F449323

General Info

Members Datasets Scaffolds Average Seq Length
464 239 928 219

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10147681|Ga0265314_101476812
Length 232
Sequence VNVPAVLSPAVTRLIVKVGGAVAGESADRILGLVEEGHQVCVVHGAGPQITQEMRRRSIPVEFIGGRRRTTLAGLEVVRASMAEVNAELCAALGDLAVPVFGDRDGLLAVPVPPLGQVGDPLPCRPRRILAALDAGLVPVVAPLAVGPLNVNADDAAAALALGIGARTLVFLTDVPGLYVDGDVVDEIGVAEAERLLDAGAFEGGIVPKLRAAAIAAGRGVSAHIGRTTVVA

Samples

Sample ID Description Type Environment
1 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
106 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
107 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
108 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
121 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
122 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
134 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
135 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
136 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
137 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
138 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 1.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.78
Rhizosphere 89.22
Stem 0
Stem Tuber 0
Unclassified 1.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265314_10147681 3300031711 Bacteria 1446
2 Ga0070658_10477167 3300005327 Bacteria 1076
3 Ga0070683_100022473 3300005329 Bacteria 5636
4 Ga0070683_100241673 3300005329 Bacteria 1717
5 Ga0070683_100355414 3300005329 Bacteria 1395
6 Ga0070680_100021963 3300005336 Bacteria 5075
7 Ga0070680_100049234 3300005336 Bacteria 3434
8 Ga0070680_100299927 3300005336 Bacteria 1362
9 Ga0070682_100071850 3300005337 Bacteria 2216
10 Ga0068868_100123960 3300005338 Bacteria 2109
11 Ga0070660_100014598 3300005339 Bacteria 5665
12 Ga0070660_100116578 3300005339 Bacteria 2130
13 Ga0070660_100133674 3300005339 Bacteria 1986
14 Ga0070660_100257061 3300005339 Bacteria 1425
15 Ga0070661_100018310 3300005344 Bacteria 4978
16 Ga0070661_100023398 3300005344 Bacteria 4427
17 Ga0070661_100042913 3300005344 Bacteria 3302
18 Ga0070661_100092938 3300005344 Bacteria 2235
19 Ga0070675_100487696 3300005354 Archaea 1109
20 Ga0070671_100161757 3300005355 Bacteria 1892
21 Ga0070674_100064313 3300005356 Unclassified 2570
22 Ga0070659_100019410 3300005366 Bacteria 5151
23 Ga0070659_100026166 3300005366 Bacteria 4487
24 Ga0070659_100247128 3300005366 Bacteria 1478
25 Ga0070667_100107189 3300005367 Bacteria 2419
26 Ga0070709_10217806 3300005434 Bacteria 1360
27 Ga0070709_10662811 3300005434 Bacteria 809
28 Ga0070714_100051431 3300005435 Bacteria 3512
29 Ga0070714_100220536 3300005435 Bacteria 1743
30 Ga0070713_100062973 3300005436 Bacteria 3108
31 Ga0070713_100970684 3300005436 Bacteria 819
32 Ga0070711_100201307 3300005439 Bacteria 1537
33 Ga0070711_100306989 3300005439 Bacteria 1264
34 Ga0070711_100556886 3300005439 Bacteria 952
35 Ga0070708_100410509 3300005445 Bacteria 1277
36 Ga0070663_100460403 3300005455 Bacteria 1050
37 Ga0070678_100708028 3300005456 Bacteria 908
38 Ga0070681_10006856 3300005458 Bacteria 11085
39 Ga0070681_10016795 3300005458 Bacteria 7309
40 Ga0070681_10053018 3300005458 Bacteria 4042
41 Ga0070681_10236715 3300005458 Bacteria 1740
42 Ga0070681_10705812 3300005458 Bacteria 924
43 Ga0070681_10886074 3300005458 Bacteria 811
44 Ga0070706_100155845 3300005467 Bacteria 2132
45 Ga0070698_100398180 3300005471 Bacteria 1310
46 Ga0070699_100144332 3300005518 Bacteria 2103
47 Ga0070679_100015519 3300005530 Bacteria 7319
48 Ga0070679_100068761 3300005530 Bacteria 3532
49 Ga0070679_100091236 3300005530 Bacteria 3034
50 Ga0070679_100185719 3300005530 Bacteria 2049
51 Ga0070679_100192791 3300005530 Bacteria 2006
52 Ga0070679_100975220 3300005530 Bacteria 791
53 Ga0070684_100021794 3300005535 Bacteria 5336
54 Ga0070684_100036222 3300005535 Bacteria 4227
55 Ga0070684_100064333 3300005535 Bacteria 3217
56 Ga0068853_100069038 3300005539 Bacteria 3073
57 Ga0068853_100221027 3300005539 Unclassified 1730
58 Ga0068853_101035027 3300005539 Bacteria 791
59 Ga0070672_100471754 3300005543 Bacteria 1083
60 Ga0070686_100317082 3300005544 Bacteria 1161
61 Ga0070693_100004706 3300005547 Bacteria 6488
62 Ga0070693_100329992 3300005547 Bacteria 1038
63 Ga0070665_100618738 3300005548 Bacteria 1096
64 Ga0070704_100168570 3300005549 Bacteria 1739
65 Ga0068855_100162394 3300005563 Bacteria 2534
66 Ga0068855_100232467 3300005563 Bacteria 2063
67 Ga0068855_100238748 3300005563 Bacteria 2032
