F449304

General Info

Members Datasets Scaffolds Average Seq Length
464 216 928 129

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10113630|Ga0207684_101136302
Length 143
Sequence LHLTLAASKNPSMADYTHLNLRDDVDDQGPNFGYAPNIEARMARVPLGLEHSGLSYLRLAPGFRIPWGHKHKQQEEVYVLVSGSARIKIDDEIRELKQWDAVRLHRDTVRGFEAGDEGAEFIAVGAPNTGPGDADLIQGWWSD

Samples

Sample ID Description Type Environment
1 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
78 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
132 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
135 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
169 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
170 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
171 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
172 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
184 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 12.93
Rhizosphere 86.21
Stem 0
Stem Tuber 0
Unclassified 15.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207684_10113630 3300025910 Bacteria 2318
2 JGI25406J46586_10070831 3300003203 Bacteria 1095
3 JGI25406J46586_10082490 3300003203 Unclassified 983
4 Ga0070683_100972955 3300005329 Bacteria 814
5 Ga0070683_100974403 3300005329 Bacteria 814
6 Ga0070666_10440577 3300005335 Bacteria 940
7 Ga0068868_100061581 3300005338 Bacteria 2973
8 Ga0068868_100198971 3300005338 Bacteria 1669
9 Ga0070689_100093393 3300005340 Bacteria 2375
10 Ga0070691_10107497 3300005341 Bacteria 1392
11 Ga0070691_10353599 3300005341 Unclassified 816
12 Ga0070692_10800197 3300005345 Unclassified 644
13 Ga0070668_100168894 3300005347 Bacteria 1780
14 Ga0070669_100460919 3300005353 Bacteria 1049
15 Ga0070669_100475565 3300005353 Bacteria 1033
16 Ga0070669_100618080 3300005353 Unclassified 909
17 Ga0070671_100619225 3300005355 Bacteria 936
18 Ga0070674_100488152 3300005356 Bacteria 1024
19 Ga0070674_100734559 3300005356 Bacteria 847
20 Ga0070674_102118556 3300005356 Unclassified 513
21 Ga0070659_100290685 3300005366 Bacteria 1361
22 Ga0070709_10099839 3300005434 Bacteria 1932
23 Ga0070714_100262056 3300005435 Bacteria 1601
24 Ga0070714_100749838 3300005435 Bacteria 944
25 Ga0070713_100267055 3300005436 Bacteria 1566
26 Ga0070713_100308031 3300005436 Bacteria 1460
27 Ga0070713_100362198 3300005436 Bacteria 1347
28 Ga0070713_100789380 3300005436 Unclassified 910
29 Ga0070710_10181000 3300005437 Bacteria 1319
30 Ga0070710_10364588 3300005437 Bacteria 960
31 Ga0070710_11320186 3300005437 Unclassified 537
32 Ga0070701_10104214 3300005438 Bacteria 1576
33 Ga0070711_100072924 3300005439 Bacteria 2424
34 Ga0070711_100502586 3300005439 Bacteria 1000
35 Ga0070711_101361109 3300005439 Unclassified 617
36 Ga0070705_100105745 3300005440 Bacteria 1787
37 Ga0070705_100185612 3300005440 Bacteria 1412
38 Ga0070705_101783536 3300005440 Bacteria 522
39 Ga0070700_101921962 3300005441 Unclassified 512
40 Ga0070694_100031988 3300005444 Bacteria 3452
41 Ga0070694_100072024 3300005444 Bacteria 2383
42 Ga0070708_100040031 3300005445 Bacteria 4103
43 Ga0070708_100839441 3300005445 Bacteria 863
44 Ga0070708_101025069 3300005445 Unclassified 774
45 Ga0070708_101948441 3300005445 Unclassified 544
46 Ga0070662_100029582 3300005457 Bacteria 3824
47 Ga0070662_100340836 3300005457 Bacteria 1226
48 Ga0070662_100391404 3300005457 Bacteria 1145
49 Ga0070662_100434249 3300005457 Bacteria 1088
50 Ga0068867_100056250 3300005459 Bacteria 2910
51 Ga0070706_100079895 3300005467 Bacteria 3028
52 Ga0070706_100657407 3300005467 Bacteria 973
53 Ga0070707_100141928 3300005468 Bacteria 2337
54 Ga0070707_100277866 3300005468 Bacteria 1628
55 Ga0070707_100499685 3300005468 Bacteria 1178
56 Ga0070698_100047498 3300005471 Bacteria 4387
57 Ga0070698_100123697 3300005471 Bacteria 2544
58 Ga0070698_100350128 3300005471 Bacteria 1409
59 Ga0070698_100797279 3300005471 Archaea 888
60 Ga0070699_100301446 3300005518 Bacteria 1438
61 Ga0070679_100986638 3300005530 Bacteria 786
62 Ga0070684_100535592 3300005535 Bacteria 1086
63 Ga0070684_101208249 3300005535 Bacteria 711
64 Ga0070684_101436389 3300005535 Unclassified 650
65 Ga0070697_100280515 3300005536 Bacteria 1429
66 Ga0070697_100295591 3300005536 Bacteria 1392
67 Ga0068853_100761731 3300005539 Bacteria 925
68 Ga0068853_101343299 3300005539 Bacteria 691
69 Ga0068853_101433089 3300005539 Unclassified 668
70 Ga0070672_100439297 3300005543 Bacteria 1123
71 Ga0070686_100188371 3300005544 Bacteria 1471
72 Ga0070686_100273368 3300005544 Bacteria 1243
