F449291

General Info

Members Datasets Scaffolds Average Seq Length
464 238 928 112

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_11574639|Ga0157378_115746392
Length 132
Sequence MLQPPATSVLHLFYDRDMAYDEDLADRIRELLGDAKGISETKMFGGLAFLVGGNMAIAASGQGGILVRAGAEESDKLVATTKAEVAVMRGRPMTGWLRVDSTDVRTRVQLKKWVTIGETYARSLPPKKKRSR

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
95 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
96 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
97 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
98 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
99 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
116 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
117 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
118 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
119 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
120 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
143 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
166 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 1.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 7.76
Rhizosphere 89.22
Stem 0
Stem Tuber 0
Unclassified 4.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_11574639 3300013297 Bacteria 703
2 Ga0070683_100092214 3300005329 Bacteria 2845
3 Ga0070683_100771579 3300005329 Unclassified 921
4 Ga0070680_100000261 3300005336 Bacteria 34740
5 Ga0070680_100093559 3300005336 Bacteria 2490
6 Ga0070682_100065902 3300005337 Bacteria 2303
7 Ga0070682_100479059 3300005337 Bacteria 959
8 Ga0068868_100431153 3300005338 Bacteria 1143
9 Ga0070691_10796675 3300005341 Unclassified 575
10 Ga0070661_100267486 3300005344 Bacteria 1323
11 Ga0070675_100905107 3300005354 Bacteria 809
12 Ga0070674_100666293 3300005356 Bacteria 886
13 Ga0070688_100658575 3300005365 Unclassified 807
14 Ga0070688_100902777 3300005365 Bacteria 697
15 Ga0070659_100017115 3300005366 Bacteria 5449
16 Ga0070714_100003930 3300005435 Bacteria 11174
17 Ga0070714_100245526 3300005435 Bacteria 1654
18 Ga0070714_100580720 3300005435 Bacteria 1075
19 Ga0070714_100692838 3300005435 Bacteria 983
20 Ga0070713_100446994 3300005436 Bacteria 1213
21 Ga0070710_10137587 3300005437 Bacteria 1495
22 Ga0070711_100779966 3300005439 Bacteria 809
23 Ga0070708_100516333 3300005445 Bacteria 1127
24 Ga0070678_100332602 3300005456 Bacteria 1301
25 Ga0070681_10000079 3300005458 Bacteria 71936
26 Ga0070706_100034752 3300005467 Bacteria 4656
27 Ga0070707_101668324 3300005468 Unclassified 604
28 Ga0070698_100159093 3300005471 Unclassified 2203
29 Ga0070679_100000056 3300005530 Bacteria 83790
30 Ga0070679_100095620 3300005530 Bacteria 2958
31 Ga0070679_101158417 3300005530 Unclassified 718
32 Ga0070684_100007969 3300005535 Bacteria 8268
33 Ga0070684_100140143 3300005535 Bacteria 2186
34 Ga0070684_100688561 3300005535 Unclassified 953
35 Ga0070686_100709522 3300005544 Bacteria 803
36 Ga0070693_100381075 3300005547 Bacteria 973
37 Ga0068855_100067742 3300005563 Bacteria 4157
38 Ga0070664_100843425 3300005564 Bacteria 858
39 Ga0070664_100848385 3300005564 Bacteria 855
40 Ga0068857_100027819 3300005577 Bacteria 4986
