bacteria 1283
271 Ga0496102_0015254 3300048905 Bacteria 6690
272 Ga0496102_0335492 3300048905 Bacteria 1424
273 Ga0496102_1021933 3300048905 Bacteria 747
274 Ga0496103_0569845 3300048906 Bacteria 722
275 Ga0496104_0006605 3300048907 Bacteria 10201
276 Ga0496105_0038051 3300048908 Bacteria 3963
277 Ga0496106_0589371 3300048909 Bacteria 891
278 Ga0496107_1349692 3300048910 Bacteria 509
279 Ga0496108_0087045 3300048911 Bacteria 2653
280 Ga0496109_0562075 3300048912 Bacteria 1076
281 Ga0496110_0165068 3300048913 Bacteria 2008
282 Ga0496111_0000414 3300048914 Bacteria 21472
283 Ga0496115_0227309 3300048918 Bacteria 1539
284 Ga0496116_0001793 3300048919 Bacteria 23337
285 Ga0496116_0005203 3300048919 Bacteria 12186
286 Ga0496116_0057114 3300048919 Bacteria 2553
287 Ga0496116_0083453 3300048919 Bacteria 1972
288 Ga0496116_0111482 3300048919 Bacteria 1607
289 Ga0496117_0000437 3300048920 Bacteria 69398
290 Ga0496117_0001193 3300048920 Bacteria 39104
291 Ga0496117_0001821 3300048920 Bacteria 28933
292 Ga0496117_0005990 3300048920 Bacteria 12527
293 Ga0496117_0033430 3300048920 Bacteria 3888
294 Ga0496117_0128323 3300048920 Bacteria 1542
295 Ga0496117_0426858 3300048920 Bacteria 661
296 Ga0496118_0000430 3300048921 Bacteria 69608
297 Ga0496118_0000500 3300048921 Bacteria 64878
298 Ga0496118_0003117 3300048921 Bacteria 21240
299 Ga0496118_0004086 3300048921 Bacteria 17697
300 Ga0496118_0048330 3300048921 Bacteria 3288
301 Ga0496118_0117800 3300048921 Bacteria 1741
302 Ga0496118_0212184 3300048921 Bacteria 1135
303 Ga0496119_0000209 3300048922 Bacteria 83605
304 Ga0496119_0000450 3300048922 Bacteria 56283
305 Ga0496120_0000271 3300048923 Bacteria 86589
306 Ga0496120_0191252 3300048923 Bacteria 997
307 Ga0496121_0000710 3300048924 Bacteria 61765
308 Ga0496121_0002335 3300048924 Bacteria 29284
309 Ga0496121_0016520 3300048924 Bacteria 7614
310 Ga0496121_0105183 3300048924 Bacteria 2167
311 Ga0496121_0207165 3300048924 Bacteria 1392
312 Ga0496121_0352190 3300048924 Bacteria 980
313 Ga0496121_0475430 3300048924 Bacteria 799
314 Ga0496122_0000266 3300048925 Bacteria 117021
315 Ga0496122_0000559 3300048925 Bacteria 76330
316 Ga0496122_0000967 3300048925 Bacteria 51549
317 Ga0496122_0004676 3300048925 Bacteria 16809
318 Ga0496122_0005071 3300048925 Bacteria 15906
319 Ga0496122_0022132 3300048925 Bacteria 5662
320 Ga0496122_0055577 3300048925 Bacteria 2960
321 Ga0496122_0072967 3300048925 Bacteria 2437
322 Ga0496122_0243238 3300048925 Bacteria 1012
323 Ga0496123_0000018 3300048926 Bacteria 404553
324 Ga0496123_0000435 3300048926 Bacteria 75306
325 Ga0496123_0002356 3300048926 Bacteria 23697
326 Ga0496123_0003353 3300048926 Bacteria 18121
327 Ga0496123_0007663 3300048926 Bacteria 10098
328 Ga0496123_0009885 3300048926 Bacteria 8513
329 Ga0496123_0051032 3300048926 Bacteria 2758
330 Ga0496123_0117724 3300048926 Bacteria 1502
331 Ga0496123_0170288 3300048926 Bacteria 1150
332 Ga0496124_0000125 3300048927 Bacteria 159942
333 Ga0496124_0000343 3300048927 Bacteria 85220
334 Ga0496124_0000584 3300048927 Bacteria 61524
335 Ga0496124_0001573 3300048927 Bacteria 32965
336 Ga0496124_0001983 3300048927 Bacteria 27904
337 Ga0496124_0002387 3300048927 Bacteria 24716
338 Ga0496124_0002508 3300048927 Bacteria 23884
339 Ga0496124_0002696 3300048927 Bacteria 22707
340 Ga0496124_0002972 3300048927 Bacteria 21248
341 Ga0496124_0005756 3300048927 Bacteria 13798
342 Ga0496124_0007613 3300048927 Bacteria 11478
343 Ga0496124_0018972 3300048927 Bacteria 6420
344 Ga0496124_0038845 3300048927 Bacteria 4130
345 Ga0496124_0052758 3300048927 Bacteria 3453
346 Ga0496124_0087178 3300048927 Bacteria 2553
347 Ga0496124_0273991 3300048927 Bacteria 1234
348 Ga0496124_0402548 3300048927 Bacteria 949
349 Ga0496124_0611769 3300048927 Bacteria 707
350 Ga0496125_0000144 3300048928 Bacteria 156270
351 Ga0496125_0000249 3300048928 Bacteria 110627
352 Ga0496125_0001175 3300048928 Bacteria 39654
353 Ga0496125_0012454 3300048928 Bacteria 8441
354 Ga0496125_0017178 3300048928 Bacteria 6915
355 Ga0496125_0023652 3300048928 Bacteria 5666
356 Ga0496125_0030949 3300048928 Bacteria 4778
357 Ga0496125_0040872 3300048928 Bacteria 3972
358 Ga0496125_0171183 3300048928 Bacteria 1459
359 Ga0496126_0000795 3300048929 Bacteria 56626
360 Ga0496126_0001062 3300048929 Bacteria 46308
361 Ga0496126_0020866 3300048929 Bacteria 6414
362 Ga0496126_0037511 3300048929 Bacteria 4521
363 Ga0496126_0055230 3300048929 Bacteria 3594
364 Ga0496126_0075455 3300048929 Bacteria 2992
365 Ga0496126_0123734 3300048929 Bacteria 2240