73 Ga0070695_100312136 3300005545 Bacteria 1166
74 Ga0070696_100233349 3300005546 Bacteria 1385
75 Ga0070696_100489307 3300005546 Bacteria 977
76 Ga0070696_100923474 3300005546 Unclassified 725
77 Ga0070693_100493059 3300005547 Bacteria 868
78 Ga0070665_100528713 3300005548 Bacteria 1191
79 Ga0070704_100331370 3300005549 Bacteria 1279
80 Ga0070704_100780976 3300005549 Unclassified 852
81 Ga0070704_100837799 3300005549 Unclassified 824
82 Ga0068855_100031288 3300005563 Bacteria 6356
83 Ga0068855_100324964 3300005563 Bacteria 1699
84 Ga0068855_102031047 3300005563 Unclassified 580
85 Ga0070664_101207240 3300005564 Bacteria 713
86 Ga0068854_100318616 3300005578 Bacteria 1263
87 Ga0068854_100773312 3300005578 Bacteria 835
88 Ga0068856_100098684 3300005614 Bacteria 2911
89 Ga0068856_100184128 3300005614 Bacteria 2102
90 Ga0068856_100470338 3300005614 Bacteria 1278
91 Ga0070702_100066844 3300005615 Bacteria 2110
92 Ga0070702_100095731 3300005615 Bacteria 1810
93 Ga0068852_100102997 3300005616 Bacteria 2581
94 Ga0068864_100202772 3300005618 Bacteria 1823
95 Ga0068866_10199020 3300005718 Bacteria 1196
96 Ga0068861_100004039 3300005719 Bacteria 9829
97 Ga0068861_100198466 3300005719 Bacteria 1682
98 Ga0068861_100815399 3300005719 Bacteria 877
99 Ga0068860_100088151 3300005843 Bacteria 2954
100 Ga0068860_100730841 3300005843 Bacteria 1001
101 Ga0068862_100253173 3300005844 Bacteria 1606
102 Ga0068862_100419942 3300005844 Bacteria 1255
103 Ga0068862_100933946 3300005844 Bacteria 855
104 Ga0068862_102343607 3300005844 Unclassified 545
105 Ga0081455_10004516 3300005937 Bacteria 15543
106 Ga0081455_10470419 3300005937 Bacteria 853
107 Ga0081539_10001235 3300005985 Bacteria 45514
108 Ga0081539_10048725 3300005985 Bacteria 2408
109 Ga0081539_10048960 3300005985 Bacteria 2401
110 Ga0081539_10330961 3300005985 Bacteria 645
111 Ga0070717_10125472 3300006028 Bacteria 2203
112 Ga0070717_10568447 3300006028 Unclassified 1027
113 Ga0075363_100694341 3300006048 Unclassified 614
114 Ga0070715_10078755 3300006163 Bacteria 1491
115 Ga0070716_100081062 3300006173 Bacteria 1936
116 Ga0070716_100258811 3300006173 Bacteria 1190
117 Ga0070712_100070501 3300006175 Bacteria 2498
118 Ga0070712_100087221 3300006175 Bacteria 2276
119 Ga0070712_100189482 3300006175 Bacteria 1608
120 Ga0070712_100767712 3300006175 Bacteria 826
121 Ga0075428_100163890 3300006844 Bacteria 2412
122 Ga0075428_100253581 3300006844 Bacteria 1895
123 Ga0075428_101080356 3300006844 Unclassified 848
124 Ga0075428_101274422 3300006844 Unclassified 773
125 Ga0075428_101898179 3300006844 Unclassified 619
126 Ga0075431_100028187 3300006847 Bacteria 5767
127 Ga0075431_100053825 3300006847 Bacteria 4149
128 Ga0075431_100059902 3300006847 Bacteria 3929
129 Ga0075433_10010377 3300006852 Bacteria 7472
130 Ga0075433_10124009 3300006852 Bacteria 2295
131 Ga0075434_100106882 3300006871 Bacteria 2808
132 Ga0075434_100484018 3300006871 Bacteria 1258
133 Ga0075434_101096186 3300006871 Bacteria 809
134 Ga0075434_101120041 3300006871 Unclassified 800
135 Ga0068865_101541701 3300006881 Bacteria 596
136 Ga0068865_102136349 3300006881 Bacteria 509
137 Ga0075436_100012875 3300006914 Bacteria 5735
138 Ga0075436_100061707 3300006914 Bacteria 2590
139 Ga0075435_100017957 3300007076 Bacteria 5364
140 Ga0075435_100141528 3300007076 Bacteria 2018
141 Ga0075435_100496821 3300007076 Unclassified 1055
142 Ga0105250_10502210 3300009092 Unclassified 550
143 Ga0111539_10008073 3300009094 Bacteria 13415
144 Ga0111539_11223601 3300009094 Bacteria 872
145 Ga0105245_10043596 3300009098 Bacteria 4002
146 Ga0105245_10349448 3300009098 Bacteria 1465
147 Ga0105245_10584876 3300009098 Bacteria 1141
148 Ga0105245_11246531 3300009098 Bacteria 792
149 Ga0105247_11103991 3300009101 Bacteria 626
150 Ga0114129_10001608 3300009147 Bacteria 30685
151 Ga0114129_10124133 3300009147 Bacteria 3551
152 Ga0114129_10523574 3300009147 Bacteria 1545
153 Ga0114129_10592517 3300009147 Bacteria 1437
154 Ga0105243_10080233 3300009148 Bacteria 2661
155 Ga0105243_10086973 3300009148 Bacteria 2565
156 Ga0105243_10174208 3300009148 Bacteria 1866
157 Ga0105243_11848969 3300009148 Bacteria 636
158 Ga0105242_10629726 3300009176 Bacteria 1040
159 Ga0105242_10843623 3300009176 Bacteria 911
160 Ga0105242_11296742 3300009176 Unclassified 752
161 Ga0105248_10519187 3300009177 Bacteria 1343
162 Ga0105237_10139128 3300009545 Bacteria 2422
163 Ga0105237_12460930 3300009545 Unclassified 531
164 Ga0105249_10051752 3300009553 Bacteria 3747