41 Ga0068857_100146490 3300005577 Bacteria 2136
42 Ga0068856_100017364 3300005614 Bacteria 6977
43 Ga0070702_101383947 3300005615 Bacteria 575
44 Ga0068859_100408387 3300005617 Bacteria 1454
45 Ga0068861_100732347 3300005719 Bacteria 922
46 Ga0068860_101560998 3300005843 Bacteria 682
47 Ga0081455_10087121 3300005937 Bacteria 2541
48 Ga0081538_10000992 3300005981 Bacteria 30125
49 Ga0081538_10023620 3300005981 Bacteria 4412
50 Ga0081538_10091867 3300005981 Bacteria 1565
51 Ga0081538_10162578 3300005981 Bacteria 989
52 Ga0081540_1002342 3300005983 Bacteria 15504
53 Ga0081540_1008932 3300005983 Bacteria 6942
54 Ga0081539_10057309 3300005985 Bacteria 2157
55 Ga0070717_10004838 3300006028 Bacteria 9800
56 Ga0070717_10578920 3300006028 Bacteria 1018
57 Ga0070717_11442621 3300006028 Bacteria 625
58 Ga0070717_11667875 3300006028 Bacteria 577
59 Ga0075363_100510471 3300006048 Bacteria 715
60 Ga0070716_100062395 3300006173 Bacteria 2160
61 Ga0070712_100558163 3300006175 Bacteria 965
62 Ga0070712_101868665 3300006175 Bacteria 526
63 Ga0075362_10166671 3300006177 Bacteria 1063
64 Ga0097621_102057848 3300006237 Bacteria 546
65 Ga0068871_101091329 3300006358 Bacteria 746
66 Ga0075428_100016431 3300006844 Bacteria 8177
67 Ga0075430_101560006 3300006846 Bacteria 542
68 Ga0068865_100966546 3300006881 Bacteria 744
69 Ga0097620_100408334 3300006931 Bacteria 1454
70 Ga0105240_10152788 3300009093 Bacteria 2748
71 Ga0105245_10731138 3300009098 Bacteria 1024
72 Ga0105245_12606685 3300009098 Bacteria 559
73 Ga0114129_10007643 3300009147 Bacteria 15385
74 Ga0105243_10029877 3300009148 Bacteria 4194
75 Ga0105241_10160497 3300009174 Bacteria 1847
76 Ga0105242_10037450 3300009176 Bacteria 3896
77 Ga0105242_10062143 3300009176 Bacteria 3073
78 Ga0105242_10689324 3300009176 Bacteria 998
79 Ga0105237_12406456 3300009545 Bacteria 537
80 Ga0157327_1081600 3300012512 Bacteria 521
81 Ga0157369_10058501 3300013105 Bacteria 4158
82 Ga0157369_12228324 3300013105 Bacteria 555
83 Ga0157369_12699199 3300013105 Bacteria 500
84 Ga0157378_10129706 3300013297 Bacteria 2333
85 Ga0157372_11294293 3300013307 Bacteria 841
86 Ga0157375_10120590 3300013308 Unclassified 2731
87 Ga0157375_11386989 3300013308 Bacteria 828
88 Ga0157379_11835379 3300014968 Bacteria 596
89 Ga0157376_12417923 3300014969 Bacteria 565
90 Ga0182005_1209902 3300015265 Bacteria 588
91 Ga0163161_11005657 3300017792 Bacteria 712
92 Ga0163161_11526437 3300017792 Bacteria 587
93 Ga0206356_10480109 3300020070 Bacteria 603
94 Ga0206354_10138253 3300020081 Bacteria 947
95 Ga0206354_11005905 3300020081 Bacteria 1461
96 Ga0206353_11072158 3300020082 Bacteria 1381
97 Ga0206353_11180034 3300020082 Bacteria 1003
98 Ga0213875_10002359 3300021388 Bacteria 11387
99 Ga0224712_10450254 3300022467 Bacteria 618
100 Ga0207647_10666996 3300025904 Bacteria 569
101 Ga0207705_10365254 3300025909 Bacteria 1113
102 Ga0207707_10000103 3300025912 Bacteria 83766
103 Ga0207707_10636277 3300025912 Bacteria 900
104 Ga0207671_11272813 3300025914 Bacteria 573
105 Ga0207693_10194172 3300025915 Bacteria 1597
106 Ga0207693_10531652 3300025915 Bacteria 917