366 Ga0496126_0718993 3300048929 Bacteria 774
367 Ga0501031_0182255 3300049568 Bacteria 1372
368 Ga0501033_0269361 3300049570 Bacteria 1204
369 Ga0501034_0016860 3300049571 Bacteria 7490
370 Ga0501034_0233353 3300049571 Bacteria 1788
371 Ga0501034_0723862 3300049571 Bacteria 892
372 Ga0501036_0027347 3300049572 Bacteria 4820
373 Ga0501038_0115651 3300049574 Bacteria 2217
374 Ga0501043_0033130 3300049579 Bacteria 4064
375 Ga0501043_0675005 3300049579 Bacteria 757
376 Ga0501046_0227003 3300049580 Bacteria 1381
377 Ga0501047_0123822 3300049581 Bacteria 2466
378 Ga0501069_0402772 3300049585 Bacteria 810
379 Ga0501072_0072408 3300049588 Bacteria 2724
380 Ga0501238_004074 3300049671 Bacteria 1815
381 Ga0501035_0146667 3300049822 Bacteria 2049
382 Ga0501035_0846324 3300049822 Bacteria 728
383 Ga0501044_0514478 3300049823 Bacteria 1097
384 nmdc:mga03683_76904_c1 3300050489 Bacteria 1435
385 nmdc:mga03n38_58882_c1 3300050490 Bacteria 1742
386 nmdc:mga00v17_11616_c1 3300050491 Bacteria 4842
387 nmdc:mga00v17_151698_c1 3300050491 Bacteria 1489
388 nmdc:mga00v17_36504_c1 3300050491 Bacteria 2929
389 nmdc:mga00v17_64825_c1 3300050491 Bacteria 2252
390 nmdc:mga00v17_96272_c1 3300050491 Bacteria 1864
391 nmdc:mga0yw44_2514_c1 3300050492 Bacteria 7850
392 nmdc:mga0yw44_3839_c2 3300050492 Bacteria 6454
393 nmdc:mga0k408_95091_c1 3300050493 Bacteria 1753
394 nmdc:mga06z11_201392_c1 3300050494 Bacteria 1157
395 nmdc:mga06z11_54500_c1 3300050494 Bacteria 2061
396 nmdc:mga04h51_1708_c2 3300050495 Bacteria 2638
397 nmdc:mga0sz30_28709_c1 3300050516 Bacteria 2290
398 nmdc:mga0sz30_9661_c1 3300050516 Bacteria 3677
399 Ga0500643_047649 3300053087 Bacteria 1234
400 Ga0500644_0000126 3300053088 Bacteria 47091
401 Ga0500562_000357 3300053108 Bacteria 11000
402 Ga0500572_028440 3300053111 Bacteria 1539
403 Ga0500594_0013912 3300053118 Bacteria 1920
404 Ga0500618_000175 3300053125 Bacteria 53230
405 Ga0500618_000271 3300053125 Bacteria 39933
406 Ga0500564_000018 3300053138 Bacteria 52235
407 Ga0500568_0005312 3300053139 Bacteria 6690
408 Ga0500568_0009166 3300053139 Bacteria 4718
409 Ga0500589_099692 3300053147 Bacteria 1264
410 Ga0500616_0115592 3300053153 Bacteria 1289
411 Ga0500622_0000744 3300053156 Bacteria 28423
412 Ga0500622_0000802 3300053156 Bacteria 27018
413 Ga0500565_027847 3300053734 Bacteria 725
414 Ga0500661_031952 3300055283 Bacteria 929

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025972 Ga0207668_11364482 Ga0207668_113644821 123
2 3300048924 Ga0496121_0207165 Ga0496121_0207165_14_403 124
3 iso_pu_bacteria 2961064222 2961067255 131
4 3300003856 Ga0058692_1003142 Ga0058692_10031426 132
5 3300044694 Ga0466963_1156503 Ga0466963_1156503_82_501 138
6 iso_pu_bacteria 8056875544 8056879752 139
7 3300048927 Ga0496124_0000343 Ga0496124_0000343_40474_40911 140
8 3300048927 Ga0496124_0002387 Ga0496124_0002387_17908_18345 140
9 3300003320 rootH2_10095370 rootH2_100953702 141
10 3300014968 Ga0157379_11889148 Ga0157379_118891482 141
11 3300048903 Ga0496100_0556200 Ga0496100_0556200_398_826 141
12 3300048904 Ga0496101_0288731 Ga0496101_0288731_641_1069 141
13 3300048905 Ga0496102_0335492 Ga0496102_0335492_615_1043 141
14 3300048911 Ga0496108_0087045 Ga0496108_0087045_489_917 141
15 3300048912 Ga0496109_0562075 Ga0496109_0562075_514_939 141
16 3300048913 Ga0496110_0165068 Ga0496110_0165068_1476_1901 141
17 3300048914 Ga0496111_0000414 Ga0496111_0000414_2144_2569 141
18 3300048919 Ga0496116_0111482 Ga0496116_0111482_464_892 141
19 3300048920 Ga0496117_0033430 Ga0496117_0033430_1913_2341 141
20 3300048921 Ga0496118_0048330 Ga0496118_0048330_321_749 141
21 3300048924 Ga0496121_0105183 Ga0496121_0105183_1340_1768 141
22 3300048925 Ga0496122_0022132 Ga0496122_0022132_3433_3858 141
23 3300048926 Ga0496123_0051032 Ga0496123_0051032_1320_1745 141
24 3300048927 Ga0496124_0087178 Ga0496124_0087178_1502_1927 141
25 3300048928 Ga0496125_0040872 Ga0496125_0040872_996_1424 141
26 3300049579 Ga0501043_0675005 Ga0501043_0675005_55_483 141
27 3300046471 Ga0495650_0024418 Ga0495650_0024418_170_601 142
28 3300046512 Ga0495610_0309036 Ga0495610_0309036_43_471 142
29 3300046524 Ga0495648_0000068 Ga0495648_0000068_114364_114795 142
30 3300047469 Ga0495673_0000191 Ga0495673_0000191_71422_71853 142
31 3300047472 Ga0495686_0322687 Ga0495686_0322687_370_798 142
32 3300053087 Ga0500643_047649 Ga0500643_047649_367_798 142
33 3300053088 Ga0500644_0000126 Ga0500644_0000126_22596_23027 142
34 3300053125 Ga0500618_000271 Ga0500618_000271_14057_14485 142