68 Ga0068855_100354997 3300005563 Bacteria 1614
69 Ga0068855_100581781 3300005563 Bacteria 1209
70 Ga0068855_100625495 3300005563 Bacteria 1159
71 Ga0070664_100003442 3300005564 Bacteria 12791
72 Ga0070664_100146853 3300005564 Bacteria 2080
73 Ga0068857_100027802 3300005577 Bacteria 4987
74 Ga0068857_100047621 3300005577 Bacteria 3806
75 Ga0068857_100050809 3300005577 Bacteria 3677
76 Ga0068854_100440626 3300005578 Bacteria 1086
77 Ga0068856_100024535 3300005614 Bacteria 5870
78 Ga0068856_100026260 3300005614 Bacteria 5679
79 Ga0068852_100099081 3300005616 Bacteria 2626
80 Ga0068852_100158344 3300005616 Bacteria 2112
81 Ga0068852_100362658 3300005616 Bacteria 1418
82 Ga0068852_101089764 3300005616 Bacteria 819
83 Ga0068851_10235596 3300005834 Bacteria 1033
84 Ga0068870_10042795 3300005840 Bacteria 2359
85 Ga0068858_101264618 3300005842 Bacteria 726
86 Ga0081455_10012984 3300005937 Bacteria 8260
87 Ga0070717_10276663 3300006028 Bacteria 1488
88 Ga0075432_10008501 3300006058 Bacteria 3503
89 Ga0070712_100094558 3300006175 Bacteria 2197
90 Ga0070712_100174667 3300006175 Bacteria 1670
91 Ga0075428_100006993 3300006844 Bacteria 12514
92 Ga0075429_100018843 3300006880 Bacteria 5978
93 Ga0105240_10065328 3300009093 Bacteria 4517
94 Ga0105240_10151217 3300009093 Bacteria 2764
95 Ga0105240_10303327 3300009093 Bacteria 1826
96 Ga0111539_10018153 3300009094 Bacteria 8713
97 Ga0105245_10112760 3300009098 Bacteria 2531
98 Ga0105245_10221788 3300009098 Bacteria 1825
99 Ga0105245_10280708 3300009098 Bacteria 1627
100 Ga0105245_10540691 3300009098 Bacteria 1186
101 Ga0114129_10027041 3300009147 Bacteria 8122
102 Ga0105248_10348657 3300009177 Bacteria 1667
103 Ga0105237_10212192 3300009545 Bacteria 1936
104 Ga0105238_10029775 3300009551 Bacteria 5561
105 Ga0105238_10038048 3300009551 Bacteria 4888
106 Ga0105238_10712592 3300009551 Bacteria 1016
107 Ga0105249_10522807 3300009553 Bacteria 1234
108 Ga0105239_10140891 3300010375 Bacteria 2687
109 Ga0105239_10636060 3300010375 Bacteria 1218
110 Ga0105246_10324862 3300011119 Bacteria 1252
111 Ga0157373_10074320 3300013100 Bacteria 2398
112 Ga0157370_10056545 3300013104 Bacteria 3734
113 Ga0157370_10171432 3300013104 Bacteria 2017
114 Ga0157370_10651863 3300013104 Bacteria 962
115 Ga0157369_10001071 3300013105 Bacteria 34352
116 Ga0157369_10008750 3300013105 Bacteria 11593
117 Ga0157369_10016070 3300013105 Bacteria 8421
118 Ga0157369_10340319 3300013105 Bacteria 1558
119 Ga0157369_10491876 3300013105 Bacteria 1269
120 Ga0157374_10060063 3300013296 Bacteria 3557
121 Ga0157378_10418860 3300013297 Bacteria 1323
122 Ga0157372_10031820 3300013307 Bacteria 5780
123 Ga0157372_10045163 3300013307 Bacteria 4885
124 Ga0157372_10113255 3300013307 Bacteria 3109
125 Ga0157372_11348621 3300013307 Bacteria 823
126 Ga0157375_10042860 3300013308 Bacteria 4384
127 Ga0157375_10372579 3300013308 Bacteria 1594
128 Ga0157376_10472878 3300014969 Bacteria 1227
129 Ga0157376_10479633 3300014969 Bacteria 1218
130 Ga0206356_10930650 3300020070 Bacteria 8554
131 Ga0206356_11117136 3300020070 Bacteria 1197
132 Ga0206356_11799602 3300020070 Bacteria 2243
133 Ga0206354_10013212 3300020081 Bacteria 2077
134 Ga0206354_10480284 3300020081 Bacteria 847
135 Ga0206353_10318927 3300020082 Bacteria 1745
136 Ga0206353_10321768 3300020082 Bacteria 2201
137 Ga0206353_10750580 3300020082 Bacteria 6566
138 Ga0206353_11000335 3300020082 Bacteria 6237
139 Ga0207692_10096404 3300025898 Bacteria 1615
140 Ga0207692_10153216 3300025898 Bacteria 1322
141 Ga0207705_10031478 3300025909 Bacteria 3788
142 Ga0207705_10066927 3300025909 Bacteria 2599
143 Ga0207705_10299810 3300025909 Bacteria 1232
144 Ga0207684_10079339 3300025910 Bacteria 2793
145 Ga0207707_10036910 3300025912 Bacteria 4270
146 Ga0207707_10078664 3300025912 Bacteria 2880
147 Ga0207707_10084492 3300025912 Bacteria 2772
148 Ga0207707_10146459 3300025912 Bacteria 2065
149 Ga0207695_10175156 3300025913 Bacteria 2068
150 Ga0207671_10325312 3300025914 Bacteria 1217
151 Ga0207671_10383548 3300025914 Bacteria 1117
152 Ga0207693_10055032 3300025915 Bacteria 3122
153 Ga0207693_10088793 3300025915 Bacteria 2422
154 Ga0207663_10045812 3300025916 Bacteria 2692
155 Ga0207663_10294907 3300025916 Bacteria 1209
156 Ga0207660_10077932 3300025917 Bacteria 2428
157 Ga0207660_10254461 3300025917 Bacteria 1387
158 Ga0207660_10849442 3300025917 Bacteria 745
159 Ga0207662_10094434 3300025918 Bacteria 1845
160 Ga0207657_10000220 3300025919 Bacteria 59453