107 Ga0207657_10001594 3300025919 Bacteria 24378
108 Ga0207649_10199795 3300025920 Bacteria 1411
109 Ga0207652_10172357 3300025921 Bacteria 1942
110 Ga0207652_11264667 3300025921 Bacteria 640
111 Ga0207646_10527558 3300025922 Unclassified 1063
112 Ga0207646_11159316 3300025922 Bacteria 679
113 Ga0207694_10125843 3300025924 Bacteria 2050
114 Ga0207700_11499378 3300025928 Unclassified 598
115 Ga0207664_10003005 3300025929 Bacteria 11205
116 Ga0207664_10029914 3300025929 Bacteria 4154
117 Ga0207664_10331821 3300025929 Bacteria 1344
118 Ga0207664_10595858 3300025929 Bacteria 992
119 Ga0207644_11167873 3300025931 Bacteria 647
120 Ga0207686_10011579 3300025934 Bacteria 4833
121 Ga0207709_10035134 3300025935 Bacteria 2961
122 Ga0207709_11121973 3300025935 Bacteria 646
123 Ga0207665_10498033 3300025939 Bacteria 941
124 Ga0207665_11540174 3300025939 Bacteria 528
125 Ga0207661_10116356 3300025944 Bacteria 2269
126 Ga0207661_10719945 3300025944 Bacteria 918
127 Ga0207661_10898322 3300025944 Bacteria 816
128 Ga0207679_10707461 3300025945 Bacteria 914
129 Ga0207679_10858170 3300025945 Bacteria 829
130 Ga0207667_10392815 3300025949 Bacteria 1412
131 Ga0207712_11094599 3300025961 Bacteria 709
132 Ga0207677_10358071 3300026023 Bacteria 1225
133 Ga0207678_10225914 3300026067 Bacteria 1603
134 Ga0207702_10108224 3300026078 Bacteria 2466
135 Ga0207674_10002616 3300026116 Bacteria 22563
136 Ga0207674_10078562 3300026116 Bacteria 3305
137 Ga0207683_10024534 3300026121 Bacteria 5195
138 Ga0265319_1032225 3300028563 Bacteria 1819
139 Ga0307511_10287618 3300030521 Bacteria 754
140 Ga0265320_10072209 3300031240 Bacteria 1624
141 Ga0373926_0468685 3300035083 Bacteria 501
142 Ga0373941_0374607 3300035115 Bacteria 584
143 Ga0373957_0244809 3300035120 Bacteria 754
144 Ga0373943_0165806 3300035170 Bacteria 1206
145 Ga0373955_0680369 3300035172 Bacteria 631
146 Ga0373935_0777268 3300035692 Bacteria 706
147 Ga0373933_0471602 3300035724 Bacteria 822
148 Ga0373947_0116863 3300035725 Bacteria 1692
149 Ga0373937_0102046 3300036401 Bacteria 2663
150 Ga0373937_0114468 3300036401 Bacteria 2511
151 Ga0373937_1814486 3300036401 Bacteria 556
152 Ga0373925_0146460 3300037068 Bacteria 1852
153 Ga0395899_0588563 3300037312 Bacteria 710
154 Ga0395900_0060987 3300037418 Bacteria 3879
155 Ga0395900_0082568 3300037418 Bacteria 3302
156 Ga0395900_0469297 3300037418 Bacteria 1212
157 Ga0395900_0912365 3300037418 Bacteria 801
158 Ga0395898_0041969 3300037466 Bacteria 4516
159 Ga0395898_0046635 3300037466 Bacteria 4256
160 Ga0395898_0588809 3300037466 Bacteria 1055
161 Ga0395905_0113689 3300037471 Bacteria 2543
162 Ga0395905_0330531 3300037471 Bacteria 1415
163 Ga0395905_0736106 3300037471 Bacteria 888
164 Ga0395905_1081648 3300037471 Bacteria 705
165 Ga0436364_0940223 3300037853 Bacteria 123217
166 Ga0395901_0039761 3300038443 Bacteria 4868
167 Ga0395901_0070101 3300038443 Bacteria 3652
168 Ga0395901_0184393 3300038443 Bacteria 2189
169 Ga0395901_0188935 3300038443 Bacteria 2160
170 Ga0395901_0229171 3300038443 Bacteria 1940
171 Ga0395901_0384898 3300038443 Bacteria 1443
172 Ga0395901_0563587 3300038443 Bacteria 1153