35 3300053138 Ga0500564_000018 Ga0500564_000018_27989_28420 142
36 3300055283 Ga0500661_031952 Ga0500661_031952_104_535 142
37 3300041498 Ga0451841_0961763 Ga0451841_0961763_15_461 143
38 3300046530 Ga0495654_0000655 Ga0495654_0000655_13613_14044 143
39 3300048926 Ga0496123_0003353 Ga0496123_0003353_17658_18104 143
40 3300048927 Ga0496124_0611769 Ga0496124_0611769_243_674 143
41 3300053118 Ga0500594_0013912 Ga0500594_0013912_1467_1907 144
42 3300048920 Ga0496117_0001193 Ga0496117_0001193_15562_15999 145
43 3300048925 Ga0496122_0000266 Ga0496122_0000266_19262_19699 145
44 3300048926 Ga0496123_0000018 Ga0496123_0000018_197307_197744 145
45 3300048927 Ga0496124_0002508 Ga0496124_0002508_6821_7258 145
46 3300048928 Ga0496125_0012454 Ga0496125_0012454_6880_7317 145
47 3300048929 Ga0496126_0001062 Ga0496126_0001062_39030_39467 145
48 3300049568 Ga0501031_0182255 Ga0501031_0182255_724_1161 145
49 3300049570 Ga0501033_0269361 Ga0501033_0269361_11_448 145
50 3300049571 Ga0501034_0016860 Ga0501034_0016860_5605_6042 145
51 3300049571 Ga0501034_0233353 Ga0501034_0233353_1167_1604 145
52 3300049572 Ga0501036_0027347 Ga0501036_0027347_1568_2005 145
53 3300049574 Ga0501038_0115651 Ga0501038_0115651_1629_2066 145
54 3300049579 Ga0501043_0033130 Ga0501043_0033130_1703_2140 145
55 3300049822 Ga0501035_0146667 Ga0501035_0146667_870_1307 145
56 3300049822 Ga0501035_0846324 Ga0501035_0846324_212_679 145
57 3300049823 Ga0501044_0514478 Ga0501044_0514478_577_1014 145
58 iso_pu_bacteria 2599185210 2599601546 146
59 iso_pu_bacteria 2600255279 2601610190 146
60 iso_pu_bacteria 2600255308 2601746964 146
61 iso_pu_bacteria 2818991439 2819557124 146
62 iso_pu_bacteria 2838675328 2838675890 146
63 iso_pu_bacteria 2838714209 2838714772 146
64 iso_pu_bacteria 2838719591 2838721427 146
65 iso_pu_bacteria 2838724970 2838725532 146
66 iso_pu_bacteria 2842130223 2842130785 146
67 iso_pu_bacteria 2842152218 2842154045 146
68 iso_pu_bacteria 2842170452 2842171016 146
69 iso_pu_bacteria 2842175837 2842177665 146
70 iso_pu_bacteria 2842187318 2842187881 146
71 iso_pu_bacteria 2842211629 2842212192 146
72 iso_pu_bacteria 2842224351 2842226189 146
73 iso_pu_bacteria 2899792073 2899796171 146
74 iso_pu_bacteria 2919114240 2919114863 146
75 iso_pu_bacteria 2926754445 2926755827 146
76 iso_pu_bacteria 2933006813 2933008690 146
77 iso_pu_bacteria 2933594066 2933596709 146
78 iso_pu_bacteria 2979100975 2979102155 146
79 iso_pu_bacteria 2984509177 2984509896 146
80 iso_pu_bacteria 2984518228 2984519406 146
81 iso_pu_bacteria 2984537506 2984538236 146
82 iso_pu_bacteria 2984601300 2984604989 146
83 iso_pu_bacteria 8003570095 8003575392 146
84 3300005444 Ga0070694_100658405 Ga0070694_1006584052 147
85 3300005841 Ga0068863_102450535 Ga0068863_1024505351 147
86 3300005983 Ga0081540_1002610 Ga0081540_100261015 147
87 3300005983 Ga0081540_1160956 Ga0081540_11609562 147
88 3300006042 Ga0075368_10003410 Ga0075368_100034102 147
89 3300006048 Ga0075363_100011210 Ga0075363_1000112103 147
90 3300006051 Ga0075364_10002070 Ga0075364_1000207012 147
91 3300006178 Ga0075367_10013316 Ga0075367_100133162 147
92 3300006186 Ga0075369_10023370 Ga0075369_100233702 147
93 3300006195 Ga0075366_10106349 Ga0075366_101063492 147
94 3300006353 Ga0075370_10014175 Ga0075370_100141752 147
95 3300026088 Ga0207641_12130053 Ga0207641_121300531 147
96 3300027866 Ga0209813_10024786 Ga0209813_100247862 147
97 3300032005 Ga0307411_10500415 Ga0307411_105004152 147
98 3300048927 Ga0496124_0000125 Ga0496124_0000125_99744_100190 147
99 3300048928 Ga0496125_0171183 Ga0496125_0171183_663_1109 147
100 3300049588 Ga0501072_0072408 Ga0501072_0072408_1536_1985 147
101 3300050490 nmdc:mga03n38_58882_c1 nmdc:mga03n38_58882_c1_332_778 147
102 3300050491 nmdc:mga00v17_11616_c1 nmdc:mga00v17_11616_c1_3206_3652 147
103 3300050493 nmdc:mga0k408_95091_c1 nmdc:mga0k408_95091_c1_758_1204 147
104 3300050494 nmdc:mga06z11_201392_c1 nmdc:mga06z11_201392_c1_490_936 147
105 3300050495 nmdc:mga04h51_1708_c2 nmdc:mga04h51_1708_c2_1946_2392 147
106 3300050516 nmdc:mga0sz30_28709_c1 nmdc:mga0sz30_28709_c1_1191_1637 147
107 3300053108 Ga0500562_000357 Ga0500562_000357_8563_9009 147
108 3300053111 Ga0500572_028440 Ga0500572_028440_355_798 147
109 iso_pu_bacteria 2513237139 2513877001 147
110 iso_pu_bacteria 2547132130 2547501320 147
111 iso_pu_bacteria 2747842428 2747949785 147
112 iso_pu_bacteria 2765235840 2765579173 147
113 iso_pu_bacteria 2791355196 2793065108 147
114 iso_pu_bacteria 2816332141 2816517118 147
115 iso_pu_bacteria 2824696289 2824698298 147