161 Ga0207657_10001478 3300025919 Bacteria 25119
162 Ga0207657_10002441 3300025919 Bacteria 20078
163 Ga0207657_10131727 3300025919 Bacteria 2049
164 Ga0207657_10246653 3300025919 Bacteria 1425
165 Ga0207649_10034798 3300025920 Bacteria 3021
166 Ga0207649_10150677 3300025920 Bacteria 1601
167 Ga0207652_10008064 3300025921 Bacteria 8454
168 Ga0207652_10063164 3300025921 Bacteria 3202
169 Ga0207652_10208648 3300025921 Bacteria 1759
170 Ga0207652_10367685 3300025921 Bacteria 1298
171 Ga0207694_10319983 3300025924 Bacteria 1280
172 Ga0207687_10324092 3300025927 Bacteria 1248
173 Ga0207687_10490453 3300025927 Bacteria 1024
174 Ga0207700_10079701 3300025928 Bacteria 2551
175 Ga0207700_10096631 3300025928 Bacteria 2346
176 Ga0207700_10871623 3300025928 Bacteria 806
177 Ga0207644_10048380 3300025931 Bacteria 3040
178 Ga0207644_10159153 3300025931 Bacteria 1754
179 Ga0207690_10020074 3300025932 Bacteria 4123
180 Ga0207690_10103911 3300025932 Bacteria 2034
181 Ga0207690_10341781 3300025932 Bacteria 1181
182 Ga0207690_10824516 3300025932 Bacteria 767
183 Ga0207709_10267342 3300025935 Bacteria 1257
184 Ga0207669_10013323 3300025937 Unclassified 4079
185 Ga0207665_10313083 3300025939 Bacteria 1176
186 Ga0207691_10486032 3300025940 Bacteria 1049
187 Ga0207689_10430091 3300025942 Bacteria 1102
188 Ga0207661_10002106 3300025944 Bacteria 13684
189 Ga0207661_10029984 3300025944 Bacteria 4184
190 Ga0207661_10172804 3300025944 Bacteria 1882
191 Ga0207661_10579234 3300025944 Bacteria 1029
192 Ga0207679_10006609 3300025945 Bacteria 7334
193 Ga0207667_10049918 3300025949 Bacteria 4416
194 Ga0207667_10124700 3300025949 Bacteria 2653
195 Ga0207667_10194216 3300025949 Bacteria 2082
196 Ga0207667_10229975 3300025949 Bacteria 1899
197 Ga0207667_10251166 3300025949 Bacteria 1809
198 Ga0207640_10443436 3300025981 Bacteria 1068
199 Ga0207658_10068216 3300025986 Bacteria 2682
200 Ga0207677_10147966 3300026023 Bacteria 1807
201 Ga0207639_10211351 3300026041 Unclassified 1670
202 Ga0207639_10319728 3300026041 Bacteria 1378
203 Ga0207639_10671208 3300026041 Bacteria 960
204 Ga0207708_10262129 3300026075 Bacteria 1395
205 Ga0207702_10013412 3300026078 Bacteria 6812
206 Ga0207674_10006026 3300026116 Bacteria 14339
207 Ga0207674_10053046 3300026116 Bacteria 4133
208 Ga0207674_10165343 3300026116 Bacteria 2166
209 Ga0207683_10201031 3300026121 Bacteria 1811
210 Ga0207698_10068622 3300026142 Bacteria 2800
211 Ga0207698_10361889 3300026142 Bacteria 1374
212 Ga0207698_11031696 3300026142 Bacteria 834
213 Ga0207428_10000393 3300027907 Bacteria 54718
214 Ga0265319_1023965 3300028563 Bacteria 2204
215 Ga0265334_10036665 3300028573 Bacteria 1936
216 Ga0265318_10030869 3300028577 Bacteria 2082
217 Ga0265322_10006195 3300028654 Bacteria 3521
218 Ga0265338_10016001 3300028800 Bacteria 8196
219 Ga0265338_10161613 3300028800 Bacteria 1729
220 Ga0265330_10079631 3300031235 Bacteria 1412
221 Ga0265325_10025986 3300031241 Bacteria 3176
222 Ga0265340_10055390 3300031247 Bacteria 1910
223 Ga0265327_10020054 3300031251 Bacteria 4088
224 Ga0265327_10026721 3300031251 Bacteria 3337
225 Ga0265327_10080373 3300031251 Bacteria 1612
226 Ga0265316_10025022 3300031344 Bacteria 4987
227 Ga0265313_10019840 3300031595 Bacteria 3728
228 Ga0265314_10035080 3300031711 Bacteria 3658
229 Ga0265342_10032704 3300031712 Bacteria 3206
230 Ga0307405_10182694 3300031731 Bacteria 1507
231 Ga0307410_10308743 3300031852 Bacteria 1251
232 Ga0307411_10137365 3300032005 Bacteria 1797
233 Ga0373944_0001935 3300035089 Bacteria 5242
234 Ga0373945_0014644 3300035116 Bacteria 2631
235 Ga0373953_0089881 3300035117 Bacteria 1284
236 Ga0373943_0001066 3300035170 Bacteria 12184
237 Ga0373943_0013614 3300035170 Bacteria 3676
238 Ga0373946_0001825 3300035171 Bacteria 7440
239 Ga0373935_0209379 3300035692 Bacteria 1350
240 Ga0373927_0010416 3300035695 Bacteria 6201
241 Ga0373947_0001921 3300035725 Bacteria 12712
242 Ga0373937_1044291 3300036401 Bacteria 766
243 Ga0373925_0004151 3300037068 Bacteria 10987
244 Ga0373925_0007457 3300037068 Bacteria 7977
245 Ga0395900_0047696 3300037418 Bacteria 4412
246 Ga0395900_0101258 3300037418 Bacteria 2959
247 Ga0395900_0121193 3300037418 Bacteria 2683
248 Ga0395900_0145656 3300037418 Bacteria 2422
249 Ga0395900_0146292 3300037418 Bacteria 2416
250 Ga0395900_0147842 3300037418 Bacteria 2402
251 Ga0395900_0238274 3300037418 Bacteria 1826
252 Ga0395900_0828887 3300037418 Bacteria 852
