F449317

General Info

Members Datasets Scaffolds Average Seq Length
464 248 461 209

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10004167|Ga0265327_100041672
Length 216
Sequence MQIAIENKTQSLPVMESFYTIQGEGFHQGRAAYFIRLGGCDVGCVWCDVKDSWDANKHPLRSVEEIVENARKEVDSWQLANIGHQPVIITGGEPLMHDCSELTKYLHSAGFRTHIETSGAHPLSGDWDWICFSPKKFKAPLPEILEAADELKVIIFNKTDFEWAEKYAALVSAKCKLFLQPEWSKSSVVTPLIIDYIKQNPQWEFSLQLHKYIHVP

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
146 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
170 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
171 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
172 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
173 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
174 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
175 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
176 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
177 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
178 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
210 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
222 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
223 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
224 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
225 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
226 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
233 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
234 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
235 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
236 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
237 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
238 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
239 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
240 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
241 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
242 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
243 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
244 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
245 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
246 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
247 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
248 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.03
Nodule 0
Rhizoplane 1.08
Rhizosphere 87.93
Stem 0
Stem Tuber 0
Unclassified 4.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10026802 3300003320 Bacteria 25915
2 rootH2_10150878 3300003320 Unclassified 1885
3 rootL2_10137917 3300003322 Bacteria 1993
4 rootL2_10378801 3300003322 Bacteria 2248
5 rootH1_10002518 3300003323 Bacteria 9244
6 rootH1_10120254 3300003323 Bacteria 1276
7 Ga0055535_1001953 3300003761 Bacteria 8568
8 Ga0055542_1004511 3300003762 Bacteria 3359
9 Ga0065712_10193256 3300005290 Bacteria 1139
10 Ga0070676_10000329 3300005328 Bacteria 21548
11 Ga0070676_10018333 3300005328 Bacteria 3878
12 Ga0070683_100000581 3300005329 Bacteria 26110
13 Ga0070683_100034325 3300005329 Bacteria 4633
14 Ga0070683_100043401 3300005329 Bacteria 4144
15 Ga0070670_100033182 3300005331 Bacteria 4447
16 Ga0070670_100108119 3300005331 Bacteria 2396
17 Ga0070670_100229565 3300005331 Bacteria 1615
18 Ga0070670_100339765 3300005331 Bacteria 1318
19 Ga0070670_100357404 3300005331 Bacteria 1284
20 Ga0070670_100431432 3300005331 Bacteria 1166
21 Ga0070677_10005846 3300005333 Bacteria 4074
22 Ga0070677_10130638 3300005333 Bacteria 1146
23 Ga0068869_100434883 3300005334 Bacteria 1085
24 Ga0070666_10000179 3300005335 Bacteria 43394
25 Ga0070666_10000194 3300005335 Bacteria 41297
26 Ga0070666_10006628 3300005335 Bacteria 7122
27 Ga0070680_100052936 3300005336 Bacteria 3313
28 Ga0070682_100390634 3300005337 Bacteria 1049
29 Ga0068868_100000883 3300005338 Bacteria 20356
30 Ga0068868_100142403 3300005338 Bacteria 1969
31 Ga0068868_100243135 3300005338 Bacteria 1513
32 Ga0070660_100010716 3300005339 Bacteria 6487
33 Ga0070689_100036382 3300005340 Bacteria 3765
34 Ga0070689_100128290 3300005340 Bacteria 2032
35 Ga0070689_100145241 3300005340 Bacteria 1910
36 Ga0070689_100398225 3300005340 Bacteria 1163
37 Ga0070661_100006009 3300005344 Bacteria 8355
38 Ga0070661_100333529 3300005344 Bacteria 1187
39 Ga0070668_100001251 3300005347 Bacteria 18123
40 Ga0070669_100008682 3300005353 Bacteria 7248
41 Ga0070669_100059311 3300005353 Bacteria 2810
42 Ga0070675_100056596 3300005354 Bacteria 3232
43 Ga0070675_100097949 3300005354 Bacteria 2466
44 Ga0070675_100138869 3300005354 Bacteria 2076
45 Ga0070675_100140141 3300005354 Unclassified 2066
46 Ga0070675_100229752 3300005354 Bacteria 1618
47 Ga0070671_100023411 3300005355 Bacteria 5055
48 Ga0070671_100138951 3300005355 Bacteria 2049
49 Ga0070671_100301188 3300005355 Bacteria 1365
50 Ga0070673_100000085 3300005364 Bacteria 40336
51 Ga0070673_100083394 3300005364 Bacteria 2597
52 Ga0070673_100562403 3300005364 Bacteria 1037
53 Ga0070688_100199892 3300005365 Bacteria 1398
54 Ga0070688_100292464 3300005365 Bacteria 1174
55 Ga0070659_100008415 3300005366 Bacteria 7536
56 Ga0070659_100217735 3300005366 Bacteria 1575
57 Ga0070667_100002397 3300005367 Bacteria 16416
58 Ga0070667_100084251 3300005367 Bacteria 2725
59 Ga0070667_100164691 3300005367 Bacteria 1955
60 Ga0070667_100526553 3300005367 Bacteria 1085
61 Ga0070663_100118120 3300005455 Bacteria 2000
62 Ga0070663_100284289 3300005455 Bacteria 1319
63 Ga0070663_100288410 3300005455 Bacteria 1310
64 Ga0070663_100706646 3300005455 Unclassified 857
65 Ga0070678_100010180 3300005456 Bacteria 5732
66 Ga0070678_100020522 3300005456 Bacteria 4337
67 Ga0070678_100119914 3300005456 Bacteria 2073
68 Ga0070662_100003544 3300005457 Bacteria 9735
69 Ga0070662_100015221 3300005457 Bacteria 5149
70 Ga0070681_10026684 3300005458 Bacteria 5806
71 Ga0068867_100002846 3300005459 Bacteria 12165
72 Ga0068867_100025410 3300005459 Bacteria 4249
73 Ga0068867_100294695 3300005459 Bacteria 1335
74 Ga0070685_10076309 3300005466 Bacteria 1999
75 Ga0070685_10244746 3300005466 Bacteria 1185
76 Ga0070685_10453130 3300005466 Bacteria 899
77 Ga0070698_100004438 3300005471 Bacteria 15426
78 Ga0070679_100001919 3300005530 Bacteria 18655
79 Ga0070684_100007156 3300005535 Bacteria 8670
80 Ga0070684_100064360 3300005535 Bacteria 3216
81 Ga0068853_100006990 3300005539 Bacteria 9018
82 Ga0068853_100058901 3300005539 Bacteria 3317
83 Ga0068853_100230973 3300005539 Bacteria 1693
84 Ga0070672_100000963 3300005543 Bacteria 17386
85 Ga0070686_100186552 3300005544 Unclassified 1477
86 Ga0070665_100000013 3300005548 Bacteria 484927
87 Ga0070665_100001739 3300005548 Bacteria 24906
88 Ga0070665_100050555 3300005548 Bacteria 4171
89 Ga0070665_101000843 3300005548 Bacteria 848
90 Ga0068855_100001762 3300005563 Bacteria 27042