165 Ga0105249_10129354 3300009553 Bacteria 2409
166 Ga0105249_10648443 3300009553 Bacteria 1113
167 Ga0105239_10121207 3300010375 Bacteria 2904
168 Ga0105239_10179212 3300010375 Bacteria 2370
169 Ga0105239_10676321 3300010375 Bacteria 1180
170 Ga0105239_11878637 3300010375 Bacteria 694
171 Ga0157326_1079492 3300012513 Unclassified 534
172 Ga0157338_1002953 3300012515 Bacteria 1375
173 Ga0157371_10099704 3300013102 Bacteria 2060
174 Ga0157374_10587372 3300013296 Bacteria 1123
175 Ga0157374_10652483 3300013296 Bacteria 1064
176 Ga0157378_10393032 3300013297 Bacteria 1364
177 Ga0163162_10101335 3300013306 Bacteria 2971
178 Ga0163162_10161489 3300013306 Bacteria 2362
179 Ga0163162_10356356 3300013306 Bacteria 1596
180 Ga0163162_11354006 3300013306 Bacteria 809
181 Ga0157372_10727610 3300013307 Bacteria 1154
182 Ga0157372_11196261 3300013307 Bacteria 878
183 Ga0157375_10076679 3300013308 Bacteria 3371
184 Ga0163163_10015356 3300014325 Bacteria 7077
185 Ga0163163_12153393 3300014325 Unclassified 617
186 Ga0157380_10191824 3300014326 Bacteria 1805
187 Ga0157377_10144195 3300014745 Bacteria 1466
188 Ga0182007_10186279 3300015262 Bacteria 720
189 Ga0163161_10223315 3300017792 Bacteria 1459
190 Ga0163161_10945840 3300017792 Bacteria 733
191 Ga0207692_10034145 3300025898 Bacteria 2461
192 Ga0207642_10171127 3300025899 Bacteria 1175
193 Ga0207710_10416207 3300025900 Bacteria 691
194 Ga0207688_10018964 3300025901 Bacteria 3743
195 Ga0207647_10264728 3300025904 Bacteria 984
196 Ga0207685_10392720 3300025905 Unclassified 709
197 Ga0207699_10221898 3300025906 Bacteria 1290
198 Ga0207699_10866954 3300025906 Unclassified 665
199 Ga0207645_10069637 3300025907 Bacteria 2250
200 Ga0207693_10000839 3300025915 Bacteria 27394
201 Ga0207693_10003376 3300025915 Bacteria 13637
202 Ga0207693_10091042 3300025915 Bacteria 2391
203 Ga0207693_10118379 3300025915 Bacteria 2080
204 Ga0207693_11232036 3300025915 Unclassified 563
205 Ga0207663_10040322 3300025916 Bacteria 2837
206 Ga0207663_10432876 3300025916 Bacteria 1012
207 Ga0207657_10663683 3300025919 Bacteria 811
208 Ga0207646_10314850 3300025922 Bacteria 1414
209 Ga0207646_10372535 3300025922 Bacteria 1290
210 Ga0207646_10413132 3300025922 Bacteria 1218
211 Ga0207681_10165252 3300025923 Bacteria 1673
212 Ga0207681_10817718 3300025923 Bacteria 779
213 Ga0207687_10094589 3300025927 Bacteria 2187
214 Ga0207687_10296662 3300025927 Bacteria 1301
215 Ga0207687_11213490 3300025927 Bacteria 648
216 Ga0207700_10668121 3300025928 Unclassified 927
217 Ga0207700_10761281 3300025928 Bacteria 865
218 Ga0207700_11301352 3300025928 Bacteria 648
219 Ga0207700_11358874 3300025928 Unclassified 632
220 Ga0207690_10815528 3300025932 Bacteria 771
221 Ga0207690_11668840 3300025932 Bacteria 532
222 Ga0207706_10006063 3300025933 Bacteria 11238
223 Ga0207706_10006904 3300025933 Bacteria 10500
224 Ga0207706_10220550 3300025933 Bacteria 1660
225 Ga0207706_10233496 3300025933 Bacteria 1609
226 Ga0207686_10103436 3300025934 Bacteria 1906
227 Ga0207686_10375113 3300025934 Bacteria 1077
228 Ga0207686_10911326 3300025934 Unclassified 710
229 Ga0207709_10124334 3300025935 Bacteria 1747
230 Ga0207709_10322425 3300025935 Bacteria 1157
231 Ga0207709_11157564 3300025935 Bacteria 636
232 Ga0207670_11349216 3300025936 Bacteria 605
233 Ga0207669_10710925 3300025937 Bacteria 827
234 Ga0207704_10082803 3300025938 Bacteria 2080
235 Ga0207704_11921963 3300025938 Bacteria 509
236 Ga0207665_10136327 3300025939 Bacteria 1747
237 Ga0207665_10172339 3300025939 Bacteria 1563
238 Ga0207665_10718044 3300025939 Bacteria 786
239 Ga0207665_11108934 3300025939 Unclassified 631
240 Ga0207691_10162680 3300025940 Bacteria 1957
241 Ga0207691_10921016 3300025940 Unclassified 731
242 Ga0207689_10171151 3300025942 Bacteria 1790
243 Ga0207661_10172965 3300025944 Bacteria 1881
244 Ga0207679_10978303 3300025945 Bacteria 775
245 Ga0207667_10339644 3300025949 Bacteria 1533
246 Ga0207712_10096423 3300025961 Bacteria 2189
247 Ga0207712_10167527 3300025961 Bacteria 1714
248 Ga0207668_10068696 3300025972 Bacteria 2520
249 Ga0207668_10167595 3300025972 Bacteria 1719
250 Ga0207640_10437315 3300025981 Unclassified 1075
251 Ga0207658_11936058 3300025986 Bacteria 537
252 Ga0207708_10004854 3300026075 Bacteria 9910
253 Ga0207708_11468393 3300026075 Unclassified 599
254 Ga0207702_10008637 3300026078 Bacteria 8593
255 Ga0207702_10546141 3300026078 Bacteria 1133
256 Ga0207648_10012202 3300026089 Bacteria 8049
257 Ga0207648_10835528 3300026089 Bacteria 859