173 Ga0395901_0691169 3300038443 Unclassified 1019
174 Ga0395901_0906598 3300038443 Bacteria 863
175 Ga0436365_1053121 3300039437 Bacteria 1340
176 Ga0436363_0848127 3300039450 Bacteria 1216
177 Ga0451847_0971047 3300041503 Bacteria 651
178 Ga0451853_1746272 3300041512 Bacteria 4094
179 Ga0451853_3466388 3300041512 Bacteria 548
180 Ga0451853_3990359 3300041512 Bacteria 502
181 Ga0466969_0010583 3300044656 Bacteria 4888
182 Ga0466965_0036652 3300044683 Bacteria 2406
183 Ga0466965_0062281 3300044683 Bacteria 1866
184 Ga0466965_0085403 3300044683 Bacteria 1600
185 Ga0466965_0701089 3300044683 Bacteria 581
186 Ga0466966_0824441 3300044684 Bacteria 559
187 Ga0466961_0056448 3300044693 Bacteria 2502
188 Ga0466961_0141264 3300044693 Bacteria 1507
189 Ga0466961_0180391 3300044693 Bacteria 1311
190 Ga0466963_0003398 3300044694 Bacteria 9103
191 Ga0466963_0036275 3300044694 Bacteria 3214
192 Ga0466963_0054083 3300044694 Bacteria 2668
193 Ga0466963_0101012 3300044694 Bacteria 1974
194 Ga0466963_0128115 3300044694 Bacteria 1751
195 Ga0466963_0144748 3300044694 Bacteria 1648
196 Ga0466963_0302610 3300044694 Bacteria 1125
197 Ga0466963_0617456 3300044694 Bacteria 765
198 Ga0466963_1201543 3300044694 Bacteria 533
199 Ga0466964_0020144 3300044706 Bacteria 2567
200 Ga0466964_0037591 3300044706 Bacteria 1945
201 Ga0466964_0040005 3300044706 Bacteria 1891
202 Ga0466964_0045300 3300044706 Bacteria 1790
203 Ga0466964_0129293 3300044706 Bacteria 1148
204 Ga0466964_0172134 3300044706 Bacteria 1020
205 Ga0466964_0255813 3300044706 Bacteria 865
206 Ga0466971_0004319 3300044719 Bacteria 6124
207 Ga0466971_0114626 3300044719 Bacteria 1245
208 Ga0466968_0008592 3300044735 Bacteria 3914
209 Ga0466968_0022620 3300044735 Bacteria 2556
210 Ga0466968_0025554 3300044735 Bacteria 2418
211 Ga0466968_0076910 3300044735 Bacteria 1461
212 Ga0466968_0097979 3300044735 Bacteria 1306
213 Ga0466968_0242525 3300044735 Bacteria 854
214 Ga0466968_0478051 3300044735 Bacteria 619
215 Ga0466968_0663212 3300044735 Bacteria 530
216 Ga0466970_0581749 3300044765 Bacteria 649
217 Ga0466970_0585839 3300044765 Bacteria 646
218 Ga0466957_0005018 3300044842 Bacteria 7410
219 Ga0466957_0012203 3300044842 Bacteria 4972
220 Ga0466960_0165646 3300044901 Bacteria 1190
221 Ga0466960_0660552 3300044901 Bacteria 625
222 Ga0466959_0502047 3300045049 Bacteria 820
223 Ga0451576_1164086 3300045051 Bacteria 806
224 Ga0466958_0002518 3300045836 Bacteria 9230
225 Ga0466958_0003210 3300045836 Bacteria 8443
226 Ga0466958_0024283 3300045836 Bacteria 3566
227 Ga0466958_0072790 3300045836 Bacteria 2105
228 Ga0466967_0010182 3300045976 Bacteria 7032
229 Ga0466967_0014056 3300045976 Bacteria 6218
230 Ga0466967_0054770 3300045976 Bacteria 3512
231 Ga0466967_0054911 3300045976 Bacteria 3508
232 Ga0466967_0083421 3300045976 Bacteria 2890
233 Ga0466967_0108125 3300045976 Bacteria 2551
234 Ga0466967_0108511 3300045976 Bacteria 2547
235 Ga0466967_0116603 3300045976 Bacteria 2460
236 Ga0466967_0169162 3300045976 Bacteria 2055
237 Ga0466967_0238542 3300045976 Bacteria 1733
238 Ga0466967_0266037 3300045976 Bacteria 1641
239 Ga0466967_0444642 3300045976 Bacteria 1266