253 Ga0395898_0005749 3300037466 Bacteria 13347
254 Ga0395898_0092580 3300037466 Bacteria 2907
255 Ga0395898_0187947 3300037466 Bacteria 1974
256 Ga0395898_0425455 3300037466 Bacteria 1265
257 Ga0395898_0520562 3300037466 Bacteria 1131
258 Ga0395901_0013865 3300038443 Bacteria 8199
259 Ga0395901_0049065 3300038443 Bacteria 4385
260 Ga0395901_0054371 3300038443 Bacteria 4161
261 Ga0395901_0060904 3300038443 Bacteria 3928
262 Ga0395901_0135884 3300038443 Bacteria 2584
263 Ga0395901_0144779 3300038443 Bacteria 2498
264 Ga0395901_0591322 3300038443 Bacteria 1120
265 Ga0439453_0084930 3300041408 Bacteria 688
266 Ga0439461_0006601 3300041410 Bacteria 2027
267 Ga0439451_013407 3300042009 Bacteria 1656
268 Ga0439454_000471 3300042011 Bacteria 3231
269 Ga0450920_008312 3300042122 Bacteria 1895
270 Ga0439446_0073811 3300042156 Bacteria 1047
271 Ga0466966_0062806 3300044684 Bacteria 2341
272 Ga0466961_0011243 3300044693 Bacteria 5722
273 Ga0466961_0022297 3300044693 Bacteria 4074
274 Ga0466961_0116865 3300044693 Bacteria 1676
275 Ga0466961_0319426 3300044693 Unclassified 947
276 Ga0466963_0008879 3300044694 Bacteria 6031
277 Ga0466963_0011662 3300044694 Bacteria 5354
278 Ga0466963_0028128 3300044694 Bacteria 3606
279 Ga0466963_0361976 3300044694 Bacteria 1022
280 Ga0466963_0588816 3300044694 Bacteria 786
281 Ga0466964_0034690 3300044706 Bacteria 2014
282 Ga0466968_0003500 3300044735 Bacteria 5806
283 Ga0466957_0145984 3300044842 Bacteria 1527
284 Ga0466959_0021349 3300045049 Bacteria 4775
285 Ga0466959_0031599 3300045049 Bacteria 3917
286 Ga0466958_0006549 3300045836 Bacteria 6347
287 Ga0466958_0088507 3300045836 Bacteria 1913
288 Ga0466967_0005201 3300045976 Bacteria 8961
289 Ga0466967_0032000 3300045976 Bacteria 4437
290 Ga0466967_0052795 3300045976 Bacteria 3570
291 Ga0466967_0081437 3300045976 Bacteria 2924
292 Ga0466967_0085920 3300045976 Bacteria 2849
293 Ga0466967_0086084 3300045976 Bacteria 2847
294 Ga0495592_0346384 3300046454 Bacteria 954
295 Ga0495592_0460993 3300046454 Bacteria 795
296 Ga0495603_0018056 3300046455 Bacteria 4267
297 Ga0495603_0138676 3300046455 Unclassified 1415
298 Ga0495629_0000665 3300046459 Bacteria 27803
299 Ga0495629_0006053 3300046459 Bacteria 8989
300 Ga0495629_0289367 3300046459 Bacteria 1123
301 Ga0495641_0005923 3300046461 Bacteria 8062
302 Ga0495651_0110010 3300046462 Bacteria 2039
303 Ga0495653_0030994 3300046463 Bacteria 4254
304 Ga0495653_0040690 3300046463 Bacteria 3631
305 Ga0495653_0046415 3300046463 Bacteria 3364
306 Ga0495582_0000703 3300046473 Bacteria 18466
307 Ga0495582_0084358 3300046473 Unclassified 1766
308 Ga0495639_0001381 3300046475 Bacteria 10886
309 Ga0495662_0000116 3300046476 Bacteria 30019
310 Ga0495664_0014643 3300046477 Bacteria 4448
311 Ga0495594_0029486 3300046499 Bacteria 2966
312 Ga0495608_0043568 3300046511 Bacteria 2998
313 Ga0495618_0033970 3300046514 Bacteria 3198
314 Ga0495618_0126264 3300046514 Bacteria 1638
315 Ga0495628_0081706 3300046516 Bacteria 2510
316 Ga0495628_0152502 3300046516 Bacteria 1759
317 Ga0495630_0004843 3300046517 Bacteria 9443
318 Ga0495630_0033429 3300046517 Bacteria 3836
319 Ga0495630_0153651 3300046517 Bacteria 1751
320 Ga0495666_0007368 3300046526 Bacteria 5516
321 Ga0495666_0068550 3300046526 Bacteria 1689
322 Ga0495652_0572017 3300046529 Unclassified 774
323 Ga0495665_0000801 3300046531 Bacteria 16452
324 Ga0495640_0007990 3300046533 Bacteria 8315
325 Ga0495640_0023288 3300046533 Bacteria 4515
326 Ga0495640_0262285 3300046533 Bacteria 1079
327 Ga0495586_0140733 3300046535 Bacteria 1354
328 Ga0495587_0021913 3300046536 Bacteria 3939
329 Ga0495587_0075357 3300046536 Bacteria 1959
330 Ga0495645_0076162 3300046543 Bacteria 2414
331 Ga0495645_0117701 3300046543 Bacteria 1874
332 Ga0495667_0055759 3300046559 Bacteria 2599
333 Ga0495634_0036855 3300046642 Bacteria 3343
334 Ga0495634_0089831 3300046642 Bacteria 1996
335 Ga0495634_0124331 3300046642 Bacteria 1650
336 Ga0495635_0041980 3300046663 Bacteria 3160
337 Ga0495635_0134990 3300046663 Bacteria 1682
338 Ga0495635_0168776 3300046663 Bacteria 1488
339 Ga0495588_0075510 3300046674 Bacteria 1756
340 Ga0495657_0336392 3300046675 Bacteria 895
341 Ga0495599_0049963 3300046678 Bacteria 2621
342 Ga0495599_0144017 3300046678 Unclassified 1478
343 Ga0495599_0185160 3300046678 Bacteria 1282
344 Ga0495623_0033301 3300046679 Bacteria 3306
345 Ga0495646_0036047 3300046680 Bacteria 3066
346 Ga0495646_0073912 3300046680 Bacteria 2002
347 Ga0495658_0000830 3300046683 Bacteria 16569