116 iso_pu_bacteria 2842391507 2842392284 147
117 iso_pu_bacteria 2919134579 2919136008 147
118 3300005466 Ga0070685_10009822 Ga0070685_100098223 148
119 3300005548 Ga0070665_100125502 Ga0070665_1001255022 148
120 3300021384 Ga0213876_10166090 Ga0213876_101660902 148
121 3300028379 Ga0268266_10135160 Ga0268266_101351602 148
122 3300039437 Ga0436365_1786926 Ga0436365_1786926_736_1185 148
123 3300039437 Ga0436365_1921538 Ga0436365_1921538_1349_1798 148
124 3300047472 Ga0495686_0007423 Ga0495686_0007423_2426_2872 148
125 iso_pu_bacteria 2600254933 2600375790 148
126 iso_pu_bacteria 2643221558 2643814007 148
127 iso_pu_bacteria 2791355253 2793283564 148
128 iso_pu_bacteria 2852649853 2852650394 148
129 iso_pu_bacteria 2891373044 2891376799 148
130 iso_pu_bacteria 2919085039 2919088589 148
131 iso_pu_bacteria 2939589442 2939589944 148
132 iso_pu_bacteria 2941475908 2941476239 148
133 iso_pu_bacteria 2974307012 2974307511 148
134 iso_pu_bacteria 2977247770 2977248224 148
135 iso_pu_bacteria 2984514374 2984517286 148
136 iso_pu_bacteria 2989349275 2989351195 148
137 iso_pu_bacteria 8018150411 8018152893 148
138 3300002741 JGI25157J39369_1015824 JGI25157J39369_10158242 149
139 3300003320 rootH2_10030123 rootH2_100301232 149
140 3300005331 Ga0070670_100000246 Ga0070670_10000024628 149
141 3300005335 Ga0070666_10057638 Ga0070666_100576382 149
142 3300005335 Ga0070666_10364830 Ga0070666_103648302 149
143 3300005347 Ga0070668_100001369 Ga0070668_10000136916 149
144 3300005347 Ga0070668_100349331 Ga0070668_1003493312 149
145 3300005353 Ga0070669_100829183 Ga0070669_1008291832 149
146 3300005367 Ga0070667_100000206 Ga0070667_10000020634 149
147 3300005548 Ga0070665_100002062 Ga0070665_1000020629 149
148 3300005564 Ga0070664_100795442 Ga0070664_1007954422 149
149 3300005617 Ga0068859_100163742 Ga0068859_1001637422 149
150 3300005618 Ga0068864_100000167 Ga0068864_10000016744 149
151 3300005618 Ga0068864_100082128 Ga0068864_1000821282 149
152 3300005719 Ga0068861_100655471 Ga0068861_1006554712 149
153 3300005841 Ga0068863_100000562 Ga0068863_1000005626 149
154 3300005842 Ga0068858_100026687 Ga0068858_1000266874 149
155 3300005843 Ga0068860_100000851 Ga0068860_10000085113 149
156 3300005844 Ga0068862_100000445 Ga0068862_10000044528 149
157 3300006931 Ga0097620_100163742 Ga0097620_1001637422 149
158 3300009177 Ga0105248_10049361 Ga0105248_100493615 149
159 3300009553 Ga0105249_10000581 Ga0105249_1000058123 149
160 3300013306 Ga0163162_10059767 Ga0163162_100597673 149
161 3300014325 Ga0163163_11393526 Ga0163163_113935262 149
162 3300021384 Ga0213876_10041053 Ga0213876_100410532 149
163 3300025250 Ga0209026_1000674 Ga0209026_10006749 149
164 3300025900 Ga0207710_10066447 Ga0207710_100664472 149
165 3300025903 Ga0207680_10003381 Ga0207680_100033814 149
166 3300025903 Ga0207680_10186258 Ga0207680_101862582 149
167 3300025925 Ga0207650_10000031 Ga0207650_10000031191 149
168 3300025941 Ga0207711_10040259 Ga0207711_100402592 149
169 3300025961 Ga0207712_10002141 Ga0207712_1000214111 149
170 3300025972 Ga0207668_10000978 Ga0207668_100009786 149
171 3300025986 Ga0207658_10000581 Ga0207658_1000058119 149
172 3300026035 Ga0207703_10007540 Ga0207703_100075402 149
173 3300026088 Ga0207641_10000697 Ga0207641_100006975 149
174 3300026095 Ga0207676_10002092 Ga0207676_100020928 149
175 3300026095 Ga0207676_10015718 Ga0207676_100157183 149
176 3300026118 Ga0207675_100626578 Ga0207675_1006265782 149
177 3300028379 Ga0268266_10006655 Ga0268266_100066553 149
178 3300028380 Ga0268265_10000923 Ga0268265_1000092312 149
179 3300028381 Ga0268264_10000361 Ga0268264_1000036128 149
180 3300031911 Ga0307412_10296001 Ga0307412_102960012 149
181 3300037853 Ga0436364_1485238 Ga0436364_1485238_44_496 149
182 3300039437 Ga0436365_0752820 Ga0436365_0752820_1301_1753 149
183 3300048905 Ga0496102_0015254 Ga0496102_0015254_925_1377 149
184 3300048905 Ga0496102_1021933 Ga0496102_1021933_281_733 149
185 3300048906 Ga0496103_0569845 Ga0496103_0569845_244_696 149
186 3300048909 Ga0496106_0589371 Ga0496106_0589371_139_591 149
187 3300048910 Ga0496107_1349692 Ga0496107_1349692_46_498 149
188 3300048924 Ga0496121_0475430 Ga0496121_0475430_259_711 149
189 3300048929 Ga0496126_0020866 Ga0496126_0020866_1583_2035 149
190 3300049671 Ga0501238_004074 Ga0501238_004074_943_1392 149
191 3300003578 Ga0006562J51391_1018820 Ga0006562J51391_10188202 150
192 3300005548 Ga0070665_100046804 Ga0070665_1000468044 150
193 3300005614 Ga0068856_100968775 Ga0068856_1009687752 150
194 3300006051 Ga0075364_10030037 Ga0075364_100300374 150