258 Ga0207675_100000792 3300026118 Bacteria 31451
259 Ga0207675_100011659 3300026118 Bacteria 8220
260 Ga0207675_100044860 3300026118 Bacteria 4131
261 Ga0207675_100258251 3300026118 Bacteria 1688
262 Ga0207683_11376648 3300026121 Bacteria 652
263 Ga0207698_10876035 3300026142 Bacteria 904
264 Ga0207698_11768013 3300026142 Bacteria 633
265 Ga0207428_10015418 3300027907 Bacteria 6612
266 Ga0268265_10337515 3300028380 Bacteria 1371
267 Ga0268265_10802072 3300028380 Bacteria 918
268 Ga0268264_10324801 3300028381 Bacteria 1456
269 Ga0268264_10373028 3300028381 Bacteria 1364
270 Ga0265334_10005216 3300028573 Bacteria 5694
271 Ga0265320_10002368 3300031240 Bacteria 13186
272 Ga0265327_10012837 3300031251 Bacteria 5615
273 Ga0373938_0110498 3300034957 Unclassified 699
274 Ga0373939_0248458 3300035114 Unclassified 691
275 Ga0373945_0047972 3300035116 Bacteria 1563
276 Ga0373960_0272360 3300035121 Unclassified 621
277 Ga0373943_0073916 3300035170 Bacteria 1732
278 Ga0373946_0429285 3300035171 Bacteria 670
279 Ga0373931_0480857 3300035691 Unclassified 798
280 Ga0373935_0307514 3300035692 Bacteria 1122
281 Ga0373927_0334708 3300035695 Bacteria 997
282 Ga0373927_0445297 3300035695 Bacteria 855
283 Ga0373947_0000533 3300035725 Bacteria 22256
284 Ga0373937_0114916 3300036401 Bacteria 2506
285 Ga0373925_0016219 3300037068 Bacteria 5393
286 Ga0395899_0005218 3300037312 Bacteria 10103
287 Ga0395899_0038494 3300037312 Bacteria 3582
288 Ga0395899_0068123 3300037312 Bacteria 2610
289 Ga0395899_0075368 3300037312 Bacteria 2463
290 Ga0395899_0087948 3300037312 Bacteria 2254
291 Ga0395899_0168945 3300037312 Bacteria 1541
292 Ga0395900_0002296 3300037418 Bacteria 21235
293 Ga0395900_0008249 3300037418 Bacteria 10725
294 Ga0395900_0019474 3300037418 Bacteria 6919
295 Ga0395900_0044212 3300037418 Bacteria 4590
296 Ga0395900_0390111 3300037418 Bacteria 1359
297 Ga0395900_0461912 3300037418 Unclassified 1224
298 Ga0395900_0531697 3300037418 Bacteria 1122
299 Ga0395900_0542877 3300037418 Bacteria 1108
300 Ga0395900_0650583 3300037418 Bacteria 991
301 Ga0395898_0007164 3300037466 Bacteria 11841
302 Ga0395898_0011336 3300037466 Bacteria 9266
303 Ga0395898_0015057 3300037466 Bacteria 7939
304 Ga0395898_0015913 3300037466 Bacteria 7708
305 Ga0395898_0021297 3300037466 Bacteria 6576
306 Ga0395898_0266064 3300037466 Bacteria 1635
307 Ga0395898_0290898 3300037466 Unclassified 1558
308 Ga0395898_0305749 3300037466 Bacteria 1517
309 Ga0395898_0736917 3300037466 Bacteria 927
310 Ga0395898_0836695 3300037466 Bacteria 860
311 Ga0395898_0921829 3300037466 Bacteria 811
312 Ga0395898_1394244 3300037466 Unclassified 628
313 Ga0395898_1591084 3300037466 Unclassified 578
314 Ga0395905_0002467 3300037471 Bacteria 20483
315 Ga0395905_0004713 3300037471 Bacteria 14091
316 Ga0395905_0013666 3300037471 Bacteria 7776
317 Ga0395905_0026106 3300037471 Bacteria 5508
318 Ga0395905_0097092 3300037471 Bacteria 2766
319 Ga0395905_0116409 3300037471 Bacteria 2512
320 Ga0395905_0121542 3300037471 Bacteria 2455
321 Ga0395905_0169192 3300037471 Bacteria 2052
322 Ga0395905_0185283 3300037471 Bacteria 1954
323 Ga0395905_0626056 3300037471 Bacteria 978
324 Ga0395905_1297386 3300037471 Bacteria 632
325 Ga0395901_0015363 3300038443 Bacteria 7791
326 Ga0395901_0019175 3300038443 Bacteria 6993
327 Ga0395901_0027120 3300038443 Bacteria 5883
328 Ga0395901_0033742 3300038443 Bacteria 5284
329 Ga0395901_0110648 3300038443 Bacteria 2884
330 Ga0395901_0130980 3300038443 Bacteria 2635
331 Ga0395901_0143299 3300038443 Bacteria 2511
332 Ga0395901_0148854 3300038443 Bacteria 2460
333 Ga0395901_0208760 3300038443 Bacteria 2045
334 Ga0395901_0210702 3300038443 Bacteria 2034
335 Ga0395901_0499834 3300038443 Unclassified 1238
336 Ga0242420_016181 3300038996 Bacteria 1296
337 Ga0451807_0617840 3300041486 Unclassified 912
338 Ga0451839_1547050 3300041496 Unclassified 544
339 Ga0451853_1200671 3300041512 Archaea 587
340 Ga0451853_1289944 3300041512 Bacteria 954
341 Ga0439458_0007315 3300042157 Bacteria 2458
342 Ga0466972_0481961 3300044658 Unclassified 583
343 Ga0466968_0520478 3300044735 Unclassified 594
344 Ga0466960_0104424 3300044901 Bacteria 1464
345 Ga0495603_0002556 3300046455 Bacteria 10726
346 Ga0495641_0001137 3300046461 Bacteria 22903
347 Ga0495580_0068877 3300046472 Bacteria 2473
348 Ga0495582_0005425 3300046473 Bacteria 7117
349 Ga0495605_0160568 3300046474 Bacteria 998
350 Ga0495584_0222609 3300046491 Bacteria 959
351 Ga0495594_0110860 3300046499 Bacteria 1547