348 Ga0495658_0142774 3300046683 Bacteria 1465
349 Ga0495658_0252136 3300046683 Bacteria 1110
350 Ga0495613_0047682 3300046689 Bacteria 3164
351 Ga0495613_0183899 3300046689 Bacteria 1479
352 Ga0495624_0028038 3300046690 Bacteria 3682
353 Ga0495624_0165456 3300046690 Bacteria 1350
354 Ga0495600_0013447 3300046809 Bacteria 5144
355 Ga0495581_0021885 3300047315 Bacteria 3706
356 Ga0495604_0033314 3300047317 Bacteria 4079
357 Ga0495674_0014116 3300047319 Bacteria 7482
358 Ga0495674_0014734 3300047319 Bacteria 7314
359 Ga0495674_0062917 3300047319 Bacteria 3230
360 Ga0495676_0078407 3300047321 Bacteria 2515
361 Ga0495680_0001597 3300047322 Bacteria 24161
362 Ga0495680_0006465 3300047322 Bacteria 10877
363 Ga0495680_0010259 3300047322 Bacteria 8358
364 Ga0495684_0008266 3300047471 Bacteria 8057
365 Ga0495593_0039432 3300047673 Bacteria 2546
366 Ga0495593_0137185 3300047673 Bacteria 1240
367 Ga0495614_0019836 3300048089 Bacteria 2908
368 Ga0496100_0134355 3300048903 Bacteria 1746
369 Ga0496100_0258105 3300048903 Bacteria 1291
370 Ga0496100_0278895 3300048903 Bacteria 1245
371 Ga0496101_0008746 3300048904 Bacteria 6623
372 Ga0496101_0065660 3300048904 Bacteria 2645
373 Ga0496101_0114172 3300048904 Bacteria 2036
374 Ga0496102_0093637 3300048905 Bacteria 2783
375 Ga0496102_0256753 3300048905 Bacteria 1648
376 Ga0496102_1086379 3300048905 Bacteria 720
377 Ga0496103_0258518 3300048906 Bacteria 1120
378 Ga0496103_0427598 3300048906 Bacteria 850
379 Ga0496104_0076430 3300048907 Bacteria 3190
380 Ga0496104_0233420 3300048907 Bacteria 1751
381 Ga0496104_0441736 3300048907 Bacteria 1213
382 Ga0496104_0681289 3300048907 Bacteria 936
383 Ga0496104_0991749 3300048907 Bacteria 744
384 Ga0496105_0012543 3300048908 Bacteria 6712
385 Ga0496105_0026913 3300048908 Bacteria 4694
386 Ga0496105_0191457 3300048908 Bacteria 1672
387 Ga0496105_0329167 3300048908 Bacteria 1223
388 Ga0496106_0000302 3300048909 Bacteria 34606
389 Ga0496106_0030841 3300048909 Bacteria 3996
390 Ga0496107_0009933 3300048910 Bacteria 6605
391 Ga0496107_0066260 3300048910 Bacteria 2618
392 Ga0496108_0040909 3300048911 Bacteria 3867
393 Ga0496108_0047222 3300048911 Bacteria 3599
394 Ga0496108_0351045 3300048911 Bacteria 1287
395 Ga0496109_0176349 3300048912 Bacteria 2006
396 Ga0496109_0405986 3300048912 Bacteria 1287
397 Ga0496109_0797326 3300048912 Bacteria 883
398 Ga0496110_0038613 3300048913 Bacteria 4155
399 Ga0496110_0077347 3300048913 Bacteria 2960
400 Ga0496111_0022436 3300048914 Bacteria 4420
401 Ga0496111_0028282 3300048914 Bacteria 3972
402 Ga0496111_0084931 3300048914 Bacteria 2314
403 Ga0496112_0007327 3300048915 Bacteria 9786
404 Ga0496112_0359892 3300048915 Bacteria 1397
405 Ga0496112_0810838 3300048915 Bacteria 860
406 Ga0496113_0022085 3300048916 Bacteria 4496
407 Ga0496114_0010884 3300048917 Bacteria 7248
408 Ga0496114_0023573 3300048917 Bacteria 5024
409 Ga0496114_0055985 3300048917 Bacteria 3289
410 Ga0496114_0114647 3300048917 Bacteria 2311
411 Ga0496114_0127912 3300048917 Bacteria 2191
412 Ga0496114_0172009 3300048917 Bacteria 1888
413 Ga0496115_0001139 3300048918 Bacteria 19188
414 Ga0496115_0008270 3300048918 Bacteria 7690
415 Ga0496115_0020493 3300048918 Bacteria 5102
416 Ga0496115_0054978 3300048918 Bacteria 3197
417 Ga0496115_0480396 3300048918 Bacteria 1001
418 Ga0501032_0083161 3300049569 Bacteria 2129
419 Ga0501033_0621108 3300049570 Bacteria 740
420 Ga0501036_0050385 3300049572 Bacteria 3526
421 Ga0501038_0174365 3300049574 Bacteria 1739
422 Ga0501039_0063671 3300049575 Bacteria 2857
423 Ga0501040_0024131 3300049576 Bacteria 4080
424 Ga0501040_0037033 3300049576 Bacteria 3313
425 Ga0501041_0015242 3300049577 Bacteria 4564
426 Ga0501042_0249927 3300049578 Bacteria 1279
427 Ga0501043_0187411 3300049579 Bacteria 1610
428 Ga0501046_0047246 3300049580 Bacteria 3413
429 Ga0501047_0112448 3300049581 Bacteria 2605
430 Ga0501047_0271957 3300049581 Bacteria 1540
431 Ga0501048_0018644 3300049582 Bacteria 5102
432 Ga0501067_0189231 3300049583 Bacteria 1146
433 Ga0501069_0061083 3300049585 Bacteria 2104
434 Ga0501069_0062058 3300049585 Bacteria 2087
435 Ga0501070_0004258 3300049586 Bacteria 12303
436 Ga0501070_0061955 3300049586 Bacteria 3099
437 Ga0501070_0086706 3300049586 Bacteria 2591
438 Ga0501070_0207247 3300049586 Bacteria 1610
439 Ga0501071_0022387 3300049587 Bacteria 4406
440 Ga0501072_0004190 3300049588 Bacteria 10929
441 Ga0501073_0238473 3300049589 Bacteria 1256