195 3300006051 Ga0075364_10773248 Ga0075364_107732481 150
196 3300006178 Ga0075367_10028106 Ga0075367_100281062 150
197 3300006186 Ga0075369_10000346 Ga0075369_1000034614 150
198 3300006948 Ga0099826_10000098 Ga0099826_1000009824 150
199 3300009545 Ga0105237_10738604 Ga0105237_107386042 150
200 3300013297 Ga0157378_10801448 Ga0157378_108014482 150
201 3300015261 Ga0182006_1045751 Ga0182006_10457514 150
202 3300017792 Ga0163161_10364652 Ga0163161_103646522 150
203 3300017792 Ga0163161_10808475 Ga0163161_108084752 150
204 3300021384 Ga0213876_10007385 Ga0213876_100073852 150
205 3300026078 Ga0207702_10805112 Ga0207702_108051122 150
206 3300027312 Ga0209371_1000003 Ga0209371_1000003859 150
207 3300027666 Ga0209282_1000147 Ga0209282_100014726 150
208 3300028379 Ga0268266_10047537 Ga0268266_100475372 150
209 3300030500 Ga0268256_1000004 Ga0268256_1000004191 150
210 3300030744 Ga0316181_1262216 Ga0316181_12622166 150
211 3300031995 Ga0307409_100294857 Ga0307409_1002948572 150
212 3300039437 Ga0436365_1668047 Ga0436365_1668047_286_741 150
213 3300044842 Ga0466957_0281907 Ga0466957_0281907_218_673 150
214 3300046499 Ga0495594_0036449 Ga0495594_0036449_1299_1754 150
215 3300047315 Ga0495581_0047506 Ga0495581_0047506_1035_1490 150
216 3300048924 Ga0496121_0000710 Ga0496121_0000710_35207_35662 150
217 3300049571 Ga0501034_0723862 Ga0501034_0723862_159_614 150
218 3300053156 Ga0500622_0000744 Ga0500622_0000744_25087_25542 150
219 3300053156 Ga0500622_0000802 Ga0500622_0000802_15383_15838 150
220 3300002773 JGI25152J39213_1000307 JGI25152J39213_100030718 151
221 3300002774 JGI25150J39212_1000215 JGI25150J39212_100021511 151
222 3300003187 JGI25151J46595_10000068 JGI25151J46595_1000006811 151
223 3300003215 JGI25153J46596_10000051 JGI25153J46596_1000005111 151
224 3300003316 rootH1_10004706 rootH1_100047062 151
225 3300003320 rootH2_10098947 rootH2_100989473 151
226 3300003322 rootL2_10066715 rootL2_100667152 151
227 3300003781 Ga0055536_1002980 Ga0055536_10029805 151
228 3300003856 Ga0058692_1000044 Ga0058692_100004465 151
229 3300005985 Ga0081539_10084810 Ga0081539_100848102 151
230 3300006186 Ga0075369_10230920 Ga0075369_102309202 151
231 3300025245 Ga0207425_1000011 Ga0207425_1000011244 151
232 3300025258 Ga0209129_1000031 Ga0209129_100003158 151
233 3300025292 Ga0209676_1000075 Ga0209676_100007573 151
234 3300025294 Ga0209025_1000012 Ga0209025_1000012557 151
235 3300025297 Ga0209758_1000018 Ga0209758_1000018100 151
236 3300025303 Ga0209051_1134098 Ga0209051_11340982 151
237 3300027312 Ga0209371_1000023 Ga0209371_1000023112 151
238 3300030500 Ga0268256_1000023 Ga0268256_1000023328 151
239 3300038705 Ga0237819_00003 Ga0237819_00003_25046_25519 151
240 3300044683 Ga0466965_0040153 Ga0466965_0040153_1018_1476 151
241 3300044694 Ga0466963_0129720 Ga0466963_0129720_603_1064 151
242 3300044735 Ga0466968_0015022 Ga0466968_0015022_2390_2851 151
243 3300045049 Ga0466959_1186808 Ga0466959_1186808_22_480 151
244 3300045976 Ga0466967_2101012 Ga0466967_2101012_45_500 151
245 3300048918 Ga0496115_0227309 Ga0496115_0227309_996_1454 151
246 3300048921 Ga0496118_0212184 Ga0496118_0212184_196_669 151
247 3300048922 Ga0496119_0000450 Ga0496119_0000450_48733_49200 151
248 3300048923 Ga0496120_0191252 Ga0496120_0191252_12_479 151
249 3300048925 Ga0496122_0243238 Ga0496122_0243238_515_982 151
250 3300048929 Ga0496126_0718993 Ga0496126_0718993_79_537 151
251 3300002739 JGI25158J39367_1000044 JGI25158J39367_100004412 152
252 3300002773 JGI25152J39213_1000303 JGI25152J39213_100030314 152
253 3300002987 JGI25159J45721_1000067 JGI25159J45721_100006747 152
254 3300002987 JGI25159J45721_1028823 JGI25159J45721_10288232 152
255 3300003215 JGI25153J46596_10000245 JGI25153J46596_1000024514 152
256 3300003323 rootH1_10216064 rootH1_102160643 152
257 3300003354 JGI25160J50197_1000297 JGI25160J50197_100029724 152
258 3300003374 JGI25161J50226_1000045 JGI25161J50226_100004525 152
259 3300003771 Ga0055526_1000824 Ga0055526_100082413 152
260 3300003771 Ga0055526_1001795 Ga0055526_10017954 152
261 3300003773 Ga0055537_1000252 Ga0055537_10002524 152
262 3300003775 Ga0055524_1000902 Ga0055524_10009025 152
263 3300003775 Ga0055524_1047974 Ga0055524_10479741 152
264 3300003784 Ga0055534_1000075 Ga0055534_100007544 152
265 3300003790 Ga0055528_1000271 Ga0055528_100027140 152
266 3300003790 Ga0055528_1043905 Ga0055528_10439051 152
267 3300003791 Ga0055530_10000771 Ga0055530_100007716 152
268 3300003791 Ga0055530_10000810 Ga0055530_1000081019 152
269 3300003792 Ga0055540_1001005 Ga0055540_100100510 152