91 Ga0068855_100008961 3300005563 Bacteria 12095
92 Ga0070664_100037450 3300005564 Bacteria 4079
93 Ga0070664_100082478 3300005564 Bacteria 2773
94 Ga0070664_100099594 3300005564 Bacteria 2526
95 Ga0070664_100140207 3300005564 Bacteria 2128
96 Ga0070664_100219903 3300005564 Bacteria 1699
97 Ga0070664_100677928 3300005564 Bacteria 959
98 Ga0068857_100005041 3300005577 Bacteria 11220
99 Ga0068857_100028355 3300005577 Bacteria 4941
100 Ga0068857_100299642 3300005577 Bacteria 1482
101 Ga0068856_100007116 3300005614 Bacteria 10924
102 Ga0068856_100420676 3300005614 Bacteria 1356
103 Ga0068852_100003790 3300005616 Bacteria 10603
104 Ga0068852_100083457 3300005616 Bacteria 2841
105 Ga0068852_100156096 3300005616 Bacteria 2126
106 Ga0068852_100856098 3300005616 Bacteria 925
107 Ga0068859_100001025 3300005617 Bacteria 28627
108 Ga0068859_100261938 3300005617 Unclassified 1820
109 Ga0068859_100954596 3300005617 Unclassified 940
110 Ga0068864_100000176 3300005618 Bacteria 59064
111 Ga0068864_100003444 3300005618 Bacteria 13080
112 Ga0068864_100149939 3300005618 Bacteria 2111
113 Ga0068864_100213555 3300005618 Bacteria 1778
114 Ga0068866_10010440 3300005718 Bacteria 3981
115 Ga0068861_100079534 3300005719 Bacteria 2563
116 Ga0068851_10004771 3300005834 Bacteria 6140
117 Ga0068851_10042820 3300005834 Bacteria 2280
118 Ga0068870_10044717 3300005840 Bacteria 2315
119 Ga0068863_100001185 3300005841 Bacteria 26042
120 Ga0068863_100001822 3300005841 Bacteria 21165
121 Ga0068858_100000421 3300005842 Bacteria 44146
122 Ga0068858_100006405 3300005842 Bacteria 11470
123 Ga0068860_100000060 3300005843 Bacteria 195631
124 Ga0068860_100001068 3300005843 Bacteria 30204
125 Ga0068860_100001069 3300005843 Bacteria 30180
126 Ga0068860_100020016 3300005843 Bacteria 6484
127 Ga0068860_100145131 3300005843 Bacteria 2283
128 Ga0068862_100332996 3300005844 Bacteria 1404
129 Ga0068862_100434017 3300005844 Bacteria 1235
130 Ga0068862_100622941 3300005844 Bacteria 1038
131 Ga0068862_101221162 3300005844 Bacteria 751
132 Ga0081540_1185638 3300005983 Unclassified 772
133 Ga0081539_10000925 3300005985 Bacteria 55202
134 Ga0075366_10094053 3300006195 Bacteria 1797
135 Ga0075366_10223513 3300006195 Bacteria 1147
136 Ga0097621_100001048 3300006237 Bacteria 19419
137 Ga0097621_100022275 3300006237 Bacteria 4917
138 Ga0097621_100082364 3300006237 Bacteria 2679
139 Ga0097621_100188908 3300006237 Bacteria 1783
140 Ga0097621_100462305 3300006237 Bacteria 1145
141 Ga0068871_100007495 3300006358 Bacteria 7804
142 Ga0068871_100051499 3300006358 Bacteria 3333
143 Ga0075428_100778421 3300006844 Bacteria 1017
144 Ga0075429_100074569 3300006880 Bacteria 2955
145 Ga0068865_100006873 3300006881 Bacteria 6971
146 Ga0068865_100022483 3300006881 Bacteria 4114
147 Ga0068865_100206510 3300006881 Bacteria 1528
148 Ga0068865_100261953 3300006881 Bacteria 1369
149 Ga0097620_100001025 3300006931 Bacteria 28627
150 Ga0097620_100261864 3300006931 Bacteria 1821
151 Ga0097620_100261940 3300006931 Unclassified 1820
152 Ga0097620_100954609 3300006931 Unclassified 940
153 Ga0105240_10006461 3300009093 Bacteria 17226
154 Ga0105240_10155709 3300009093 Bacteria 2718
155 Ga0105240_10279782 3300009093 Bacteria 1917
156 Ga0105245_10407297 3300009098 Bacteria 1360
157 Ga0105247_10010507 3300009101 Bacteria 5595
158 Ga0114129_10001257 3300009147 Bacteria 33836
159 Ga0105243_10285585 3300009148 Bacteria 1488
160 Ga0105241_10000471 3300009174 Bacteria 30433
161 Ga0105241_10005849 3300009174 Bacteria 9078
162 Ga0105241_11007687 3300009174 Bacteria 779
163 Ga0105242_10044724 3300009176 Bacteria 3586
164 Ga0105237_10002967 3300009545 Bacteria 20532
165 Ga0105237_10012025 3300009545 Bacteria 9141
166 Ga0105237_10449662 3300009545 Bacteria 1294
167 Ga0105249_10001502 3300009553 Bacteria 20455
168 Ga0105249_10004283 3300009553 Bacteria 12331
169 Ga0105249_10009470 3300009553 Bacteria 8530
170 Ga0105249_10440172 3300009553 Unclassified 1340
171 Ga0105239_10044725 3300010375 Bacteria 4853
172 Ga0105239_10053552 3300010375 Bacteria 4427
173 Ga0105246_10010333 3300011119 Bacteria 5772
174 Ga0157371_10015931 3300013102 Bacteria 5623
175 Ga0157371_10117223 3300013102 Bacteria 1893
176 Ga0157370_10003868 3300013104 Bacteria 17439
177 Ga0157370_10011354 3300013104 Bacteria 9326
178 Ga0157370_10084358 3300013104 Bacteria 2986
179 Ga0157370_10311908 3300013104 Bacteria 1451
180 Ga0157374_10000850 3300013296 Bacteria 26701
181 Ga0157374_10026293 3300013296 Bacteria 5236
182 Ga0157374_10038161 3300013296 Bacteria 4414
183 Ga0157374_10104851 3300013296 Bacteria 2715
184 Ga0157378_10003999 3300013297 Bacteria 13023
185 Ga0163162_10000574 3300013306 Bacteria 34026
186 Ga0163162_10000964 3300013306 Bacteria 26690
187 Ga0163162_10003450 3300013306 Bacteria 15102
188 Ga0163162_10005210 3300013306 Bacteria 12537
189 Ga0163162_10054665 3300013306 Bacteria 4017
190 Ga0163162_10107868 3300013306 Bacteria 2880
191 Ga0163162_10358902 3300013306 Bacteria 1590
192 Ga0163162_10694626 3300013306 Bacteria 1139
193 Ga0157372_10040899 3300013307 Bacteria 5123
194 Ga0157372_10246963 3300013307 Bacteria 2071
195 Ga0157372_10828319 3300013307 Bacteria 1074
196 Ga0157375_10002620 3300013308 Bacteria 15589
197 Ga0157375_10005336 3300013308 Bacteria 11170
198 Ga0157375_10029600 3300013308 Bacteria 5153
199 Ga0157375_10186701 3300013308 Bacteria 2227
200 Ga0157375_10479817 3300013308 Bacteria 1408
201 Ga0157375_10499637 3300013308 Bacteria 1380
202 Ga0157375_10694814 3300013308 Bacteria 1171
203 Ga0163163_10000784 3300014325 Bacteria 26949
204 Ga0163163_10014131 3300014325 Bacteria 7332
205 Ga0163163_10244359 3300014325 Bacteria 1845
206 Ga0163163_11158639 3300014325 Unclassified 836
207 Ga0157380_10345928 3300014326 Unclassified 1389
208 Ga0157380_11020365 3300014326 Bacteria 862
209 Ga0157377_10025030 3300014745 Bacteria 3179
210 Ga0157377_10265242 3300014745 Bacteria 1119
211 Ga0157379_10001247 3300014968 Bacteria 20630
212 Ga0157379_10011514 3300014968 Bacteria 7719
213 Ga0157379_10117184 3300014968 Bacteria 2395
214 Ga0157379_10177454 3300014968 Bacteria 1924
215 Ga0157379_10608962 3300014968 Unclassified 1020
216 Ga0157376_10000312 3300014969 Bacteria 32517
217 Ga0157376_10019641 3300014969 Bacteria 5213
218 Ga0157376_10110443 3300014969 Bacteria 2419
219 Ga0157376_10152598 3300014969 Bacteria 2085
220 Ga0163161_10046006 3300017792 Bacteria 3148
221 Ga0163161_10091114 3300017792 Bacteria 2256
222 Ga0209258_100075 3300025242 Bacteria 270751
223 Ga0209646_1000562 3300025246 Bacteria 15554
224 Ga0209148_1000085 3300025254 Bacteria 265193
225 Ga0209455_1001679 3300025272 Bacteria 9515
226 Ga0209758_1094435 3300025297 Bacteria 867
227 Ga0207656_10060942 3300025321 Bacteria 1655
228 Ga0207656_10136505 3300025321 Bacteria 1153
229 Ga0207682_10013932 3300025893 Bacteria 3132