442 Ga0501074_0064638 3300049590 Bacteria 2634
443 Ga0501074_0180022 3300049590 Bacteria 1508
444 Ga0501076_0003792 3300049592 Bacteria 10646
445 Ga0501077_0473788 3300049593 Bacteria 802
446 Ga0501080_0094817 3300049742 Bacteria 2771
447 Ga0501080_0183307 3300049742 Bacteria 1926
448 Ga0501080_0455626 3300049742 Bacteria 1146
449 Ga0501081_0065325 3300049743 Bacteria 2529
450 Ga0501045_0031400 3300049824 Bacteria 3847
451 nmdc:mga05p37_84160_c1 3300050507 Bacteria 3919
452 nmdc:mga09592_12130_c1 3300050508 Bacteria 1289
453 nmdc:mga08y16_52441_c1 3300050511 Bacteria 4268
454 nmdc:mga0n895_752699_c1 3300050512 Bacteria 967
455 Ga0495601_0037229 3300053077 Bacteria 3041
456 Ga0495595_0005765 3300053084 Bacteria 5015
457 Ga0495619_0004992 3300053085 Bacteria 8428
458 Ga0495619_0026047 3300053085 Bacteria 3760
459 Ga0495619_0049667 3300053085 Bacteria 2767
460 Ga0495619_0102059 3300053085 Bacteria 1953
461 Ga0501084_0051482 3300054114 Bacteria 3446
462 Ga0501084_0795346 3300054114 Bacteria 797
463 Ga0501082_0940212 3300060353 Bacteria 756
464 Ga0530510_0025772 3300061734 Bacteria 4206
465 Ga0265314_10147681
466 Ga0070658_10477167
467 Ga0070683_100022473
468 Ga0070683_100241673
469 Ga0070683_100355414
470 Ga0070680_100021963
471 Ga0070680_100049234
472 Ga0070680_100299927
473 Ga0070682_100071850
474 Ga0068868_100123960
475 Ga0070660_100014598
476 Ga0070660_100116578
477 Ga0070660_100133674
478 Ga0070660_100257061
479 Ga0070661_100018310
480 Ga0070661_100023398
481 Ga0070661_100042913
482 Ga0070661_100092938
483 Ga0070675_100487696
484 Ga0070671_100161757
485 Ga0070674_100064313
486 Ga0070659_100019410
487 Ga0070659_100026166
488 Ga0070659_100247128
489 Ga0070667_100107189
490 Ga0070709_10217806
491 Ga0070709_10662811
492 Ga0070714_100051431
493 Ga0070714_100220536
494 Ga0070713_100062973
495 Ga0070713_100970684
496 Ga0070711_100201307
497 Ga0070711_100306989
498 Ga0070711_100556886
499 Ga0070708_100410509
500 Ga0070663_100460403
501 Ga0070678_100708028
502 Ga0070681_10006856
503 Ga0070681_10016795
504 Ga0070681_10053018
505 Ga0070681_10236715
506 Ga0070681_10705812
507 Ga0070681_10886074
508 Ga0070706_100155845
509 Ga0070698_100398180
510 Ga0070699_100144332
511 Ga0070679_100015519
512 Ga0070679_100068761
513 Ga0070679_100091236
514 Ga0070679_100185719
515 Ga0070679_100192791
516 Ga0070679_100975220
517 Ga0070684_100021794
518 Ga0070684_100036222
519 Ga0070684_100064333
520 Ga0068853_100069038
521 Ga0068853_100221027
522 Ga0068853_101035027
523 Ga0070672_100471754
524 Ga0070686_100317082
525 Ga0070693_100004706
526 Ga0070693_100329992
527 Ga0070665_100618738
528 Ga0070704_100168570
529 Ga0068855_100162394
530 Ga0068855_100232467
531 Ga0068855_100238748
532 Ga0068855_100354997
533 Ga0068855_100581781
534 Ga0068855_100625495
535 Ga0070664_100003442
536 Ga0070664_100146853
537 Ga0068857_100027802
538 Ga0068857_100047621
539 Ga0068857_100050809
540 Ga0068854_100440626
541 Ga0068856_100024535
542 Ga0068856_100026260
543 Ga0068852_100099081
544 Ga0068852_100158344
545 Ga0068852_100362658
546 Ga0068852_101089764
547 Ga0068851_10235596
548 Ga0068870_10042795
549 Ga0068858_101264618
550 Ga0081455_10012984
551 Ga0070717_10276663
552 Ga0075432_10008501
553 Ga0070712_100094558
554 Ga0070712_100174667
555 Ga0075428_100006993
556 Ga0075429_100018843
557 Ga0105240_10065328
558 Ga0105240_10151217
559 Ga0105240_10303327
560 Ga0111539_10018153
561 Ga0105245_10112760
562 Ga0105245_10221788
563 Ga0105245_10280708
564 Ga0105245_10540691
565 Ga0114129_10027041
566 Ga0105248_10348657
567 Ga0105237_10212192
568 Ga0105238_10029775
569 Ga0105238_10038048
570 Ga0105238_10712592
571 Ga0105249_10522807
572 Ga0105239_10140891
573 Ga0105239_10636060
574 Ga0105246_10324862
575 Ga0157373_10074320
576 Ga0157370_10056545
577 Ga0157370_10171432
578 Ga0157370_10651863
579 Ga0157369_10001071
580 Ga0157369_10008750
581 Ga0157369_10016070
582 Ga0157369_10340319
583 Ga0157369_10491876
584 Ga0157374_10060063
585 Ga0157378_10418860
586 Ga0157372_10031820
587 Ga0157372_10045163
588 Ga0157372_10113255
589 Ga0157372_11348621
590 Ga0157375_10042860
591 Ga0157375_10372579
592 Ga0157376_10472878
593 Ga0157376_10479633
594 Ga0206356_10930650
595 Ga0206356_11117136
596 Ga0206356_11799602
597 Ga0206354_10013212
598 Ga0206354_10480284
599 Ga0206353_10318927
600 Ga0206353_10321768
601 Ga0206353_10750580
602 Ga0206353_11000335
603 Ga0207692_10096404
604 Ga0207692_10153216
605 Ga0207705_10031478
606 Ga0207705_10066927
607 Ga0207705_10299810