352 Ga0495607_0218027 3300046501 Unclassified 935
353 Ga0495607_0279271 3300046501 Unclassified 793
354 Ga0495630_0018403 3300046517 Bacteria 5133
355 Ga0495631_0035376 3300046518 Bacteria 2235
356 Ga0495644_0082480 3300046523 Bacteria 1212
357 Ga0495663_0208651 3300046525 Unclassified 684
358 Ga0495666_0036989 3300046526 Bacteria 2376
359 Ga0495642_0025878 3300046528 Bacteria 2328
360 Ga0495642_0062958 3300046528 Bacteria 1541
361 Ga0495665_0102093 3300046531 Bacteria 1505
362 Ga0495587_0212172 3300046536 Bacteria 1093
363 Ga0495609_0233176 3300046538 Unclassified 762
364 Ga0495609_0282211 3300046538 Unclassified 679
365 Ga0495622_0064568 3300046557 Bacteria 1693
366 Ga0495656_0174971 3300046615 Bacteria 1052
367 Ga0495668_0026827 3300046616 Bacteria 3267
368 Ga0495659_0003050 3300046664 Bacteria 5374
369 Ga0495588_0000498 3300046674 Bacteria 19236
370 Ga0495647_0114535 3300046681 Bacteria 1128
371 Ga0495670_0016751 3300046691 Bacteria 3604
372 Ga0495670_0497280 3300046691 Unclassified 662
373 Ga0495671_0224166 3300046692 Unclassified 910
374 Ga0495589_0212742 3300046794 Bacteria 910
375 Ga0495581_0121520 3300047315 Bacteria 1520
376 Ga0495636_0024954 3300047318 Bacteria 2426
377 Ga0495676_0014026 3300047321 Bacteria 7176
378 Ga0495680_0554498 3300047322 Bacteria 774
379 Ga0496100_0225733 3300048903 Bacteria 1376
380 Ga0496100_0241387 3300048903 Bacteria 1333
381 Ga0496100_0569707 3300048903 Bacteria 877
382 Ga0496101_0009209 3300048904 Bacteria 6483
383 Ga0496101_0176413 3300048904 Bacteria 1644
384 Ga0496101_0208557 3300048904 Bacteria 1513
385 Ga0496101_0268419 3300048904 Unclassified 1332
386 Ga0496101_0459868 3300048904 Bacteria 1004
387 Ga0496101_0721058 3300048904 Unclassified 787
388 Ga0496101_0890553 3300048904 Bacteria 701
389 Ga0496102_0021141 3300048905 Bacteria 5753
390 Ga0496102_0285011 3300048905 Bacteria 1557
391 Ga0496102_0287508 3300048905 Unclassified 1549
392 Ga0496103_0008175 3300048906 Bacteria 6210
393 Ga0496103_0059692 3300048906 Bacteria 2370
394 Ga0496104_0002164 3300048907 Bacteria 17056
395 Ga0496104_0778002 3300048907 Bacteria 864
396 Ga0496105_0000804 3300048908 Bacteria 21255
397 Ga0496105_0426479 3300048908 Bacteria 1049
398 Ga0496105_1368756 3300048908 Unclassified 514
399 Ga0496106_0220164 3300048909 Bacteria 1514
400 Ga0496106_0362558 3300048909 Bacteria 1164
401 Ga0496107_0055726 3300048910 Bacteria 2855
402 Ga0496107_0205804 3300048910 Bacteria 1463
403 Ga0496107_0443888 3300048910 Bacteria 964
404 Ga0496108_0006353 3300048911 Bacteria 9580
405 Ga0496108_0573496 3300048911 Bacteria 984
406 Ga0496109_0029682 3300048912 Bacteria 4899
407 Ga0496109_0035207 3300048912 Bacteria 4514
408 Ga0496109_0103587 3300048912 Bacteria 2641
409 Ga0496109_0181387 3300048912 Unclassified 1977
410 Ga0496109_0914779 3300048912 Bacteria 815
411 Ga0496110_0002550 3300048913 Bacteria 13690
412 Ga0496110_0017886 3300048913 Bacteria 5934
413 Ga0496110_0069446 3300048913 Bacteria 3120
414 Ga0496110_0296831 3300048913 Bacteria 1472
415 Ga0496110_0318284 3300048913 Unclassified 1417
416 Ga0496110_0379886 3300048913 Bacteria 1287
417 Ga0496110_1321086 3300048913 Bacteria 630
418 Ga0496111_0004127 3300048914 Bacteria 9123
419 Ga0496111_0028269 3300048914 Bacteria 3973
420 Ga0496111_0031712 3300048914 Bacteria 3765
421 Ga0496111_0179015 3300048914 Bacteria 1576
422 Ga0496111_0184436 3300048914 Bacteria 1551
423 Ga0496112_0002614 3300048915 Bacteria 14537
424 Ga0496112_0113035 3300048915 Bacteria 2686
425 Ga0496112_0206921 3300048915 Bacteria 1920
426 Ga0496112_0264567 3300048915 Bacteria 1669
427 Ga0496112_0781623 3300048915 Unclassified 880
428 Ga0496113_0003371 3300048916 Bacteria 9549
429 Ga0496113_0060118 3300048916 Bacteria 2864
430 Ga0496113_0149013 3300048916 Bacteria 1845
431 Ga0496113_0796141 3300048916 Unclassified 751
432 Ga0496114_0052361 3300048917 Bacteria 3401
433 Ga0496114_0394454 3300048917 Unclassified 1226
434 Ga0496115_0036580 3300048918 Bacteria 3888
435 Ga0496115_0137915 3300048918 Bacteria 2012
436 Ga0496115_0231650 3300048918 Bacteria 1523
437 Ga0496115_0329064 3300048918 Bacteria 1249
438 Ga0501067_0042299 3300049583 Bacteria 2529
439 Ga0501069_0067986 3300049585 Bacteria 1993
440 Ga0501081_0814167 3300049743 Unclassified 703
441 nmdc:mga05p37_1151684_c1 3300050507 Bacteria 807
442 nmdc:mga05p37_12863_c1 3300050507 Bacteria 10008
443 nmdc:mga05p37_25358_c1 3300050507 Bacteria 6483
444 nmdc:mga05p37_487831_c1 3300050507 Bacteria 1417