230 Ga0207642_10034176 3300025899 Bacteria 2159
231 Ga0207710_10016876 3300025900 Bacteria 3092
232 Ga0207688_10004973 3300025901 Bacteria 7233
233 Ga0207680_10000367 3300025903 Bacteria 21706
234 Ga0207680_10071758 3300025903 Bacteria 2147
235 Ga0207645_10003185 3300025907 Bacteria 12556
236 Ga0207645_10011511 3300025907 Bacteria 6037
237 Ga0207705_10003464 3300025909 Bacteria 11997
238 Ga0207705_10140797 3300025909 Bacteria 1801
239 Ga0207705_10220876 3300025909 Bacteria 1439
240 Ga0207654_10001064 3300025911 Bacteria 14934
241 Ga0207695_10018970 3300025913 Bacteria 7934
242 Ga0207695_10121568 3300025913 Bacteria 2578
243 Ga0207671_10003728 3300025914 Bacteria 15016
244 Ga0207671_10288827 3300025914 Bacteria 1294
245 Ga0207660_10021874 3300025917 Bacteria 4304
246 Ga0207657_10028281 3300025919 Bacteria 5116
247 Ga0207649_10011943 3300025920 Bacteria 4804
248 Ga0207649_10508306 3300025920 Bacteria 917
249 Ga0207652_10003072 3300025921 Bacteria 13936
250 Ga0207681_10014733 3300025923 Bacteria 4868
251 Ga0207681_10700311 3300025923 Bacteria 842
252 Ga0207650_10022605 3300025925 Bacteria 4452
253 Ga0207650_10042147 3300025925 Bacteria 3348
254 Ga0207650_10198893 3300025925 Bacteria 1604
255 Ga0207650_10610583 3300025925 Bacteria 918
256 Ga0207659_10271563 3300025926 Bacteria 1383
257 Ga0207659_10468103 3300025926 Bacteria 1063
258 Ga0207687_10234980 3300025927 Bacteria 1450
259 Ga0207687_10239350 3300025927 Bacteria 1437
260 Ga0207644_10154895 3300025931 Bacteria 1776
261 Ga0207690_10062849 3300025932 Bacteria 2530
262 Ga0207706_10005545 3300025933 Bacteria 11767
263 Ga0207706_10011117 3300025933 Bacteria 8203
264 Ga0207686_10129466 3300025934 Bacteria 1729
265 Ga0207670_10091206 3300025936 Unclassified 2154
266 Ga0207669_10058749 3300025937 Bacteria 2348
267 Ga0207704_10003908 3300025938 Bacteria 6775
268 Ga0207704_10683530 3300025938 Bacteria 848
269 Ga0207691_10000060 3300025940 Bacteria 86844
270 Ga0207691_10055331 3300025940 Bacteria 3616
271 Ga0207689_10001980 3300025942 Bacteria 19344
272 Ga0207689_10002457 3300025942 Bacteria 17262
273 Ga0207689_10050525 3300025942 Bacteria 3428
274 Ga0207689_10396806 3300025942 Bacteria 1150
275 Ga0207661_10016487 3300025944 Bacteria 5451
276 Ga0207661_10022044 3300025944 Bacteria 4788
277 Ga0207661_10494888 3300025944 Bacteria 1117
278 Ga0207679_10008848 3300025945 Bacteria 6420
279 Ga0207679_10093040 3300025945 Bacteria 2337
280 Ga0207667_10015800 3300025949 Bacteria 8556
281 Ga0207667_10337003 3300025949 Bacteria 1540
282 Ga0207712_10018452 3300025961 Bacteria 4544
283 Ga0207668_10001572 3300025972 Bacteria 13358
284 Ga0207658_10000441 3300025986 Bacteria 39124
285 Ga0207658_10045400 3300025986 Bacteria 3203
286 Ga0207658_10099279 3300025986 Bacteria 2277
287 Ga0207658_10816511 3300025986 Bacteria 847
288 Ga0207677_10001365 3300026023 Bacteria 13038
289 Ga0207677_10084763 3300026023 Bacteria 2285
290 Ga0207677_10125009 3300026023 Bacteria 1942
291 Ga0207677_10259155 3300026023 Bacteria 1417
292 Ga0207677_10855671 3300026023 Bacteria 817
293 Ga0207703_10003385 3300026035 Bacteria 13390
294 Ga0207703_10191675 3300026035 Bacteria 1811
295 Ga0207703_11394348 3300026035 Bacteria 674
296 Ga0207639_10005269 3300026041 Bacteria 8727
297 Ga0207639_10042512 3300026041 Bacteria 3406
298 Ga0207639_10092024 3300026041 Bacteria 2430
299 Ga0207678_10165443 3300026067 Unclassified 1889
300 Ga0207678_10287768 3300026067 Unclassified 1411
301 Ga0207678_10392963 3300026067 Bacteria 1200
302 Ga0207702_10262610 3300026078 Bacteria 1626
303 Ga0207641_10000176 3300026088 Bacteria 88863
304 Ga0207641_10005463 3300026088 Bacteria 10839
305 Ga0207641_10048353 3300026088 Bacteria 3590
306 Ga0207648_10003646 3300026089 Bacteria 16119
307 Ga0207648_10006310 3300026089 Bacteria 11791
308 Ga0207648_10006712 3300026089 Bacteria 11417
309 Ga0207648_10281664 3300026089 Bacteria 1487
310 Ga0207648_10903018 3300026089 Unclassified 825
311 Ga0207676_10001290 3300026095 Bacteria 18640
312 Ga0207676_10011486 3300026095 Bacteria 6332
313 Ga0207676_10094263 3300026095 Bacteria 2466
314 Ga0207676_10128482 3300026095 Bacteria 2151
315 Ga0207676_10669177 3300026095 Bacteria 1003
316 Ga0207674_10001543 3300026116 Bacteria 29681
317 Ga0207674_10194531 3300026116 Bacteria 1978
318 Ga0207674_10318911 3300026116 Bacteria 1504
319 Ga0207674_10336961 3300026116 Bacteria 1458
320 Ga0207675_100110320 3300026118 Bacteria 2596
321 Ga0207683_10087930 3300026121 Bacteria 2764
322 Ga0207683_10435477 3300026121 Bacteria 1208
323 Ga0207698_10004823 3300026142 Bacteria 8259
324 Ga0207698_10034461 3300026142 Bacteria 3691
325 Ga0207698_10109290 3300026142 Bacteria 2313
326 Ga0207698_11121845 3300026142 Unclassified 799
327 Ga0209999_1039196 3300027543 Bacteria 887
328 Ga0268266_10000024 3300028379 Bacteria 490820
329 Ga0268266_10009886 3300028379 Bacteria 8386
330 Ga0268266_10325296 3300028379 Bacteria 1440
331 Ga0268266_10507046 3300028379 Bacteria 1152
332 Ga0268264_10000243 3300028381 Bacteria 102854
333 Ga0268264_10000998 3300028381 Bacteria 28836
334 Ga0268264_10006081 3300028381 Bacteria 10198
335 Ga0268264_10050226 3300028381 Bacteria 3472
336 Ga0268264_10693719 3300028381 Bacteria 1011
337 Ga0307517_10127227 3300028786 Bacteria 1853
338 Ga0307511_10000892 3300030521 Bacteria 31389
339 Ga0265327_10004167 3300031251 Bacteria 13044
340 Ga0265327_10043622 3300031251 Bacteria 2398
341 Ga0307513_10203786 3300031456 Bacteria 1816
342 Ga0307513_10260972 3300031456 Bacteria 1522
343 Ga0307509_10007247 3300031507 Bacteria 14588
344 Ga0307509_10221913 3300031507 Bacteria 1702
345 Ga0307508_10000277 3300031616 Bacteria 63110
346 Ga0307516_10000786 3300031730 Bacteria 43327
347 Ga0307516_10207343 3300031730 Bacteria 1676
348 Ga0316577_10249170 3300031733 Bacteria 1005
349 Ga0307413_10239257 3300031824 Unclassified 1339
350 Ga0307410_10148017 3300031852 Unclassified 1745
351 Ga0307406_10122991 3300031901 Bacteria 1808
352 Ga0307407_10299054 3300031903 Unclassified 1121
353 Ga0307409_100200015 3300031995 Unclassified 1787
354 Ga0307414_10053978 3300032004 Bacteria 2806
355 Ga0307414_10545187 3300032004 Unclassified 1033
356 Ga0307510_10000208 3300033180 Bacteria 51631
357 Ga0373934_0163832 3300035086 Bacteria 912
358 Ga0373943_0414936 3300035170 Bacteria 779
359 Ga0373955_0060634 3300035172 Bacteria 2087
360 Ga0373924_0094904 3300035410 Bacteria 1279
361 Ga0373935_0269881 3300035692 Bacteria 1195
362 Ga0373933_0247657 3300035724 Bacteria 1147
363 Ga0373937_0021120 3300036401 Bacteria 5843
364 Ga0316584_0381445 3300036712 Bacteria 1007
365 Ga0436365_0741238 3300039437 Bacteria 21789
366 Ga0436365_1084760 3300039437 Bacteria 1719
367 Ga0439436_0004340 3300041404 Bacteria 4343
368 Ga0439439_0013123 3300041406 Bacteria 2007