240 Ga0466967_2489457 3300045976 Bacteria 512
241 Ga0495617_114150 3300046452 Bacteria 873
242 Ga0495592_0042180 3300046454 Bacteria 3417
243 Ga0495603_0260195 3300046455 Bacteria 999
244 Ga0495629_0135594 3300046459 Bacteria 1714
245 Ga0495641_0005639 3300046461 Bacteria 8358
246 Ga0495641_0040826 3300046461 Bacteria 2157
247 Ga0495641_0406155 3300046461 Unclassified 618
248 Ga0495641_0433963 3300046461 Bacteria 597
249 Ga0495651_0177427 3300046462 Bacteria 1511
250 Ga0495653_0110211 3300046463 Bacteria 1979
251 Ga0495653_0309900 3300046463 Bacteria 1027
252 Ga0495653_0874667 3300046463 Bacteria 536
253 Ga0495582_0069307 3300046473 Bacteria 1950
254 Ga0495639_0110479 3300046475 Unclassified 1304
255 Ga0495639_0431336 3300046475 Unclassified 668
256 Ga0495639_0667558 3300046475 Bacteria 536
257 Ga0495662_0100599 3300046476 Bacteria 1414
258 Ga0495662_0171741 3300046476 Bacteria 1068
259 Ga0495596_0224962 3300046500 Bacteria 729
260 Ga0495607_0300973 3300046501 Bacteria 755
261 Ga0495608_0019502 3300046511 Bacteria 4666
262 Ga0495616_0399693 3300046513 Bacteria 565
263 Ga0495618_0169866 3300046514 Bacteria 1388
264 Ga0495628_0144879 3300046516 Bacteria 1811
265 Ga0495628_0189851 3300046516 Bacteria 1551
266 Ga0495630_0035159 3300046517 Bacteria 3744
267 Ga0495630_0417089 3300046517 Bacteria 1029
268 Ga0495630_0859967 3300046517 Bacteria 691
269 Ga0495652_0438754 3300046529 Bacteria 916
270 Ga0495652_0455417 3300046529 Bacteria 895
271 Ga0495640_0045469 3300046533 Bacteria 3046
272 Ga0495586_0310670 3300046535 Bacteria 904
273 Ga0495587_0194411 3300046536 Bacteria 1148
274 Ga0495598_0239685 3300046537 Bacteria 668
275 Ga0495645_0479276 3300046543 Bacteria 781
276 Ga0495667_0241274 3300046559 Bacteria 1151
277 Ga0495656_0556454 3300046615 Bacteria 612
278 Ga0495635_0444020 3300046663 Bacteria 858
279 Ga0495659_0138147 3300046664 Unclassified 971
280 Ga0495623_0375536 3300046679 Bacteria 770
281 Ga0495647_0189566 3300046681 Unclassified 898
282 Ga0495658_0013930 3300046683 Bacteria 4100
283 Ga0495658_0065725 3300046683 Bacteria 2093
284 Ga0495613_0003036 3300046689 Bacteria 12557
285 Ga0495613_0410170 3300046689 Unclassified 923
286 Ga0495624_0010409 3300046690 Bacteria 6410
287 Ga0495624_0067451 3300046690 Bacteria 2232
288 Ga0495624_0363691 3300046690 Bacteria 870
289 Ga0495670_0302152 3300046691 Bacteria 858
290 Ga0495671_0385202 3300046692 Bacteria 672
291 Ga0495589_0367546 3300046794 Bacteria 662
292 Ga0495600_0068175 3300046809 Bacteria 2325
293 Ga0495660_0396048 3300046810 Bacteria 606
294 Ga0495581_0124080 3300047315 Unclassified 1503
295 Ga0495604_0079172 3300047317 Bacteria 2465
296 Ga0495604_0197646 3300047317 Bacteria 1397
297 Ga0495674_0004634 3300047319 Bacteria 13218
298 Ga0495674_0117722 3300047319 Bacteria 2247
299 Ga0495674_0279442 3300047319 Bacteria 1368
300 Ga0495674_1006158 3300047319 Bacteria 638
301 Ga0495676_0084489 3300047321 Unclassified 2395
302 Ga0495676_0097277 3300047321 Bacteria 2186
303 Ga0495676_0165412 3300047321 Bacteria 1561
304 Ga0495676_0622640 3300047321 Bacteria 702
305 Ga0495676_0810130 3300047321 Bacteria 603