445 nmdc:mga06r32_26375_c1 3300050510 Bacteria 5416
446 nmdc:mga06r32_88424_c1 3300050510 Bacteria 3024
447 nmdc:mga08y16_29542_c1 3300050511 Bacteria 5774
448 nmdc:mga08y16_940113_c1 3300050511 Bacteria 848
449 nmdc:mga0n895_1022760_c1 3300050512 Bacteria 807
450 nmdc:mga0n895_1059976_c1 3300050512 Unclassified 789
451 nmdc:mga0n895_16863_c1 3300050512 Bacteria 6716
452 nmdc:mga0n895_52949_c1 3300050512 Bacteria 3986
453 nmdc:mga0rr50_1467867_c1 3300050513 Bacteria 577
454 nmdc:mga0rr50_290769_c1 3300050513 Unclassified 1365
455 nmdc:mga0rr50_42490_c1 3300050513 Bacteria 3320
456 nmdc:mga0rr50_456897_c1 3300050513 Bacteria 1083
457 nmdc:mga0rr50_8383_c1 3300050513 Bacteria 6432
458 nmdc:mga08x19_121050_c1 3300050514 Bacteria 1755
459 nmdc:mga08x19_85768_c1 3300050514 Bacteria 2073
460 nmdc:mga08x19_8660_c1 3300050514 Bacteria 6066
461 nmdc:mga0a205_1187976_c1 3300050515 Unclassified 611
462 nmdc:mga0a205_71790_c1 3300050515 Bacteria 3344
463 Ga0495655_0160154 3300053083 Unclassified 714
464 Ga0530510_0024768 3300061734 Bacteria 4287
465 Ga0207684_10113630
466 JGI25406J46586_10070831
467 JGI25406J46586_10082490
468 Ga0070683_100972955
469 Ga0070683_100974403
470 Ga0070666_10440577
471 Ga0068868_100061581
472 Ga0068868_100198971
473 Ga0070689_100093393
474 Ga0070691_10107497
475 Ga0070691_10353599
476 Ga0070692_10800197
477 Ga0070668_100168894
478 Ga0070669_100460919
479 Ga0070669_100475565
480 Ga0070669_100618080
481 Ga0070671_100619225
482 Ga0070674_100488152
483 Ga0070674_100734559
484 Ga0070674_102118556
485 Ga0070659_100290685
486 Ga0070709_10099839
487 Ga0070714_100262056
488 Ga0070714_100749838
489 Ga0070713_100267055
490 Ga0070713_100308031
491 Ga0070713_100362198
492 Ga0070713_100789380
493 Ga0070710_10181000
494 Ga0070710_10364588
495 Ga0070710_11320186
496 Ga0070701_10104214
497 Ga0070711_100072924
498 Ga0070711_100502586
499 Ga0070711_101361109
500 Ga0070705_100105745
501 Ga0070705_100185612
502 Ga0070705_101783536
503 Ga0070700_101921962
504 Ga0070694_100031988
505 Ga0070694_100072024
506 Ga0070708_100040031
507 Ga0070708_100839441
508 Ga0070708_101025069
509 Ga0070708_101948441
510 Ga0070662_100029582
511 Ga0070662_100340836
512 Ga0070662_100391404
513 Ga0070662_100434249
514 Ga0068867_100056250
515 Ga0070706_100079895
516 Ga0070706_100657407
517 Ga0070707_100141928
518 Ga0070707_100277866
519 Ga0070707_100499685
520 Ga0070698_100047498
521 Ga0070698_100123697
522 Ga0070698_100350128
523 Ga0070698_100797279
524 Ga0070699_100301446
525 Ga0070679_100986638
526 Ga0070684_100535592
527 Ga0070684_101208249
528 Ga0070684_101436389
529 Ga0070697_100280515
530 Ga0070697_100295591
531 Ga0068853_100761731
532 Ga0068853_101343299
533 Ga0068853_101433089
534 Ga0070672_100439297
535 Ga0070686_100188371
536 Ga0070686_100273368
537 Ga0070695_100312136
538 Ga0070696_100233349
539 Ga0070696_100489307
540 Ga0070696_100923474
541 Ga0070693_100493059
542 Ga0070665_100528713
543 Ga0070704_100331370
544 Ga0070704_100780976
545 Ga0070704_100837799
546 Ga0068855_100031288
547 Ga0068855_100324964
548 Ga0068855_102031047
549 Ga0070664_101207240
550 Ga0068854_100318616
551 Ga0068854_100773312
552 Ga0068856_100098684
553 Ga0068856_100184128
554 Ga0068856_100470338
555 Ga0070702_100066844
556 Ga0070702_100095731
557 Ga0068852_100102997
558 Ga0068864_100202772
559 Ga0068866_10199020
560 Ga0068861_100004039
561 Ga0068861_100198466
562 Ga0068861_100815399
563 Ga0068860_100088151
564 Ga0068860_100730841
565 Ga0068862_100253173
566 Ga0068862_100419942
567 Ga0068862_100933946
568 Ga0068862_102343607
569 Ga0081455_10004516
570 Ga0081455_10470419
571 Ga0081539_10001235
572 Ga0081539_10048725
573 Ga0081539_10048960
574 Ga0081539_10330961
575 Ga0070717_10125472
576 Ga0070717_10568447
577 Ga0075363_100694341
578 Ga0070715_10078755
579 Ga0070716_100081062
580 Ga0070716_100258811
581 Ga0070712_100070501
582 Ga0070712_100087221
583 Ga0070712_100189482
584 Ga0070712_100767712
585 Ga0075428_100163890
586 Ga0075428_100253581
587 Ga0075428_101080356
588 Ga0075428_101274422
589 Ga0075428_101898179
590 Ga0075431_100028187
591 Ga0075431_100053825
592 Ga0075431_100059902
593 Ga0075433_10010377
594 Ga0075433_10124009
595 Ga0075434_100106882
596 Ga0075434_100484018
597 Ga0075434_101096186
598 Ga0075434_101120041
599 Ga0068865_101541701
600 Ga0068865_102136349
601 Ga0075436_100012875
602 Ga0075436_100061707
603 Ga0075435_100017957
604 Ga0075435_100141528
605 Ga0075435_100496821
606 Ga0105250_10502210
607 Ga0111539_10008073
608 Ga0111539_11223601