369 Ga0439439_0032038 3300041406 Bacteria 1342
370 Ga0451791_0748860 3300041451 Bacteria 1457
371 Ga0439433_0009196 3300041999 Bacteria 2151
372 Ga0439442_005890 3300042002 Bacteria 2456
373 Ga0439442_051592 3300042002 Unclassified 868
374 Ga0439445_0094006 3300042004 Bacteria 846
375 Ga0439449_0028194 3300042007 Bacteria 2093
376 Ga0439449_0037942 3300042007 Bacteria 1792
377 Ga0439462_0005868 3300042015 Bacteria 3041
378 Ga0450894_018658 3300042131 Bacteria 928
379 Ga0439446_0027134 3300042156 Bacteria 1643
380 Ga0451577_0196915 3300042876 Bacteria 1818
381 Ga0466969_0001848 3300044656 Bacteria 11316
382 Ga0466972_0000050 3300044658 Bacteria 118759
383 Ga0466972_0000336 3300044658 Bacteria 25992
384 Ga0466972_0002843 3300044658 Bacteria 8569
385 Ga0466972_0274786 3300044658 Bacteria 787
386 Ga0466966_0000074 3300044684 Bacteria 63538
387 Ga0466961_0093115 3300044693 Bacteria 1902
388 Ga0466964_0024467 3300044706 Bacteria 2354
389 Ga0466968_0101962 3300044735 Bacteria 1282
390 Ga0466970_0004106 3300044765 Bacteria 7157
391 Ga0466957_0002572 3300044842 Bacteria 9763
392 Ga0466957_0322374 3300044842 Bacteria 1043
393 Ga0466959_0000031 3300045049 Bacteria 111271
394 Ga0466959_0097486 3300045049 Bacteria 2107
395 Ga0466967_0093753 3300045976 Bacteria 2733
396 Ga0495592_0030421 3300046454 Bacteria 4084
397 Ga0495651_0109840 3300046462 Bacteria 2041
398 Ga0495580_0422867 3300046472 Unclassified 896
399 Ga0495606_0006636 3300046507 Bacteria 10611
400 Ga0495618_0285636 3300046514 Bacteria 1028
401 Ga0495628_0172172 3300046516 Bacteria 1641
402 Ga0495630_0022029 3300046517 Bacteria 4707
403 Ga0495632_0250715 3300046519 Bacteria 794
404 Ga0495648_0013136 3300046524 Bacteria 6140
405 Ga0495652_0424350 3300046529 Bacteria 936
406 Ga0495622_0128836 3300046557 Bacteria 1153
407 Ga0495667_0088516 3300046559 Bacteria 2007
408 Ga0495668_0000212 3300046616 Bacteria 84542
409 Ga0495634_0034122 3300046642 Bacteria 3493
410 Ga0495625_0171010 3300046660 Bacteria 1451
411 Ga0495625_0245175 3300046660 Bacteria 1165
412 Ga0495646_0223224 3300046680 Bacteria 1018
413 Ga0495613_0216914 3300046689 Bacteria 1344
414 Ga0495660_0173645 3300046810 Bacteria 1048
415 Ga0495604_0370369 3300047317 Bacteria 948
416 Ga0495672_0017982 3300047320 Bacteria 4708
417 Ga0495687_000014 3300047443 Bacteria 366896
418 Ga0495686_0027318 3300047472 Bacteria 3728
419 Ga0495686_0035925 3300047472 Bacteria 3181
420 Ga0496101_0924118 3300048904 Bacteria 687
421 Ga0496108_0474470 3300048911 Bacteria 1093
422 Ga0496109_0085238 3300048912 Bacteria 2916
423 Ga0496115_0120928 3300048918 Bacteria 2155
424 Ga0496124_0091919 3300048927 Bacteria 2472
425 Ga0501037_0133500 3300049573 Bacteria 1779
426 Ga0501046_0297666 3300049580 Bacteria 1179
427 Ga0501047_0050953 3300049581 Bacteria 3998
428 Ga0501047_0138435 3300049581 Bacteria 2313
429 Ga0501048_0577647 3300049582 Bacteria 807
430 Ga0501202_003841 3300049652 Bacteria 2594
431 Ga0501207_012067 3300049654 Bacteria 1295
432 Ga0501246_010576 3300049676 Bacteria 845
433 Ga0501253_030683 3300049683 Bacteria 1023
434 Ga0501219_000407 3300049703 Bacteria 7172
435 Ga0501241_004054 3300049758 Bacteria 2756
436 Ga0501035_0088757 3300049822 Bacteria 2724
437 Ga0501044_0009162 3300049823 Bacteria 10811
438 Ga0501284_00008 3300050005 Bacteria 143517
439 nmdc:mga09592_1003456_c1 3300050508 Bacteria 698
440 nmdc:mga09592_277279_c1 3300050508 Bacteria 1454
441 nmdc:mga08y16_40608_c1 3300050511 Unclassified 4875
442 Ga0500644_0000233 3300053088 Bacteria 31422
443 Ga0500644_0138836 3300053088 Bacteria 964
444 Ga0500646_0002809 3300053090 Bacteria 4474
445 Ga0500583_0000014 3300053092 Bacteria 147919
446 Ga0500583_0003162 3300053092 Bacteria 5116
447 Ga0500583_0005386 3300053092 Bacteria 4285
448 Ga0500651_0234329 3300053093 Bacteria 1073
449 Ga0500650_0048540 3300053098 Bacteria 1969
450 Ga0500572_070495 3300053111 Bacteria 1079
451 Ga0500607_068668 3300053121 Bacteria 1834
452 Ga0500608_213845 3300053122 Bacteria 785
453 Ga0500658_0231520 3300053134 Bacteria 848
454 Ga0500559_0195814 3300053136 Unclassified 952
455 Ga0500585_184080 3300053144 Bacteria 707
456 Ga0500588_0004605 3300053146 Bacteria 3001
457 Ga0500589_010763 3300053147 Bacteria 3927
458 Ga0500590_164696 3300053148 Bacteria 983
459 Ga0500622_0030268 3300053156 Bacteria 2843
460 Ga0500633_0000490 3300053160 Bacteria 6312
461 Ga0500636_0067768 3300053177 Bacteria 2073

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031733 Ga0316577_10249170 Ga0316577_102491702 193
2 3300033180 Ga0307510_10000208 Ga0307510_100002082 193
3 3300046507 Ga0495606_0006636 Ga0495606_0006636_6382_6963 193
4 3300014326 Ga0157380_11020365 Ga0157380_110203651 199
5 3300036712 Ga0316584_0381445 Ga0316584_0381445_390_989 199
6 3300003322 rootL2_10378801 rootL2_103788012 200
7 3300006880 Ga0075429_100074569 Ga0075429_1000745691 201
8 3300013104 Ga0157370_10311908 Ga0157370_103119082 201
9 3300031730 Ga0307516_10207343 Ga0307516_102073432 201
10 3300053122 Ga0500608_213845 Ga0500608_213845_104_709 201
11 iso_pu_bacteria 2738541278 2738729066 202
12 iso_pu_bacteria 2818991444 2819587931 202
13 3300005983 Ga0081540_1185638 Ga0081540_11856381 203
14 3300031730 Ga0307516_10000786 Ga0307516_1000078614 203
15 3300042876 Ga0451577_0196915 Ga0451577_0196915_932_1549 203
16 3300005331 Ga0070670_100033182 Ga0070670_1000331822 204
17 3300005366 Ga0070659_100217735 Ga0070659_1002177351 204
18 3300005563 Ga0068855_100008961 Ga0068855_1000089615 204
19 3300009553 Ga0105249_10009470 Ga0105249_100094704 204
20 3300014325 Ga0163163_10244359 Ga0163163_102443592 204
21 3300025925 Ga0207650_10022605 Ga0207650_100226052 204
22 3300025932 Ga0207690_10062849 Ga0207690_100628492 204
23 3300031251 Ga0265327_10043622 Ga0265327_100436223 204
24 3300039437 Ga0436365_0741238 Ga0436365_0741238_21110_21724 204
25 3300039437 Ga0436365_1084760 Ga0436365_1084760_818_1432 204
26 3300049703 Ga0501219_000407 Ga0501219_000407_4999_5613 204
27 3300049758 Ga0501241_004054 Ga0501241_004054_1282_1896 204
28 3300050005 Ga0501284_00008 Ga0501284_00008_110501_111115 204
29 3300003320 rootH2_10150878 rootH2_101508782 205
30 3300003323 rootH1_10120254 rootH1_101202542 205
31 3300005563 Ga0068855_100001762 Ga0068855_10000176225 205
32 3300005577 Ga0068857_100028355 Ga0068857_1000283554 205
33 3300005614 Ga0068856_100007116 Ga0068856_1000071162 205
34 3300005843 Ga0068860_100145131 Ga0068860_1001451312 205
35 3300005844 Ga0068862_100332996 Ga0068862_1003329963 205
36 3300005844 Ga0068862_101221162 Ga0068862_1012211621 205
37 3300006195 Ga0075366_10094053 Ga0075366_100940532 205
38 3300006195 Ga0075366_10223513 Ga0075366_102235132 205
39 3300009147 Ga0114129_10001257 Ga0114129_1000125725 205
40 3300009174 Ga0105241_10005849 Ga0105241_100058493 205