270 3300003794 Ga0055531_10013004 Ga0055531_100130043 152
271 3300003794 Ga0055531_10027771 Ga0055531_100277712 152
272 3300003794 Ga0055531_10041179 Ga0055531_100411792 152
273 3300004625 Ga0055543_1000142 Ga0055543_100014228 152
274 3300005262 Ga0065165_1000456 Ga0065165_100045617 152
275 3300005262 Ga0065165_1006668 Ga0065165_10066683 152
276 3300005262 Ga0065165_1084230 Ga0065165_10842302 152
277 3300005262 Ga0065165_1115965 Ga0065165_11159652 152
278 3300005333 Ga0070677_10101269 Ga0070677_101012692 152
279 3300005548 Ga0070665_100019103 Ga0070665_1000191036 152
280 3300005548 Ga0070665_101014516 Ga0070665_1010145161 152
281 3300005548 Ga0070665_101541522 Ga0070665_1015415221 152
282 3300005577 Ga0068857_100382471 Ga0068857_1003824712 152
283 3300006038 Ga0075365_10009640 Ga0075365_100096406 152
284 3300006038 Ga0075365_10016388 Ga0075365_100163885 152
285 3300006042 Ga0075368_10318568 Ga0075368_103185682 152
286 3300006051 Ga0075364_10120601 Ga0075364_101206012 152
287 3300006051 Ga0075364_10524637 Ga0075364_105246372 152
288 3300006178 Ga0075367_10181087 Ga0075367_101810872 152
289 3300006186 Ga0075369_10252502 Ga0075369_102525022 152
290 3300006948 Ga0099826_10118639 Ga0099826_101186392 152
291 3300009011 Ga0105251_10021575 Ga0105251_100215752 152
292 3300009036 Ga0105244_10068168 Ga0105244_100681682 152
293 3300009545 Ga0105237_10413434 Ga0105237_104134342 152
294 3300009551 Ga0105238_10056430 Ga0105238_100564302 152
295 3300010375 Ga0105239_10045424 Ga0105239_100454243 152
296 3300013100 Ga0157373_10017517 Ga0157373_100175172 152
297 3300013100 Ga0157373_10034090 Ga0157373_100340902 152
298 3300013100 Ga0157373_10831934 Ga0157373_108319342 152
299 3300013102 Ga0157371_10000206 Ga0157371_1000020635 152
300 3300013102 Ga0157371_10182641 Ga0157371_101826412 152
301 3300013102 Ga0157371_10500472 Ga0157371_105004722 152
302 3300013104 Ga0157370_10001495 Ga0157370_100014953 152
303 3300013104 Ga0157370_10007589 Ga0157370_100075893 152
304 3300013104 Ga0157370_10138120 Ga0157370_101381202 152
305 3300013105 Ga0157369_10021447 Ga0157369_100214473 152
306 3300013306 Ga0163162_10305446 Ga0163162_103054462 152
307 3300013307 Ga0157372_12142582 Ga0157372_121425822 152
308 3300014497 Ga0182008_10000051 Ga0182008_1000005170 152
309 3300014497 Ga0182008_10061597 Ga0182008_100615971 152
310 3300014497 Ga0182008_10074802 Ga0182008_100748022 152
311 3300015261 Ga0182006_1010535 Ga0182006_10105353 152
312 3300015261 Ga0182006_1024073 Ga0182006_10240732 152
313 3300015261 Ga0182006_1071515 Ga0182006_10715151 152
314 3300015262 Ga0182007_10000061 Ga0182007_1000006154 152
315 3300015262 Ga0182007_10048750 Ga0182007_100487502 152
316 3300015265 Ga0182005_1000019 Ga0182005_1000019182 152
317 3300015265 Ga0182005_1001189 Ga0182005_10011892 152
318 3300017792 Ga0163161_10001084 Ga0163161_1000108413 152
319 3300017792 Ga0163161_10014285 Ga0163161_100142855 152
320 3300017792 Ga0163161_10016445 Ga0163161_100164452 152
321 3300017792 Ga0163161_10085080 Ga0163161_100850802 152
322 3300025208 Ga0209436_100001 Ga0209436_100001222 152
323 3300025208 Ga0209436_100003 Ga0209436_10000321 152
324 3300025245 Ga0207425_1000815 Ga0207425_10008156 152
325 3300025258 Ga0209129_1000405 Ga0209129_100040512 152
326 3300025263 Ga0209565_1000050 Ga0209565_1000050129 152
327 3300025273 Ga0209673_1000199 Ga0209673_100019932 152
328 3300025273 Ga0209673_1000397 Ga0209673_100039784 152
329 3300025273 Ga0209673_1034855 Ga0209673_10348552 152
330 3300025284 Ga0209130_1000049 Ga0209130_1000049111 152
331 3300025284 Ga0209130_1007297 Ga0209130_10072974 152
332 3300025291 Ga0209675_1000007 Ga0209675_1000007455 152
333 3300025291 Ga0209675_1006525 Ga0209675_10065254 152
334 3300025292 Ga0209676_1000018 Ga0209676_1000018132 152
335 3300025294 Ga0209025_1000416 Ga0209025_10004165 152
336 3300025295 Ga0209564_1000061 Ga0209564_1000061228 152
337 3300025295 Ga0209564_1001168 Ga0209564_100116825 152
338 3300025295 Ga0209564_1009339 Ga0209564_10093395 152
339 3300025297 Ga0209758_1000175 Ga0209758_100017597 152
340 3300025297 Ga0209758_1002975 Ga0209758_10029755 152
341 3300025297 Ga0209758_1018578 Ga0209758_10185783 152
342 3300025298 Ga0209050_1000424 Ga0209050_100042437 152
343 3300025298 Ga0209050_1000610 Ga0209050_100061036 152
344 3300025298 Ga0209050_1028962 Ga0209050_10289622 152
345 3300025299 Ga0209256_1000379 Ga0209256_10003795 152
346 3300025299 Ga0209256_1004229 Ga0209256_10042292 152
347 3300025299 Ga0209256_1004926 Ga0209256_10049269 152