609 Ga0105245_10043596
610 Ga0105245_10349448
611 Ga0105245_10584876
612 Ga0105245_11246531
613 Ga0105247_11103991
614 Ga0114129_10001608
615 Ga0114129_10124133
616 Ga0114129_10523574
617 Ga0114129_10592517
618 Ga0105243_10080233
619 Ga0105243_10086973
620 Ga0105243_10174208
621 Ga0105243_11848969
622 Ga0105242_10629726
623 Ga0105242_10843623
624 Ga0105242_11296742
625 Ga0105248_10519187
626 Ga0105237_10139128
627 Ga0105237_12460930
628 Ga0105249_10051752
629 Ga0105249_10129354
630 Ga0105249_10648443
631 Ga0105239_10121207
632 Ga0105239_10179212
633 Ga0105239_10676321
634 Ga0105239_11878637
635 Ga0157326_1079492
636 Ga0157338_1002953
637 Ga0157371_10099704
638 Ga0157374_10587372
639 Ga0157374_10652483
640 Ga0157378_10393032
641 Ga0163162_10101335
642 Ga0163162_10161489
643 Ga0163162_10356356
644 Ga0163162_11354006
645 Ga0157372_10727610
646 Ga0157372_11196261
647 Ga0157375_10076679
648 Ga0163163_10015356
649 Ga0163163_12153393
650 Ga0157380_10191824
651 Ga0157377_10144195
652 Ga0182007_10186279
653 Ga0163161_10223315
654 Ga0163161_10945840
655 Ga0207692_10034145
656 Ga0207642_10171127
657 Ga0207710_10416207
658 Ga0207688_10018964
659 Ga0207647_10264728
660 Ga0207685_10392720
661 Ga0207699_10221898
662 Ga0207699_10866954
663 Ga0207645_10069637
664 Ga0207693_10000839
665 Ga0207693_10003376
666 Ga0207693_10091042
667 Ga0207693_10118379
668 Ga0207693_11232036
669 Ga0207663_10040322
670 Ga0207663_10432876
671 Ga0207657_10663683
672 Ga0207646_10314850
673 Ga0207646_10372535
674 Ga0207646_10413132
675 Ga0207681_10165252
676 Ga0207681_10817718
677 Ga0207687_10094589
678 Ga0207687_10296662
679 Ga0207687_11213490
680 Ga0207700_10668121
681 Ga0207700_10761281
682 Ga0207700_11301352
683 Ga0207700_11358874
684 Ga0207690_10815528
685 Ga0207690_11668840
686 Ga0207706_10006063
687 Ga0207706_10006904
688 Ga0207706_10220550
689 Ga0207706_10233496
690 Ga0207686_10103436
691 Ga0207686_10375113
692 Ga0207686_10911326
693 Ga0207709_10124334
694 Ga0207709_10322425
695 Ga0207709_11157564
696 Ga0207670_11349216
697 Ga0207669_10710925
698 Ga0207704_10082803
699 Ga0207704_11921963
700 Ga0207665_10136327
701 Ga0207665_10172339
702 Ga0207665_10718044
703 Ga0207665_11108934
704 Ga0207691_10162680
705 Ga0207691_10921016
706 Ga0207689_10171151
707 Ga0207661_10172965
708 Ga0207679_10978303
709 Ga0207667_10339644
710 Ga0207712_10096423
711 Ga0207712_10167527
712 Ga0207668_10068696
713 Ga0207668_10167595
714 Ga0207640_10437315
715 Ga0207658_11936058
716 Ga0207708_10004854
717 Ga0207708_11468393
718 Ga0207702_10008637
719 Ga0207702_10546141
720 Ga0207648_10012202
721 Ga0207648_10835528
722 Ga0207675_100000792
723 Ga0207675_100011659
724 Ga0207675_100044860
725 Ga0207675_100258251
726 Ga0207683_11376648
727 Ga0207698_10876035
728 Ga0207698_11768013
729 Ga0207428_10015418
730 Ga0268265_10337515
731 Ga0268265_10802072
732 Ga0268264_10324801
733 Ga0268264_10373028
734 Ga0265334_10005216
735 Ga0265320_10002368
736 Ga0265327_10012837
737 Ga0373938_0110498
738 Ga0373939_0248458
739 Ga0373945_0047972
740 Ga0373960_0272360
741 Ga0373943_0073916
742 Ga0373946_0429285
743 Ga0373931_0480857
744 Ga0373935_0307514
745 Ga0373927_0334708
746 Ga0373927_0445297
747 Ga0373947_0000533
748 Ga0373937_0114916
749 Ga0373925_0016219
750 Ga0395899_0005218
751 Ga0395899_0038494
752 Ga0395899_0068123
753 Ga0395899_0075368
754 Ga0395899_0087948
755 Ga0395899_0168945
756 Ga0395900_0002296
757 Ga0395900_0008249
758 Ga0395900_0019474
759 Ga0395900_0044212
760 Ga0395900_0390111
761 Ga0395900_0461912
762 Ga0395900_0531697
763 Ga0395900_0542877
764 Ga0395900_0650583
765 Ga0395898_0007164
766 Ga0395898_0011336
767 Ga0395898_0015057
768 Ga0395898_0015913
769 Ga0395898_0021297
770 Ga0395898_0266064
771 Ga0395898_0290898
772 Ga0395898_0305749
773 Ga0395898_0736917
774 Ga0395898_0836695
775 Ga0395898_0921829
776 Ga0395898_1394244
777 Ga0395898_1591084
778 Ga0395905_0002467
779 Ga0395905_0004713
780 Ga0395905_0013666
781 Ga0395905_0026106
782 Ga0395905_0097092
783 Ga0395905_0116409
784 Ga0395905_0121542
785 Ga0395905_0169192
786 Ga0395905_0185283
787 Ga0395905_0626056
788 Ga0395905_1297386
789 Ga0395901_0015363
790 Ga0395901_0019175
791 Ga0395901_0027120
792 Ga0395901_0033742
793 Ga0395901_0110648
794 Ga0395901_0130980
795 Ga0395901_0143299
796 Ga0395901_0148854
797 Ga0395901_0208760
798 Ga0395901_0210702
799 Ga0395901_0499834
800 Ga0242420_016181
801 Ga0451807_0617840
802 Ga0451839_1547050
803 Ga0451853_1200671
804 Ga0451853_1289944
805 Ga0439458_0007315
806 Ga0466972_0481961