41 3300013307 Ga0157372_10828319 Ga0157372_108283191 205
42 3300025246 Ga0209646_1000562 Ga0209646_10005628 205
43 3300025949 Ga0207667_10015800 Ga0207667_100158005 205
44 3300026116 Ga0207674_10194531 Ga0207674_101945312 205
45 3300028379 Ga0268266_10325296 Ga0268266_103252962 205
46 3300028381 Ga0268264_10693719 Ga0268264_106937191 205
47 3300031507 Ga0307509_10007247 Ga0307509_100072474 205
48 3300031824 Ga0307413_10239257 Ga0307413_102392572 205
49 3300031852 Ga0307410_10148017 Ga0307410_101480172 205
50 3300031903 Ga0307407_10299054 Ga0307407_102990541 205
51 3300031995 Ga0307409_100200015 Ga0307409_1002000152 205
52 3300032004 Ga0307414_10545187 Ga0307414_105451872 205
53 3300041404 Ga0439436_0004340 Ga0439436_0004340_1824_2441 205
54 3300041406 Ga0439439_0013123 Ga0439439_0013123_656_1273 205
55 3300041406 Ga0439439_0032038 Ga0439439_0032038_216_833 205
56 3300041451 Ga0451791_0748860 Ga0451791_0748860_284_901 205
57 3300041999 Ga0439433_0009196 Ga0439433_0009196_1461_2078 205
58 3300042007 Ga0439449_0028194 Ga0439449_0028194_340_957 205
59 3300042007 Ga0439449_0037942 Ga0439449_0037942_803_1420 205
60 3300042015 Ga0439462_0005868 Ga0439462_0005868_70_687 205
61 3300044656 Ga0466969_0001848 Ga0466969_0001848_1354_1971 205
62 3300044658 Ga0466972_0000336 Ga0466972_0000336_10170_10787 205
63 3300044658 Ga0466972_0002843 Ga0466972_0002843_1157_1774 205
64 3300044684 Ga0466966_0000074 Ga0466966_0000074_33500_34117 205
65 3300044693 Ga0466961_0093115 Ga0466961_0093115_491_1108 205
66 3300044706 Ga0466964_0024467 Ga0466964_0024467_1185_1808 205
67 3300044842 Ga0466957_0002572 Ga0466957_0002572_5586_6203 205
68 3300045049 Ga0466959_0000031 Ga0466959_0000031_62819_63436 205
69 3300046557 Ga0495622_0128836 Ga0495622_0128836_261_878 205
70 3300049581 Ga0501047_0050953 Ga0501047_0050953_2257_2874 205
71 3300049581 Ga0501047_0138435 Ga0501047_0138435_776_1393 205
72 3300049582 Ga0501048_0577647 Ga0501048_0577647_15_632 205
73 3300049822 Ga0501035_0088757 Ga0501035_0088757_2016_2633 205
74 3300049823 Ga0501044_0009162 Ga0501044_0009162_6473_7090 205
75 3300053090 Ga0500646_0002809 Ga0500646_0002809_3512_4129 205
76 3300053092 Ga0500583_0000014 Ga0500583_0000014_34767_35384 205
77 3300053092 Ga0500583_0005386 Ga0500583_0005386_2532_3149 205
78 3300053147 Ga0500589_010763 Ga0500589_010763_1291_1908 205
79 3300053156 Ga0500622_0030268 Ga0500622_0030268_224_841 205
80 iso_pu_bacteria 2929239360 2929245347 205
81 3300003323 rootH1_10002518 rootH1_100025185 206
82 3300005328 Ga0070676_10000329 Ga0070676_1000032910 206
83 3300005331 Ga0070670_100431432 Ga0070670_1004314322 206
84 3300005335 Ga0070666_10000179 Ga0070666_100001796 206
85 3300005335 Ga0070666_10000194 Ga0070666_1000019425 206
86 3300005338 Ga0068868_100000883 Ga0068868_1000008838 206
87 3300005340 Ga0070689_100128290 Ga0070689_1001282902 206
88 3300005340 Ga0070689_100145241 Ga0070689_1001452412 206
89 3300005347 Ga0070668_100001251 Ga0070668_1000012515 206
90 3300005355 Ga0070671_100023411 Ga0070671_1000234113 206
91 3300005355 Ga0070671_100301188 Ga0070671_1003011882 206
92 3300005364 Ga0070673_100000085 Ga0070673_10000008510 206
93 3300005364 Ga0070673_100562403 Ga0070673_1005624031 206
94 3300005367 Ga0070667_100002397 Ga0070667_1000023979 206
95 3300005455 Ga0070663_100118120 Ga0070663_1001181202 206
96 3300005457 Ga0070662_100003544 Ga0070662_1000035446 206
97 3300005459 Ga0068867_100002846 Ga0068867_1000028466 206
98 3300005459 Ga0068867_100025410 Ga0068867_1000254102 206
99 3300005459 Ga0068867_100294695 Ga0068867_1002946952 206
100 3300005466 Ga0070685_10244746 Ga0070685_102447462 206
101 3300005466 Ga0070685_10453130 Ga0070685_104531302 206
102 3300005539 Ga0068853_100006990 Ga0068853_1000069906 206
103 3300005543 Ga0070672_100000963 Ga0070672_1000009636 206
104 3300005548 Ga0070665_100001739 Ga0070665_1000017392 206
105 3300005564 Ga0070664_100219903 Ga0070664_1002199032 206
106 3300005577 Ga0068857_100299642 Ga0068857_1002996422 206
107 3300005616 Ga0068852_100003790 Ga0068852_1000037905 206
108 3300005617 Ga0068859_100001025 Ga0068859_10000102521 206
109 3300005618 Ga0068864_100000176 Ga0068864_10000017641 206
110 3300005618 Ga0068864_100003444 Ga0068864_1000034443 206
111 3300005719 Ga0068861_100079534 Ga0068861_1000795343 206
112 3300005834 Ga0068851_10004771 Ga0068851_100047711 206
113 3300005834 Ga0068851_10042820 Ga0068851_100428201 206
114 3300005841 Ga0068863_100001185 Ga0068863_10000118515 206
115 3300005841 Ga0068863_100001822 Ga0068863_1000018225 206
116 3300005842 Ga0068858_100000421 Ga0068858_10000042122 206
117 3300005842 Ga0068858_100006405 Ga0068858_1000064055 206
118 3300005843 Ga0068860_100001068 Ga0068860_1000010686 206
119 3300005843 Ga0068860_100001069 Ga0068860_1000010698 206
120 3300005844 Ga0068862_100434017 Ga0068862_1004340172 206
121 3300006237 Ga0097621_100188908 Ga0097621_1001889082 206
122 3300006358 Ga0068871_100007495 Ga0068871_1000074956 206
123 3300006881 Ga0068865_100006873 Ga0068865_1000068733 206
124 3300006931 Ga0097620_100001025 Ga0097620_10000102521 206
125 3300009093 Ga0105240_10155709 Ga0105240_101557092 206
126 3300009098 Ga0105245_10407297 Ga0105245_104072972 206
127 3300009101 Ga0105247_10010507 Ga0105247_100105072 206
128 3300009148 Ga0105243_10285585 Ga0105243_102855852 206
129 3300009174 Ga0105241_10000471 Ga0105241_100004715 206
130 3300009545 Ga0105237_10002967 Ga0105237_100029675 206
131 3300009553 Ga0105249_10001502 Ga0105249_1000150210 206
132 3300009553 Ga0105249_10004283 Ga0105249_100042838 206
133 3300011119 Ga0105246_10010333 Ga0105246_100103332 206
134 3300013296 Ga0157374_10000850 Ga0157374_1000085018 206
135 3300013296 Ga0157374_10104851 Ga0157374_101048512 206
136 3300013297 Ga0157378_10003999 Ga0157378_100039993 206
137 3300013306 Ga0163162_10000964 Ga0163162_1000096418 206
138 3300013306 Ga0163162_10054665 Ga0163162_100546653 206
139 3300013308 Ga0157375_10005336 Ga0157375_100053364 206
140 3300013308 Ga0157375_10499637 Ga0157375_104996372 206
141 3300014325 Ga0163163_10000784 Ga0163163_100007849 206
142 3300014968 Ga0157379_10001247 Ga0157379_1000124715 206
143 3300014968 Ga0157379_10011514 Ga0157379_100115145 206
144 3300014969 Ga0157376_10000312 Ga0157376_100003125 206
145 3300025321 Ga0207656_10060942 Ga0207656_100609422 206
146 3300025900 Ga0207710_10016876 Ga0207710_100168762 206
147 3300025903 Ga0207680_10000367 Ga0207680_100003675 206
148 3300025907 Ga0207645_10003185 Ga0207645_100031857 206
149 3300025909 Ga0207705_10003464 Ga0207705_100034646 206
150 3300025911 Ga0207654_10001064 Ga0207654_100010647 206
151 3300025913 Ga0207695_10121568 Ga0207695_101215682 206
152 3300025914 Ga0207671_10003728 Ga0207671_100037284 206
153 3300025925 Ga0207650_10610583 Ga0207650_106105831 206
154 3300025927 Ga0207687_10234980 Ga0207687_102349802 206