348 3300025299 Ga0209256_1024872 Ga0209256_10248722 152
349 3300025302 Ga0207426_1000043 Ga0207426_1000043107 152
350 3300025303 Ga0209051_1002213 Ga0209051_100221311 152
351 3300025304 Ga0209257_1000035 Ga0209257_1000035132 152
352 3300025304 Ga0209257_1000667 Ga0209257_100066724 152
353 3300025304 Ga0209257_1004768 Ga0209257_100476810 152
354 3300025304 Ga0209257_1015854 Ga0209257_10158542 152
355 3300025304 Ga0209257_1016638 Ga0209257_10166382 152
356 3300025315 Ga0207697_10466025 Ga0207697_104660251 152
357 3300025735 Ga0207713_1020455 Ga0207713_10204552 152
358 3300025893 Ga0207682_10171542 Ga0207682_101715422 152
359 3300025914 Ga0207671_10875835 Ga0207671_108758351 152
360 3300025924 Ga0207694_10220182 Ga0207694_102201822 152
361 3300028379 Ga0268266_10039994 Ga0268266_100399942 152
362 3300028379 Ga0268266_10064957 Ga0268266_100649572 152
363 3300028379 Ga0268266_10934245 Ga0268266_109342452 152
364 3300030732 Ga0316176_1191301 Ga0316176_11913014 152
365 3300032005 Ga0307411_10931762 Ga0307411_109317621 152
366 3300032126 Ga0307415_102419805 Ga0307415_1024198051 152
367 3300041494 Ga0451837_1623979 Ga0451837_1623979_119_592 152
368 3300041512 Ga0451853_2511842 Ga0451853_2511842_129_602 152
369 3300042006 Ga0439432_002062 Ga0439432_002062_6394_6867 152
370 3300044683 Ga0466965_0107437 Ga0466965_0107437_337_795 152
371 3300044735 Ga0466968_0040051 Ga0466968_0040051_1366_1824 152
372 3300044765 Ga0466970_0288579 Ga0466970_0288579_81_539 152
373 3300046453 Ga0495627_001035 Ga0495627_001035_8706_9179 152
374 3300046458 Ga0495591_006879 Ga0495591_006879_3904_4377 152
375 3300046460 Ga0495638_0000409 Ga0495638_0000409_21381_21854 152
376 3300046512 Ga0495610_0001846 Ga0495610_0001846_12970_13443 152
377 3300046515 Ga0495620_0190053 Ga0495620_0190053_161_634 152
378 3300046518 Ga0495631_0000377 Ga0495631_0000377_19074_19547 152
379 3300046522 Ga0495643_0000599 Ga0495643_0000599_18241_18714 152
380 3300046558 Ga0495633_0035410 Ga0495633_0035410_298_771 152
381 3300046616 Ga0495668_0113258 Ga0495668_0113258_963_1427 152
382 3300046660 Ga0495625_0012191 Ga0495625_0012191_3001_3474 152
383 3300046660 Ga0495625_0030042 Ga0495625_0030042_783_1256 152
384 3300047320 Ga0495672_0000417 Ga0495672_0000417_32567_33040 152
385 3300047320 Ga0495672_0046219 Ga0495672_0046219_1683_2147 152
386 3300047472 Ga0495686_0005207 Ga0495686_0005207_6489_6962 152
387 3300048907 Ga0496104_0006605 Ga0496104_0006605_5264_5737 152
388 3300048908 Ga0496105_0038051 Ga0496105_0038051_164_637 152
389 3300048919 Ga0496116_0001793 Ga0496116_0001793_10893_11366 152
390 3300048919 Ga0496116_0005203 Ga0496116_0005203_8719_9192 152
391 3300048919 Ga0496116_0057114 Ga0496116_0057114_972_1445 152
392 3300048919 Ga0496116_0083453 Ga0496116_0083453_589_1062 152
393 3300048920 Ga0496117_0000437 Ga0496117_0000437_50743_51216 152
394 3300048920 Ga0496117_0001821 Ga0496117_0001821_2364_2837 152
395 3300048920 Ga0496117_0005990 Ga0496117_0005990_3894_4367 152
396 3300048920 Ga0496117_0128323 Ga0496117_0128323_137_610 152
397 3300048920 Ga0496117_0426858 Ga0496117_0426858_29_502 152
398 3300048921 Ga0496118_0000430 Ga0496118_0000430_50755_51228 152
399 3300048921 Ga0496118_0000500 Ga0496118_0000500_22581_23054 152
400 3300048921 Ga0496118_0003117 Ga0496118_0003117_16572_17045 152
401 3300048921 Ga0496118_0004086 Ga0496118_0004086_90_563 152
402 3300048921 Ga0496118_0117800 Ga0496118_0117800_1209_1682 152
403 3300048922 Ga0496119_0000209 Ga0496119_0000209_32582_33055 152
404 3300048923 Ga0496120_0000271 Ga0496120_0000271_35549_36022 152
405 3300048924 Ga0496121_0002335 Ga0496121_0002335_25662_26135 152
406 3300048924 Ga0496121_0016520 Ga0496121_0016520_1983_2456 152
407 3300048924 Ga0496121_0352190 Ga0496121_0352190_415_873 152
408 3300048925 Ga0496122_0000967 Ga0496122_0000967_14289_14762 152
409 3300048925 Ga0496122_0004676 Ga0496122_0004676_12064_12537 152
410 3300048925 Ga0496122_0005071 Ga0496122_0005071_4292_4765 152
411 3300048925 Ga0496122_0055577 Ga0496122_0055577_1228_1701 152
412 3300048925 Ga0496122_0072967 Ga0496122_0072967_1264_1737 152
413 3300048926 Ga0496123_0000435 Ga0496123_0000435_67261_67719 152
414 3300048926 Ga0496123_0002356 Ga0496123_0002356_4520_4993 152
415 3300048926 Ga0496123_0007663 Ga0496123_0007663_2959_3432 152
416 3300048926 Ga0496123_0009885 Ga0496123_0009885_4441_4914 152
417 3300048926 Ga0496123_0170288 Ga0496123_0170288_449_922 152
418 3300048927 Ga0496124_0000584 Ga0496124_0000584_26285_26758 152
419 3300048927 Ga0496124_0001573 Ga0496124_0001573_7487_7960 152