306 Ga0495676_1051375 3300047321 Bacteria 518
307 Ga0495680_0096352 3300047322 Bacteria 2210
308 Ga0495680_0153910 3300047322 Bacteria 1674
309 Ga0495680_0412348 3300047322 Bacteria 931
310 Ga0495680_0487483 3300047322 Bacteria 839
311 Ga0495593_0172904 3300047673 Bacteria 1089
312 Ga0495593_0340376 3300047673 Bacteria 750
313 Ga0495614_0331994 3300048089 Bacteria 706
314 Ga0495614_0538148 3300048089 Bacteria 558
315 Ga0496100_0035316 3300048903 Bacteria 3143
316 Ga0496100_0173501 3300048903 Bacteria 1555
317 Ga0496100_0747579 3300048903 Bacteria 765
318 Ga0496100_1153768 3300048903 Bacteria 611
319 Ga0496101_0083014 3300048904 Bacteria 2371
320 Ga0496101_0626504 3300048904 Bacteria 850
321 Ga0496101_1349200 3300048904 Bacteria 557
322 Ga0496102_0730662 3300048905 Bacteria 913
323 Ga0496103_0408938 3300048906 Bacteria 871
324 Ga0496104_0022717 3300048907 Bacteria 5761
325 Ga0496104_0523109 3300048907 Bacteria 1097
326 Ga0496105_0001677 3300048908 Bacteria 15797
327 Ga0496106_0067256 3300048909 Bacteria 2731
328 Ga0496107_0110668 3300048910 Bacteria 2018
329 Ga0496107_0314873 3300048910 Unclassified 1165
330 Ga0496107_0611363 3300048910 Unclassified 805
331 Ga0496107_0922955 3300048910 Unclassified 636
332 Ga0496108_0149462 3300048911 Bacteria 2015
333 Ga0496109_0003799 3300048912 Bacteria 12605
334 Ga0496109_0197688 3300048912 Bacteria 1890
335 Ga0496109_0432825 3300048912 Bacteria 1243
336 Ga0496109_1159700 3300048912 Bacteria 709
337 Ga0496109_1351809 3300048912 Bacteria 648
338 Ga0496110_0480415 3300048913 Bacteria 1132
339 Ga0496111_0211842 3300048914 Bacteria 1439
340 Ga0496111_0752032 3300048914 Bacteria 707
341 Ga0496111_0966663 3300048914 Bacteria 611
342 Ga0496111_1067250 3300048914 Bacteria 577
343 Ga0496112_0027493 3300048915 Bacteria 5484
344 Ga0496112_1048138 3300048915 Bacteria 734
345 Ga0496113_0135500 3300048916 Bacteria 1935
346 Ga0496113_0152614 3300048916 Bacteria 1823
347 Ga0496114_0931437 3300048917 Bacteria 751
348 Ga0496115_0074281 3300048918 Bacteria 2760
349 Ga0496115_0599381 3300048918 Bacteria 876
350 Ga0496115_1012402 3300048918 Bacteria 634
351 Ga0501031_0000579 3300049568 Bacteria 21517
352 Ga0501031_0065056 3300049568 Bacteria 2376
353 Ga0501032_0009823 3300049569 Bacteria 6921
354 Ga0501032_0048020 3300049569 Bacteria 2882
355 Ga0501033_0007326 3300049570 Bacteria 8600
356 Ga0501033_0019246 3300049570 Bacteria 5160
357 Ga0501033_0384910 3300049570 Bacteria 980
358 Ga0501034_0895099 3300049571 Bacteria 776
359 Ga0501036_0001333 3300049572 Bacteria 18960
360 Ga0501036_0022824 3300049572 Bacteria 5268
361 Ga0501037_0001891 3300049573 Bacteria 15225
362 Ga0501037_0003358 3300049573 Bacteria 11632
363 Ga0501038_0004714 3300049574 Bacteria 12683
364 Ga0501038_0029053 3300049574 Bacteria 4903
365 Ga0501038_0553546 3300049574 Bacteria 874
366 Ga0501039_0002177 3300049575 Bacteria 14476
367 Ga0501039_0004237 3300049575 Bacteria 10798
368 Ga0501039_0050682 3300049575 Bacteria 3212
369 Ga0501040_0000543 3300049576 Bacteria 22790
370 Ga0501040_0001465 3300049576 Bacteria 14961
371 Ga0501040_0059622 3300049576 Bacteria 2622
372 Ga0501041_0001394 3300049577 Bacteria 13358