608 Ga0207684_10079339
609 Ga0207707_10036910
610 Ga0207707_10078664
611 Ga0207707_10084492
612 Ga0207707_10146459
613 Ga0207695_10175156
614 Ga0207671_10325312
615 Ga0207671_10383548
616 Ga0207693_10055032
617 Ga0207693_10088793
618 Ga0207663_10045812
619 Ga0207663_10294907
620 Ga0207660_10077932
621 Ga0207660_10254461
622 Ga0207660_10849442
623 Ga0207662_10094434
624 Ga0207657_10000220
625 Ga0207657_10001478
626 Ga0207657_10002441
627 Ga0207657_10131727
628 Ga0207657_10246653
629 Ga0207649_10034798
630 Ga0207649_10150677
631 Ga0207652_10008064
632 Ga0207652_10063164
633 Ga0207652_10208648
634 Ga0207652_10367685
635 Ga0207694_10319983
636 Ga0207687_10324092
637 Ga0207687_10490453
638 Ga0207700_10079701
639 Ga0207700_10096631
640 Ga0207700_10871623
641 Ga0207644_10048380
642 Ga0207644_10159153
643 Ga0207690_10020074
644 Ga0207690_10103911
645 Ga0207690_10341781
646 Ga0207690_10824516
647 Ga0207709_10267342
648 Ga0207669_10013323
649 Ga0207665_10313083
650 Ga0207691_10486032
651 Ga0207689_10430091
652 Ga0207661_10002106
653 Ga0207661_10029984
654 Ga0207661_10172804
655 Ga0207661_10579234
656 Ga0207679_10006609
657 Ga0207667_10049918
658 Ga0207667_10124700
659 Ga0207667_10194216
660 Ga0207667_10229975
661 Ga0207667_10251166
662 Ga0207640_10443436
663 Ga0207658_10068216
664 Ga0207677_10147966
665 Ga0207639_10211351
666 Ga0207639_10319728
667 Ga0207639_10671208
668 Ga0207708_10262129
669 Ga0207702_10013412
670 Ga0207674_10006026
671 Ga0207674_10053046
672 Ga0207674_10165343
673 Ga0207683_10201031
674 Ga0207698_10068622
675 Ga0207698_10361889
676 Ga0207698_11031696
677 Ga0207428_10000393
678 Ga0265319_1023965
679 Ga0265334_10036665
680 Ga0265318_10030869
681 Ga0265322_10006195
682 Ga0265338_10016001
683 Ga0265338_10161613
684 Ga0265330_10079631
685 Ga0265325_10025986
686 Ga0265340_10055390
687 Ga0265327_10020054
688 Ga0265327_10026721
689 Ga0265327_10080373
690 Ga0265316_10025022
691 Ga0265313_10019840
692 Ga0265314_10035080
693 Ga0265342_10032704
694 Ga0307405_10182694
695 Ga0307410_10308743
696 Ga0307411_10137365
697 Ga0373944_0001935
698 Ga0373945_0014644
699 Ga0373953_0089881
700 Ga0373943_0001066
701 Ga0373943_0013614
702 Ga0373946_0001825
703 Ga0373935_0209379
704 Ga0373927_0010416
705 Ga0373947_0001921
706 Ga0373937_1044291
707 Ga0373925_0004151
708 Ga0373925_0007457
709 Ga0395900_0047696
710 Ga0395900_0101258
711 Ga0395900_0121193
712 Ga0395900_0145656
713 Ga0395900_0146292
714 Ga0395900_0147842
715 Ga0395900_0238274
716 Ga0395900_0828887
717 Ga0395898_0005749
718 Ga0395898_0092580
719 Ga0395898_0187947
720 Ga0395898_0425455
721 Ga0395898_0520562
722 Ga0395901_0013865
723 Ga0395901_0049065
724 Ga0395901_0054371
725 Ga0395901_0060904
726 Ga0395901_0135884
727 Ga0395901_0144779
728 Ga0395901_0591322
729 Ga0439453_0084930
730 Ga0439461_0006601
731 Ga0439451_013407
732 Ga0439454_000471
733 Ga0450920_008312
734 Ga0439446_0073811
735 Ga0466966_0062806
736 Ga0466961_0011243
737 Ga0466961_0022297
738 Ga0466961_0116865
739 Ga0466961_0319426
740 Ga0466963_0008879
741 Ga0466963_0011662
742 Ga0466963_0028128
743 Ga0466963_0361976
744 Ga0466963_0588816
745 Ga0466964_0034690
746 Ga0466968_0003500
747 Ga0466957_0145984
748 Ga0466959_0021349
749 Ga0466959_0031599
750 Ga0466958_0006549
751 Ga0466958_0088507
752 Ga0466967_0005201
753 Ga0466967_0032000
754 Ga0466967_0052795
755 Ga0466967_0081437
756 Ga0466967_0085920
757 Ga0466967_0086084
758 Ga0495592_0346384
759 Ga0495592_0460993
760 Ga0495603_0018056
761 Ga0495603_0138676
762 Ga0495629_0000665
763 Ga0495629_0006053
764 Ga0495629_0289367
765 Ga0495641_0005923
766 Ga0495651_0110010
767 Ga0495653_0030994
768 Ga0495653_0040690
769 Ga0495653_0046415
770 Ga0495582_0000703
771 Ga0495582_0084358
772 Ga0495639_0001381
773 Ga0495662_0000116
774 Ga0495664_0014643
775 Ga0495594_0029486
776 Ga0495608_0043568
777 Ga0495618_0033970
778 Ga0495618_0126264
779 Ga0495628_0081706
780 Ga0495628_0152502
781 Ga0495630_0004843
782 Ga0495630_0033429
783 Ga0495630_0153651
784 Ga0495666_0007368
785 Ga0495666_0068550
786 Ga0495652_0572017
787 Ga0495665_0000801
788 Ga0495640_0007990
789 Ga0495640_0023288
790 Ga0495640_0262285
791 Ga0495586_0140733
792 Ga0495587_0021913
793 Ga0495587_0075357
794 Ga0495645_0076162
795 Ga0495645_0117701
796 Ga0495667_0055759
797 Ga0495634_0036855
798 Ga0495634_0089831
799 Ga0495634_0124331
800 Ga0495635_0041980
801 Ga0495635_0134990
802 Ga0495635_0168776
803 Ga0495588_0075510
804 Ga0495657_0336392
805 Ga0495599_0049963