420 3300048927 Ga0496124_0001983 Ga0496124_0001983_22390_22863 152
421 3300048927 Ga0496124_0002696 Ga0496124_0002696_8388_8861 152
422 3300048927 Ga0496124_0002972 Ga0496124_0002972_15019_15492 152
423 3300048927 Ga0496124_0005756 Ga0496124_0005756_12240_12713 152
424 3300048927 Ga0496124_0007613 Ga0496124_0007613_8109_8582 152
425 3300048927 Ga0496124_0018972 Ga0496124_0018972_912_1370 152
426 3300048927 Ga0496124_0052758 Ga0496124_0052758_1291_1752 152
427 3300048927 Ga0496124_0273991 Ga0496124_0273991_224_682 152
428 3300048927 Ga0496124_0402548 Ga0496124_0402548_68_541 152
429 3300048928 Ga0496125_0000144 Ga0496125_0000144_36940_37413 152
430 3300048928 Ga0496125_0000249 Ga0496125_0000249_35510_35983 152
431 3300048928 Ga0496125_0001175 Ga0496125_0001175_23758_24231 152
432 3300048928 Ga0496125_0017178 Ga0496125_0017178_3631_4104 152
433 3300048928 Ga0496125_0023652 Ga0496125_0023652_3904_4377 152
434 3300048928 Ga0496125_0030949 Ga0496125_0030949_3735_4208 152
435 3300048929 Ga0496126_0000795 Ga0496126_0000795_20553_21026 152
436 3300048929 Ga0496126_0037511 Ga0496126_0037511_498_971 152
437 3300048929 Ga0496126_0055230 Ga0496126_0055230_1792_2265 152
438 3300048929 Ga0496126_0075455 Ga0496126_0075455_1975_2448 152
439 3300048929 Ga0496126_0123734 Ga0496126_0123734_393_866 152
440 3300049581 Ga0501047_0123822 Ga0501047_0123822_29_496 152
441 3300049585 Ga0501069_0402772 Ga0501069_0402772_312_773 152
442 3300050491 nmdc:mga00v17_151698_c1 nmdc:mga00v17_151698_c1_891_1364 152
443 3300050491 nmdc:mga00v17_36504_c1 nmdc:mga00v17_36504_c1_1015_1488 152
444 3300050491 nmdc:mga00v17_96272_c1 nmdc:mga00v17_96272_c1_254_727 152
445 3300050492 nmdc:mga0yw44_2514_c1 nmdc:mga0yw44_2514_c1_2761_3234 152
446 3300050492 nmdc:mga0yw44_3839_c2 nmdc:mga0yw44_3839_c2_3994_4452 152
447 3300053125 Ga0500618_000175 Ga0500618_000175_27546_28004 152
448 3300053139 Ga0500568_0005312 Ga0500568_0005312_946_1410 152
449 3300053139 Ga0500568_0009166 Ga0500568_0009166_2320_2784 152
450 3300053147 Ga0500589_099692 Ga0500589_099692_383_847 152
451 3300053153 Ga0500616_0115592 Ga0500616_0115592_589_1053 152
452 3300053734 Ga0500565_027847 Ga0500565_027847_225_698 152
453 3300050489 nmdc:mga03683_76904_c1 nmdc:mga03683_76904_c1_584_1054 153
454 3300050491 nmdc:mga00v17_64825_c1 nmdc:mga00v17_64825_c1_1097_1567 153
455 3300050494 nmdc:mga06z11_54500_c1 nmdc:mga06z11_54500_c1_290_760 153
456 3300050516 nmdc:mga0sz30_9661_c1 nmdc:mga0sz30_9661_c1_1893_2363 153
457 3300049580 Ga0501046_0227003 Ga0501046_0227003_182_655 154
458 3300001989 JGI24739J22299_10160645 JGI24739J22299_101606452 155
459 3300003790 Ga0055528_1003154 Ga0055528_10031542 155
460 3300005337 Ga0070682_100023654 Ga0070682_1000236544 155
461 3300041413 Ga0439465_0000189 Ga0439465_0000189_11264_11731 155
462 3300048925 Ga0496122_0000559 Ga0496122_0000559_7584_8084 155
463 3300048926 Ga0496123_0117724 Ga0496123_0117724_96_563 155
464 3300048927 Ga0496124_0038845 Ga0496124_0038845_2436_2903 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

7

129

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3to5-assembly1.cif.gz_A high resolution structure of chey3 from vibrio cholerae 0.9319 7 136
2id7-assembly1.cif.gz_A 1.75 a structure of t87i phosphono-chey 0.9315 7 136
4lx8-assembly1.cif.gz_A crystal structure (2.2a) of mg2+ bound chey3 of vibrio cholerae 0.9309 7 136
1ab5-assembly2.cif.gz_B structure of chey mutant f14n, v21t 0.929 6 136
1ab6-assembly2.cif.gz_B structure of chey mutant f14n, v86t 0.9266 6 136
ID Description Score Start End Superfamily
4jp1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9288 8 136 3.40.50.2300
5brjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9084 5 144 3.40.50.2300
af_Q0D3B6_62_211_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9076 9 136 3.40.50.2300
af_Q1JSA0_6_124_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9073 10 134 3.40.50.2300
af_K7LHH0_84_250_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9062 9 136 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2G4E2G8-F1-model_v4 Chemotaxis protein CheY 0.9863 7 111 GO:0000160
AF-A0A2N6A3I8-F1-model_v4 Response regulatory domain-containing protein 0.9597 7 140 GO:0000160
AF-A0A2G4E2G8-F1-model_v4 Chemotaxis protein CheY 0.9591 7 111 GO:0000160
AF-A0A2V8A4Z5-F1-model_v4 Two-component system response regulator 0.954 5 120 GO:0000160
AF-J8V183-F1-model_v4 deleted 0.9479 7 105

Feature Viewer

pLDDT pTM Quality
81.73 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map