155 3300025927 Ga0207687_10239350 Ga0207687_102393502 206
156 3300025933 Ga0207706_10011117 Ga0207706_100111177 206
157 3300025938 Ga0207704_10003908 Ga0207704_100039083 206
158 3300025940 Ga0207691_10000060 Ga0207691_1000006029 206
159 3300025942 Ga0207689_10002457 Ga0207689_100024579 206
160 3300025945 Ga0207679_10093040 Ga0207679_100930402 206
161 3300025961 Ga0207712_10018452 Ga0207712_100184523 206
162 3300025972 Ga0207668_10001572 Ga0207668_100015724 206
163 3300025986 Ga0207658_10000441 Ga0207658_100004416 206
164 3300026023 Ga0207677_10001365 Ga0207677_100013654 206
165 3300026023 Ga0207677_10259155 Ga0207677_102591551 206
166 3300026035 Ga0207703_10003385 Ga0207703_100033858 206
167 3300026035 Ga0207703_10191675 Ga0207703_101916752 206
168 3300026041 Ga0207639_10042512 Ga0207639_100425123 206
169 3300026088 Ga0207641_10000176 Ga0207641_100001765 206
170 3300026088 Ga0207641_10005463 Ga0207641_100054634 206
171 3300026088 Ga0207641_10048353 Ga0207641_100483534 206
172 3300026089 Ga0207648_10003646 Ga0207648_100036466 206
173 3300026089 Ga0207648_10006310 Ga0207648_1000631010 206
174 3300026095 Ga0207676_10001290 Ga0207676_100012909 206
175 3300026095 Ga0207676_10011486 Ga0207676_100114862 206
176 3300026116 Ga0207674_10318911 Ga0207674_103189111 206
177 3300026118 Ga0207675_100110320 Ga0207675_1001103201 206
178 3300026142 Ga0207698_10034461 Ga0207698_100344612 206
179 3300028379 Ga0268266_10009886 Ga0268266_100098865 206
180 3300028381 Ga0268264_10000998 Ga0268264_1000099820 206
181 3300028381 Ga0268264_10006081 Ga0268264_100060812 206
182 3300031456 Ga0307513_10203786 Ga0307513_102037862 206
183 3300031507 Ga0307509_10221913 Ga0307509_102219132 206
184 3300031616 Ga0307508_10000277 Ga0307508_100002779 206
185 3300042002 Ga0439442_051592 Ga0439442_051592_155_775 206
186 3300044658 Ga0466972_0000050 Ga0466972_0000050_66361_66981 206
187 3300044765 Ga0466970_0004106 Ga0466970_0004106_1526_2146 206
188 3300046660 Ga0495625_0171010 Ga0495625_0171010_123_743 206
189 3300047320 Ga0495672_0017982 Ga0495672_0017982_3491_4111 206
190 3300048911 Ga0496108_0474470 Ga0496108_0474470_20_646 206
191 3300048912 Ga0496109_0085238 Ga0496109_0085238_604_1230 206
192 3300053088 Ga0500644_0138836 Ga0500644_0138836_157_903 206
193 3300053093 Ga0500651_0234329 Ga0500651_0234329_36_656 206
194 3300053098 Ga0500650_0048540 Ga0500650_0048540_660_1406 206
195 3300053111 Ga0500572_070495 Ga0500572_070495_19_639 206
196 3300053144 Ga0500585_184080 Ga0500585_184080_40_660 206
197 3300053146 Ga0500588_0004605 Ga0500588_0004605_1451_2071 206
198 3300053177 Ga0500636_0067768 Ga0500636_0067768_468_1088 206
199 3300003322 rootL2_10137917 rootL2_101379172 207
200 3300005336 Ga0070680_100052936 Ga0070680_1000529362 207
201 3300005337 Ga0070682_100390634 Ga0070682_1003906341 207
202 3300005339 Ga0070660_100010716 Ga0070660_1000107166 207
203 3300005458 Ga0070681_10026684 Ga0070681_100266846 207
204 3300005530 Ga0070679_100001919 Ga0070679_1000019194 207
205 3300005548 Ga0070665_101000843 Ga0070665_1010008431 207
206 3300005614 Ga0068856_100420676 Ga0068856_1004206762 207
207 3300005616 Ga0068852_100083457 Ga0068852_1000834573 207
208 3300006237 Ga0097621_100001048 Ga0097621_1000010483 207
209 3300009093 Ga0105240_10006461 Ga0105240_100064615 207
210 3300009545 Ga0105237_10012025 Ga0105237_100120252 207
211 3300010375 Ga0105239_10044725 Ga0105239_100447254 207
212 3300013102 Ga0157371_10015931 Ga0157371_100159312 207
213 3300013102 Ga0157371_10117223 Ga0157371_101172232 207
214 3300013104 Ga0157370_10003868 Ga0157370_1000386812 207
215 3300013104 Ga0157370_10084358 Ga0157370_100843582 207
216 3300013306 Ga0163162_10000574 Ga0163162_100005745 207
217 3300013306 Ga0163162_10005210 Ga0163162_100052102 207
218 3300013306 Ga0163162_10358902 Ga0163162_103589021 207
219 3300013307 Ga0157372_10040899 Ga0157372_100408993 207
220 3300013307 Ga0157372_10246963 Ga0157372_102469632 207
221 3300013308 Ga0157375_10479817 Ga0157375_104798172 207
222 3300014968 Ga0157379_10177454 Ga0157379_101774541 207
223 3300014969 Ga0157376_10019641 Ga0157376_100196414 207
224 3300014969 Ga0157376_10152598 Ga0157376_101525982 207
225 3300025272 Ga0209455_1001679 Ga0209455_10016794 207
226 3300025909 Ga0207705_10140797 Ga0207705_101407972 207
227 3300025909 Ga0207705_10220876 Ga0207705_102208762 207
228 3300025917 Ga0207660_10021874 Ga0207660_100218743 207
229 3300025919 Ga0207657_10028281 Ga0207657_100282815 207
230 3300025921 Ga0207652_10003072 Ga0207652_100030727 207
231 3300025949 Ga0207667_10337003 Ga0207667_103370032 207
232 3300026142 Ga0207698_10004823 Ga0207698_100048235 207
233 3300027543 Ga0209999_1039196 Ga0209999_10391961 207
234 3300031251 Ga0265327_10004167 Ga0265327_100041672 207
235 3300031456 Ga0307513_10260972 Ga0307513_102609721 207
236 3300031901 Ga0307406_10122991 Ga0307406_101229912 207
237 3300044658 Ga0466972_0274786 Ga0466972_0274786_41_667 207
238 3300044735 Ga0466968_0101962 Ga0466968_0101962_567_1193 207
239 3300044842 Ga0466957_0322374 Ga0466957_0322374_243_869 207
240 3300045049 Ga0466959_0097486 Ga0466959_0097486_1185_1811 207
241 3300046462 Ga0495651_0109840 Ga0495651_0109840_1342_1965 207
242 3300046472 Ga0495580_0422867 Ga0495580_0422867_156_779 207
243 3300046529 Ga0495652_0424350 Ga0495652_0424350_63_686 207
244 3300047472 Ga0495686_0027318 Ga0495686_0027318_1390_2028 207
245 3300047472 Ga0495686_0035925 Ga0495686_0035925_2468_3091 207
246 3300048927 Ga0496124_0091919 Ga0496124_0091919_679_1332 207
247 3300049652 Ga0501202_003841 Ga0501202_003841_829_1455 207
248 3300049676 Ga0501246_010576 Ga0501246_010576_59_685 207
249 3300049683 Ga0501253_030683 Ga0501253_030683_253_879 207
250 3300005331 Ga0070670_100357404 Ga0070670_1003574042 208
251 3300005455 Ga0070663_100706646 Ga0070663_1007066461 208
252 3300005456 Ga0070678_100020522 Ga0070678_1000205221 208
253 3300009545 Ga0105237_10449662 Ga0105237_104496621 208
254 3300014325 Ga0163163_11158639 Ga0163163_111586391 208
255 3300025914 Ga0207671_10288827 Ga0207671_102888271 208
256 3300026067 Ga0207678_10165443 Ga0207678_101654432 208
257 3300026089 Ga0207648_10281664 Ga0207648_102816642 208
258 3300026121 Ga0207683_10087930 Ga0207683_100879303 208
259 3300030521 Ga0307511_10000892 Ga0307511_100008925 208
260 3300035692 Ga0373935_0269881 Ga0373935_0269881_325_951 208
261 3300046519 Ga0495632_0250715 Ga0495632_0250715_15_641 208
262 3300048918 Ga0496115_0120928 Ga0496115_0120928_558_1184 208
263 3300050508 nmdc:mga09592_1003456_c1 nmdc:mga09592_1003456_c1_55_681 208
264 3300003761 Ga0055535_1001953 Ga0055535_10019532 209
265 3300003762 Ga0055542_1004511 Ga0055542_10045112 209
266 3300005329 Ga0070683_100034325 Ga0070683_1000343253 209
267 3300005331 Ga0070670_100229565 Ga0070670_1002295652 209