806 Ga0495599_0144017
807 Ga0495599_0185160
808 Ga0495623_0033301
809 Ga0495646_0036047
810 Ga0495646_0073912
811 Ga0495658_0000830
812 Ga0495658_0142774
813 Ga0495658_0252136
814 Ga0495613_0047682
815 Ga0495613_0183899
816 Ga0495624_0028038
817 Ga0495624_0165456
818 Ga0495600_0013447
819 Ga0495581_0021885
820 Ga0495604_0033314
821 Ga0495674_0014116
822 Ga0495674_0014734
823 Ga0495674_0062917
824 Ga0495676_0078407
825 Ga0495680_0001597
826 Ga0495680_0006465
827 Ga0495680_0010259
828 Ga0495684_0008266
829 Ga0495593_0039432
830 Ga0495593_0137185
831 Ga0495614_0019836
832 Ga0496100_0134355
833 Ga0496100_0258105
834 Ga0496100_0278895
835 Ga0496101_0008746
836 Ga0496101_0065660
837 Ga0496101_0114172
838 Ga0496102_0093637
839 Ga0496102_0256753
840 Ga0496102_1086379
841 Ga0496103_0258518
842 Ga0496103_0427598
843 Ga0496104_0076430
844 Ga0496104_0233420
845 Ga0496104_0441736
846 Ga0496104_0681289
847 Ga0496104_0991749
848 Ga0496105_0012543
849 Ga0496105_0026913
850 Ga0496105_0191457
851 Ga0496105_0329167
852 Ga0496106_0000302
853 Ga0496106_0030841
854 Ga0496107_0009933
855 Ga0496107_0066260
856 Ga0496108_0040909
857 Ga0496108_0047222
858 Ga0496108_0351045
859 Ga0496109_0176349
860 Ga0496109_0405986
861 Ga0496109_0797326
862 Ga0496110_0038613
863 Ga0496110_0077347
864 Ga0496111_0022436
865 Ga0496111_0028282
866 Ga0496111_0084931
867 Ga0496112_0007327
868 Ga0496112_0359892
869 Ga0496112_0810838
870 Ga0496113_0022085
871 Ga0496114_0010884
872 Ga0496114_0023573
873 Ga0496114_0055985
874 Ga0496114_0114647
875 Ga0496114_0127912
876 Ga0496114_0172009
877 Ga0496115_0001139
878 Ga0496115_0008270
879 Ga0496115_0020493
880 Ga0496115_0054978
881 Ga0496115_0480396
882 Ga0501032_0083161
883 Ga0501033_0621108
884 Ga0501036_0050385
885 Ga0501038_0174365
886 Ga0501039_0063671
887 Ga0501040_0024131
888 Ga0501040_0037033
889 Ga0501041_0015242
890 Ga0501042_0249927
891 Ga0501043_0187411
892 Ga0501046_0047246
893 Ga0501047_0112448
894 Ga0501047_0271957
895 Ga0501048_0018644
896 Ga0501067_0189231
897 Ga0501069_0061083
898 Ga0501069_0062058
899 Ga0501070_0004258
900 Ga0501070_0061955
901 Ga0501070_0086706
902 Ga0501070_0207247
903 Ga0501071_0022387
904 Ga0501072_0004190
905 Ga0501073_0238473
906 Ga0501074_0064638
907 Ga0501074_0180022
908 Ga0501076_0003792
909 Ga0501077_0473788
910 Ga0501080_0094817
911 Ga0501080_0183307
912 Ga0501080_0455626
913 Ga0501081_0065325
914 Ga0501045_0031400
915 nmdc:mga05p37_84160_c1
916 nmdc:mga09592_12130_c1
917 nmdc:mga08y16_52441_c1
918 nmdc:mga0n895_752699_c1
919 Ga0495601_0037229
920 Ga0495595_0005765
921 Ga0495619_0004992
922 Ga0495619_0026047
923 Ga0495619_0049667
924 Ga0495619_0102059
925 Ga0501084_0051482
926 Ga0501084_0795346
927 Ga0501082_0940212
928 Ga0530510_0025772

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00696

AA_kinase

Amino acid kinase family

12

227

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rd5-assembly1.cif.gz_B structural basis for the regulation of n-acetylglutamate kinase by pii in arabidopsis thaliana 0.923 2 222
2rd5-assembly1.cif.gz_B structural basis for the regulation of n-acetylglutamate kinase by pii in arabidopsis thaliana 0.9151 2 222
2buf-assembly2.cif.gz_L arginine feed-back inhibitable acetylglutamate kinase 0.8969 2 217
2buf-assembly2.cif.gz_I arginine feed-back inhibitable acetylglutamate kinase 0.8948 2 222
2buf-assembly2.cif.gz_I arginine feed-back inhibitable acetylglutamate kinase 0.8873 2 222
ID Description Score Start End Superfamily
2v5hF00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.8867 2 221 3.40.1160.10
af_P9WQ01_4_294_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.8866 2 221 3.40.1160.10
2v5hF00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.8756 2 221 3.40.1160.10
af_P9WQ01_4_294_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.8753 2 221 3.40.1160.10
3l86A00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.8752 3 221 3.40.1160.10
ID Description Score Start End GO Terms
AF-A0A7Y6CVD9-F1-model_v4 acetylglutamate kinase (EC 2.7.2.8) 0.9865 1 150 GO:0003991
GO:0006526
AF-A0A7W0N4W5-F1-model_v4 acetylglutamate kinase (EC 2.7.2.8) 0.986 5 222 GO:0003991
GO:0005737
GO:0006526
AF-A0A538KZ62-F1-model_v4 acetylglutamate kinase (EC 2.7.2.8) 0.9842 2 222 GO:0003991
GO:0006526
AF-A0A538L5I7-F1-model_v4 acetylglutamate kinase (EC 2.7.2.8) 0.9806 1 222 GO:0003991
GO:0005737
GO:0006526
AF-A0A7Y6CVD9-F1-model_v4 acetylglutamate kinase (EC 2.7.2.8) 0.98 1 150 GO:0003991
GO:0006526

Map