807 Ga0466968_0520478
808 Ga0466960_0104424
809 Ga0495603_0002556
810 Ga0495641_0001137
811 Ga0495580_0068877
812 Ga0495582_0005425
813 Ga0495605_0160568
814 Ga0495584_0222609
815 Ga0495594_0110860
816 Ga0495607_0218027
817 Ga0495607_0279271
818 Ga0495630_0018403
819 Ga0495631_0035376
820 Ga0495644_0082480
821 Ga0495663_0208651
822 Ga0495666_0036989
823 Ga0495642_0025878
824 Ga0495642_0062958
825 Ga0495665_0102093
826 Ga0495587_0212172
827 Ga0495609_0233176
828 Ga0495609_0282211
829 Ga0495622_0064568
830 Ga0495656_0174971
831 Ga0495668_0026827
832 Ga0495659_0003050
833 Ga0495588_0000498
834 Ga0495647_0114535
835 Ga0495670_0016751
836 Ga0495670_0497280
837 Ga0495671_0224166
838 Ga0495589_0212742
839 Ga0495581_0121520
840 Ga0495636_0024954
841 Ga0495676_0014026
842 Ga0495680_0554498
843 Ga0496100_0225733
844 Ga0496100_0241387
845 Ga0496100_0569707
846 Ga0496101_0009209
847 Ga0496101_0176413
848 Ga0496101_0208557
849 Ga0496101_0268419
850 Ga0496101_0459868
851 Ga0496101_0721058
852 Ga0496101_0890553
853 Ga0496102_0021141
854 Ga0496102_0285011
855 Ga0496102_0287508
856 Ga0496103_0008175
857 Ga0496103_0059692
858 Ga0496104_0002164
859 Ga0496104_0778002
860 Ga0496105_0000804
861 Ga0496105_0426479
862 Ga0496105_1368756
863 Ga0496106_0220164
864 Ga0496106_0362558
865 Ga0496107_0055726
866 Ga0496107_0205804
867 Ga0496107_0443888
868 Ga0496108_0006353
869 Ga0496108_0573496
870 Ga0496109_0029682
871 Ga0496109_0035207
872 Ga0496109_0103587
873 Ga0496109_0181387
874 Ga0496109_0914779
875 Ga0496110_0002550
876 Ga0496110_0017886
877 Ga0496110_0069446
878 Ga0496110_0296831
879 Ga0496110_0318284
880 Ga0496110_0379886
881 Ga0496110_1321086
882 Ga0496111_0004127
883 Ga0496111_0028269
884 Ga0496111_0031712
885 Ga0496111_0179015
886 Ga0496111_0184436
887 Ga0496112_0002614
888 Ga0496112_0113035
889 Ga0496112_0206921
890 Ga0496112_0264567
891 Ga0496112_0781623
892 Ga0496113_0003371
893 Ga0496113_0060118
894 Ga0496113_0149013
895 Ga0496113_0796141
896 Ga0496114_0052361
897 Ga0496114_0394454
898 Ga0496115_0036580
899 Ga0496115_0137915
900 Ga0496115_0231650
901 Ga0496115_0329064
902 Ga0501067_0042299
903 Ga0501069_0067986
904 Ga0501081_0814167
905 nmdc:mga05p37_1151684_c1
906 nmdc:mga05p37_12863_c1
907 nmdc:mga05p37_25358_c1
908 nmdc:mga05p37_487831_c1
909 nmdc:mga06r32_26375_c1
910 nmdc:mga06r32_88424_c1
911 nmdc:mga08y16_29542_c1
912 nmdc:mga08y16_940113_c1
913 nmdc:mga0n895_1022760_c1
914 nmdc:mga0n895_1059976_c1
915 nmdc:mga0n895_16863_c1
916 nmdc:mga0n895_52949_c1
917 nmdc:mga0rr50_1467867_c1
918 nmdc:mga0rr50_290769_c1
919 nmdc:mga0rr50_42490_c1
920 nmdc:mga0rr50_456897_c1
921 nmdc:mga0rr50_8383_c1
922 nmdc:mga08x19_121050_c1
923 nmdc:mga08x19_85768_c1
924 nmdc:mga08x19_8660_c1
925 nmdc:mga0a205_1187976_c1
926 nmdc:mga0a205_71790_c1
927 Ga0495655_0160154
928 Ga0530510_0024768

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

55

125

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e2g-assembly2.cif.gz_C crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus 0.9353 26 111
3bu7-assembly1.cif.gz_B crystal structure and biochemical characterization of gdosp, a gentisate 1,2-dioxygenase from silicibacter pomeroyi 0.9282 39 111
3kgl-assembly1.cif.gz_B crystal structure of procruciferin, 11s globulin from brassica napus 0.9162 22 111
3kgl-assembly1.cif.gz_A crystal structure of procruciferin, 11s globulin from brassica napus 0.9154 22 111
3kgl-assembly2.cif.gz_D crystal structure of procruciferin, 11s globulin from brassica napus 0.9138 22 111
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9664 39 111 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9331 38 111 2.60.120.10
3bu7B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9282 39 111 2.60.120.10
4e2gD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9266 38 111 2.60.120.10
2d40B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9223 41 110 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A847LWR0-F1-model_v4 Mannose-1-phosphate guanylyltransferase 0.9834 39 111 GO:0004475
GO:0005976
GO:0009298
AF-A0A374TU20-F1-model_v4 Cupin domain-containing protein 0.9765 40 111 GO:0004475
GO:0005976
GO:0009298
AF-A0A5B8NMV7-F1-model_v4 Cupin domain-containing protein 0.9713 38 111 GO:0004475
GO:0005976
GO:0009298
AF-A0A5D0MG16-F1-model_v4 mannose-1-phosphate guanylyltransferase (EC 2.7.7.13) 0.9634 39 111 GO:0000271
GO:0004475
GO:0005525
GO:0009298
GO:0016853
AF-A0A383D522-F1-model_v4 Cupin type-2 domain-containing protein 0.9617 38 111

Map