268 3300005331 Ga0070670_100339765 Ga0070670_1003397651 209
269 3300005338 Ga0068868_100243135 Ga0068868_1002431351 209
270 3300005353 Ga0070669_100059311 Ga0070669_1000593112 209
271 3300005354 Ga0070675_100056596 Ga0070675_1000565962 209
272 3300005354 Ga0070675_100138869 Ga0070675_1001388692 209
273 3300005354 Ga0070675_100140141 Ga0070675_1001401413 209
274 3300005364 Ga0070673_100083394 Ga0070673_1000833943 209
275 3300005456 Ga0070678_100119914 Ga0070678_1001199143 209
276 3300005539 Ga0068853_100058901 Ga0068853_1000589012 209
277 3300005544 Ga0070686_100186552 Ga0070686_1001865521 209
278 3300005564 Ga0070664_100677928 Ga0070664_1006779282 209
279 3300005616 Ga0068852_100856098 Ga0068852_1008560981 209
280 3300006237 Ga0097621_100462305 Ga0097621_1004623052 209
281 3300013306 Ga0163162_10694626 Ga0163162_106946262 209
282 3300013308 Ga0157375_10186701 Ga0157375_101867014 209
283 3300025242 Ga0209258_100075 Ga0209258_100075164 209
284 3300025254 Ga0209148_1000085 Ga0209148_100008565 209
285 3300025297 Ga0209758_1094435 Ga0209758_10944351 209
286 3300025925 Ga0207650_10198893 Ga0207650_101988932 209
287 3300025926 Ga0207659_10271563 Ga0207659_102715632 209
288 3300025938 Ga0207704_10683530 Ga0207704_106835301 209
289 3300026023 Ga0207677_10855671 Ga0207677_108556712 209
290 3300026095 Ga0207676_10128482 Ga0207676_101284821 209
291 3300026121 Ga0207683_10435477 Ga0207683_104354771 209
292 3300026142 Ga0207698_11121845 Ga0207698_111218451 209
293 3300032004 Ga0307414_10053978 Ga0307414_100539784 209
294 3300042131 Ga0450894_018658 Ga0450894_018658_21_653 209
295 3300046616 Ga0495668_0000212 Ga0495668_0000212_30611_31246 209
296 3300046660 Ga0495625_0245175 Ga0495625_0245175_336_965 209
297 3300046810 Ga0495660_0173645 Ga0495660_0173645_278_1015 209
298 3300049573 Ga0501037_0133500 Ga0501037_0133500_274_906 209
299 3300049580 Ga0501046_0297666 Ga0501046_0297666_156_788 209
300 3300049654 Ga0501207_012067 Ga0501207_012067_639_1274 209
301 3300050511 nmdc:mga08y16_40608_c1 nmdc:mga08y16_40608_c1_1851_2480 209
302 3300053088 Ga0500644_0000233 Ga0500644_0000233_875_1504 209
303 3300053092 Ga0500583_0003162 Ga0500583_0003162_4049_4678 209
304 3300053121 Ga0500607_068668 Ga0500607_068668_144_773 209
305 3300053136 Ga0500559_0195814 Ga0500559_0195814_275_904 209
306 3300053148 Ga0500590_164696 Ga0500590_164696_144_773 209
307 3300053160 Ga0500633_0000490 Ga0500633_0000490_5315_5944 209
308 3300005471 Ga0070698_100004438 Ga0070698_10000443812 210
309 3300003320 rootH2_10026802 rootH2_100268028 211
310 3300005290 Ga0065712_10193256 Ga0065712_101932562 211
311 3300005328 Ga0070676_10018333 Ga0070676_100183334 211
312 3300005329 Ga0070683_100000581 Ga0070683_10000058117 211
313 3300005329 Ga0070683_100043401 Ga0070683_1000434012 211
314 3300005331 Ga0070670_100108119 Ga0070670_1001081193 211
315 3300005333 Ga0070677_10005846 Ga0070677_100058461 211
316 3300005333 Ga0070677_10130638 Ga0070677_101306381 211
317 3300005334 Ga0068869_100434883 Ga0068869_1004348832 211
318 3300005335 Ga0070666_10006628 Ga0070666_100066282 211
319 3300005338 Ga0068868_100142403 Ga0068868_1001424031 211
320 3300005340 Ga0070689_100036382 Ga0070689_1000363822 211
321 3300005340 Ga0070689_100398225 Ga0070689_1003982252 211
322 3300005344 Ga0070661_100006009 Ga0070661_1000060096 211
323 3300005344 Ga0070661_100333529 Ga0070661_1003335291 211
324 3300005353 Ga0070669_100008682 Ga0070669_1000086824 211
325 3300005354 Ga0070675_100097949 Ga0070675_1000979492 211
326 3300005354 Ga0070675_100229752 Ga0070675_1002297522 211
327 3300005355 Ga0070671_100138951 Ga0070671_1001389512 211
328 3300005365 Ga0070688_100199892 Ga0070688_1001998921 211
329 3300005365 Ga0070688_100292464 Ga0070688_1002924642 211
330 3300005366 Ga0070659_100008415 Ga0070659_1000084153 211
331 3300005367 Ga0070667_100084251 Ga0070667_1000842513 211
332 3300005367 Ga0070667_100164691 Ga0070667_1001646912 211
333 3300005367 Ga0070667_100526553 Ga0070667_1005265532 211
334 3300005455 Ga0070663_100284289 Ga0070663_1002842892 211
335 3300005455 Ga0070663_100288410 Ga0070663_1002884101 211
336 3300005456 Ga0070678_100010180 Ga0070678_1000101802 211
337 3300005457 Ga0070662_100015221 Ga0070662_1000152213 211
338 3300005466 Ga0070685_10076309 Ga0070685_100763092 211
339 3300005535 Ga0070684_100007156 Ga0070684_1000071562 211
340 3300005535 Ga0070684_100064360 Ga0070684_1000643602 211
341 3300005539 Ga0068853_100230973 Ga0068853_1002309732 211
342 3300005548 Ga0070665_100000013 Ga0070665_100000013355 211
343 3300005548 Ga0070665_100050555 Ga0070665_1000505553 211
344 3300005564 Ga0070664_100037450 Ga0070664_1000374504 211
345 3300005564 Ga0070664_100082478 Ga0070664_1000824782 211
346 3300005564 Ga0070664_100099594 Ga0070664_1000995942 211
347 3300005564 Ga0070664_100140207 Ga0070664_1001402072 211
348 3300005577 Ga0068857_100005041 Ga0068857_1000050414 211
349 3300005616 Ga0068852_100156096 Ga0068852_1001560963 211
350 3300005617 Ga0068859_100261938 Ga0068859_1002619382 211
351 3300005617 Ga0068859_100954596 Ga0068859_1009545961 211
352 3300005618 Ga0068864_100149939 Ga0068864_1001499392 211
353 3300005618 Ga0068864_100213555 Ga0068864_1002135552 211
354 3300005718 Ga0068866_10010440 Ga0068866_100104403 211
355 3300005840 Ga0068870_10044717 Ga0068870_100447171 211
356 3300005843 Ga0068860_100000060 Ga0068860_1000000607 211
357 3300005843 Ga0068860_100020016 Ga0068860_1000200163 211
358 3300005844 Ga0068862_100622941 Ga0068862_1006229411 211
359 3300005985 Ga0081539_10000925 Ga0081539_1000092526 211
360 3300006237 Ga0097621_100022275 Ga0097621_1000222752 211
361 3300006237 Ga0097621_100082364 Ga0097621_1000823642 211
362 3300006358 Ga0068871_100051499 Ga0068871_1000514992 211
363 3300006844 Ga0075428_100778421 Ga0075428_1007784213 211
364 3300006881 Ga0068865_100022483 Ga0068865_1000224834 211
365 3300006881 Ga0068865_100206510 Ga0068865_1002065102 211
366 3300006881 Ga0068865_100261953 Ga0068865_1002619531 211
367 3300006931 Ga0097620_100261864 Ga0097620_1002618642 211
368 3300006931 Ga0097620_100261940 Ga0097620_1002619402 211
369 3300006931 Ga0097620_100954609 Ga0097620_1009546091 211
370 3300009093 Ga0105240_10279782 Ga0105240_102797822 211
371 3300009174 Ga0105241_11007687 Ga0105241_110076871 211
372 3300009176 Ga0105242_10044724 Ga0105242_100447244 211
373 3300009553 Ga0105249_10440172 Ga0105249_104401722 211
374 3300010375 Ga0105239_10053552 Ga0105239_100535524 211
375 3300013104 Ga0157370_10011354 Ga0157370_100113543 211
376 3300013296 Ga0157374_10026293 Ga0157374_100262935 211
377 3300013296 Ga0157374_10038161 Ga0157374_100381613 211
378 3300013306 Ga0163162_10003450 Ga0163162_100034509 211
379 3300013306 Ga0163162_10107868 Ga0163162_101078682 211
380 3300013308 Ga0157375_10002620 Ga0157375_100026205 211
381 3300013308 Ga0157375_10029600 Ga0157375_100296003 211
382 3300013308 Ga0157375_10694814 Ga0157375_106948142 211
383 3300014325 Ga0163163_10014131 Ga0163163_100141312 211
384 3300014326 Ga0157380_10345928 Ga0157380_103459281 211
385 3300014745 Ga0157377_10025030 Ga0157377_100250303 211
386 3300014745 Ga0157377_10265242 Ga0157377_102652422 211
387 3300014968 Ga0157379_10117184 Ga0157379_101171843 211
388 3300014968 Ga0157379_10608962 Ga0157379_106089622 211
389 3300014969 Ga0157376_10110443 Ga0157376_101104431 211
390 3300017792 Ga0163161_10046006 Ga0163161_100460062 211
391 3300017792 Ga0163161_10091114 Ga0163161_100911142 211
392 3300025321 Ga0207656_10136505 Ga0207656_101365052 211
393 3300025893 Ga0207682_10013932 Ga0207682_100139324 211
394 3300025899 Ga0207642_10034176 Ga0207642_100341762 211
395 3300025901 Ga0207688_10004973 Ga0207688_100049735 211
396 3300025903 Ga0207680_10071758 Ga0207680_100717582 211
397 3300025907 Ga0207645_10011511 Ga0207645_100115114 211
398 3300025913 Ga0207695_10018970 Ga0207695_100189704 211
399 3300025920 Ga0207649_10011943 Ga0207649_100119434 211
400 3300025920 Ga0207649_10508306 Ga0207649_105083062 211
401 3300025923 Ga0207681_10014733 Ga0207681_100147334 211
402 3300025923 Ga0207681_10700311 Ga0207681_107003111 211
403 3300025925 Ga0207650_10042147 Ga0207650_100421472 211
404 3300025926 Ga0207659_10468103 Ga0207659_104681032 211
405 3300025931 Ga0207644_10154895 Ga0207644_101548952 211
406 3300025933 Ga0207706_10005545 Ga0207706_100055456 211
407 3300025934 Ga0207686_10129466 Ga0207686_101294662 211
408 3300025936 Ga0207670_10091206 Ga0207670_100912061 211
409 3300025937 Ga0207669_10058749 Ga0207669_100587492 211
410 3300025940 Ga0207691_10055331 Ga0207691_100553312 211
411 3300025942 Ga0207689_10001980 Ga0207689_100019801 211
412 3300025942 Ga0207689_10050525 Ga0207689_100505254 211
413 3300025942 Ga0207689_10396806 Ga0207689_103968062 211
414 3300025944 Ga0207661_10016487 Ga0207661_100164872 211
415 3300025944 Ga0207661_10022044 Ga0207661_100220442 211
416 3300025944 Ga0207661_10494888 Ga0207661_104948882 211
417 3300025945 Ga0207679_10008848 Ga0207679_100088485 211
418 3300025986 Ga0207658_10045400 Ga0207658_100454002 211
419 3300025986 Ga0207658_10099279 Ga0207658_100992794 211
420 3300025986 Ga0207658_10816511 Ga0207658_108165112 211
421 3300026023 Ga0207677_10084763 Ga0207677_100847633 211
422 3300026023 Ga0207677_10125009 Ga0207677_101250093 211
423 3300026035 Ga0207703_11394348 Ga0207703_113943481 211
424 3300026041 Ga0207639_10005269 Ga0207639_100052693 211
425 3300026041 Ga0207639_10092024 Ga0207639_100920242 211
426 3300026067 Ga0207678_10287768 Ga0207678_102877682 211
427 3300026067 Ga0207678_10392963 Ga0207678_103929632 211
428 3300026078 Ga0207702_10262610 Ga0207702_102626102 211
429 3300026089 Ga0207648_10006712 Ga0207648_100067127 211
430 3300026089 Ga0207648_10903018 Ga0207648_109030181 211
431 3300026095 Ga0207676_10094263 Ga0207676_100942632 211
432 3300026095 Ga0207676_10669177 Ga0207676_106691772 211
433 3300026116 Ga0207674_10001543 Ga0207674_1000154313 211
434 3300026116 Ga0207674_10336961 Ga0207674_103369612 211
435 3300026142 Ga0207698_10109290 Ga0207698_101092903 211
436 3300028379 Ga0268266_10000024 Ga0268266_1000002449 211
437 3300028379 Ga0268266_10507046 Ga0268266_105070461 211
438 3300028381 Ga0268264_10000243 Ga0268264_1000024393 211
439 3300028381 Ga0268264_10050226 Ga0268264_100502261 211
440 3300028786 Ga0307517_10127227 Ga0307517_101272272 211
441 3300035086 Ga0373934_0163832 Ga0373934_0163832_248_883 211
442 3300035170 Ga0373943_0414936 Ga0373943_0414936_54_689 211
443 3300035172 Ga0373955_0060634 Ga0373955_0060634_210_845 211
444 3300035410 Ga0373924_0094904 Ga0373924_0094904_509_1144 211
445 3300035724 Ga0373933_0247657 Ga0373933_0247657_196_831 211
446 3300036401 Ga0373937_0021120 Ga0373937_0021120_2398_3033 211
447 3300042002 Ga0439442_005890 Ga0439442_005890_358_996 211
448 3300042004 Ga0439445_0094006 Ga0439445_0094006_65_703 211
449 3300042156 Ga0439446_0027134 Ga0439446_0027134_478_1116 211
450 3300045976 Ga0466967_0093753 Ga0466967_0093753_1232_1882 211
451 3300046454 Ga0495592_0030421 Ga0495592_0030421_3149_3784 211
452 3300046514 Ga0495618_0285636 Ga0495618_0285636_353_988 211
453 3300046516 Ga0495628_0172172 Ga0495628_0172172_765_1400 211
454 3300046517 Ga0495630_0022029 Ga0495630_0022029_814_1449 211
455 3300046524 Ga0495648_0013136 Ga0495648_0013136_4582_5220 211
456 3300046559 Ga0495667_0088516 Ga0495667_0088516_364_999 211
457 3300046642 Ga0495634_0034122 Ga0495634_0034122_64_699 211
458 3300046680 Ga0495646_0223224 Ga0495646_0223224_263_898 211
459 3300046689 Ga0495613_0216914 Ga0495613_0216914_590_1225 211
460 3300047317 Ga0495604_0370369 Ga0495604_0370369_237_872 211
461 3300047443 Ga0495687_000014 Ga0495687_000014_315579_316217 211
462 3300048904 Ga0496101_0924118 Ga0496101_0924118_36_671 211
463 3300050508 nmdc:mga09592_277279_c1 nmdc:mga09592_277279_c1_418_1053 211
464 3300053134 Ga0500658_0231520 Ga0500658_0231520_61_699 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

34

157

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nhl-assembly1.cif.gz_A crystal structure of quee from escherichia coli 0.8652 16 202
6nhl-assembly1.cif.gz_B-2 crystal structure of quee from escherichia coli 0.8652 16 202
4njh-assembly1.cif.gz_B crystal structure of quee from burkholderia multivorans in complex with adomet and 6-carboxy-5,6,7,8-tetrahydropterin 0.8492 16 211
5tgs-assembly1.cif.gz_B crystal structure of quee from bacillus subtilis with methionine bound 0.809 15 205
5tgs-assembly1.cif.gz_A crystal structure of quee from bacillus subtilis with methionine bound 0.8005 14 206
ID Description Score Start End Superfamily
af_P64554_2_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9037 16 211 3.20.20.70
af_P64554_2_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8389 16 211 3.20.20.70
4njjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8279 16 211 3.20.20.70
af_Q2G1X7_4_231_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8246 16 205 3.20.20.70
af_Q58218_60_281_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7814 38 177 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A4Q5YDI2-F1-model_v4 7-carboxy-7-deazaguanine synthase QueE 0.987 70 211 GO:0051539
AF-A0A7Y3GPK6-F1-model_v4 7-carboxy-7-deazaguanine synthase QueE 0.9863 85 211 GO:0051539
AF-A0A349MB71-F1-model_v4 7-carboxy-7-deazaguanine synthase QueE 0.9849 62 211 GO:0016829
GO:0051539
AF-A0A4Q5ZGA7-F1-model_v4 Radical SAM protein 0.9845 19 182 GO:0016829
GO:0046872
GO:0051539
AF-A0A090PW06-F1-model_v4 deleted 0.9837 95 211

Feature Viewer

pLDDT pTM Quality
87.77 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map