373 Ga0501041_0012244 3300049577 Bacteria 5082
374 Ga0501041_0050029 3300049577 Bacteria 2546
375 Ga0501041_0193259 3300049577 Bacteria 1275
376 Ga0501042_0000869 3300049578 Bacteria 16883
377 Ga0501042_0006630 3300049578 Bacteria 7538
378 Ga0501042_0503384 3300049578 Bacteria 879
379 Ga0501043_0040830 3300049579 Bacteria 3646
380 Ga0501043_0123307 3300049579 Bacteria 2032
381 Ga0501046_0001721 3300049580 Bacteria 20878
382 Ga0501046_0009662 3300049580 Bacteria 8316
383 Ga0501046_0041428 3300049580 Bacteria 3675
384 Ga0501048_0000307 3300049582 Bacteria 33260
385 Ga0501048_0035911 3300049582 Bacteria 3565
386 Ga0501048_0064356 3300049582 Bacteria 2593
387 Ga0501067_0095647 3300049583 Bacteria 1649
388 Ga0501067_0186245 3300049583 Bacteria 1156
389 Ga0501067_0219118 3300049583 Bacteria 1060
390 Ga0501068_0003870 3300049584 Bacteria 8125
391 Ga0501068_0005694 3300049584 Bacteria 6824
392 Ga0501068_0081344 3300049584 Bacteria 1988
393 Ga0501069_0000848 3300049585 Bacteria 14466
394 Ga0501069_0047812 3300049585 Bacteria 2375
395 Ga0501070_0007384 3300049586 Bacteria 9335
396 Ga0501070_0251653 3300049586 Bacteria 1445
397 Ga0501070_0599761 3300049586 Bacteria 878
398 Ga0501071_0000691 3300049587 Bacteria 17654
399 Ga0501071_0004755 3300049587 Bacteria 8645
400 Ga0501071_0005985 3300049587 Bacteria 7880
401 Ga0501072_0002727 3300049588 Bacteria 13256
402 Ga0501072_0010887 3300049588 Bacteria 6937
403 Ga0501072_0011031 3300049588 Bacteria 6896
404 Ga0501072_0634342 3300049588 Bacteria 841
405 Ga0501072_0894897 3300049588 Bacteria 693
406 Ga0501073_0067669 3300049589 Bacteria 2490
407 Ga0501073_0173526 3300049589 Bacteria 1492
408 Ga0501074_0000964 3300049590 Bacteria 18612
409 Ga0501074_0001509 3300049590 Bacteria 15709
410 Ga0501074_0117635 3300049590 Bacteria 1901
411 Ga0501075_0000233 3300049591 Bacteria 29841
412 Ga0501075_0881544 3300049591 Bacteria 680
413 Ga0501076_0000267 3300049592 Bacteria 32294
414 Ga0501076_0029133 3300049592 Bacteria 4291
415 Ga0501076_0071507 3300049592 Bacteria 2775
416 Ga0501077_0001021 3300049593 Bacteria 16908
417 Ga0501077_0006994 3300049593 Bacteria 6953
418 Ga0501077_0012199 3300049593 Bacteria 5380
419 Ga0501079_0000710 3300049741 Bacteria 22479
420 Ga0501079_0005613 3300049741 Bacteria 9363
421 Ga0501079_0063770 3300049741 Bacteria 2842
422 Ga0501080_0043222 3300049742 Bacteria 4196
423 Ga0501080_0047757 3300049742 Bacteria 3985
424 Ga0501080_0140109 3300049742 Bacteria 2236
425 Ga0501080_0326033 3300049742 Bacteria 1389
426 Ga0501081_0017975 3300049743 Bacteria 4689
427 Ga0501081_0128152 3300049743 Bacteria 1811
428 Ga0501081_1318182 3300049743 Bacteria 547
429 Ga0501083_0006378 3300049744 Bacteria 8360
430 Ga0501083_0150498 3300049744 Bacteria 1524
431 Ga0501035_0002907 3300049822 Bacteria 16492
432 Ga0501035_0009240 3300049822 Bacteria 9166
433 Ga0501035_0134312 3300049822 Bacteria 2155
434 Ga0501035_0218963 3300049822 Bacteria 1626
435 Ga0501044_0113739 3300049823 Bacteria 2713
436 Ga0501045_0000233 3300049824 Bacteria 32252
437 Ga0501045_0004284 3300049824 Bacteria 9838
438 Ga0501045_0057012 3300049824 Bacteria 2858
439 Ga0501045_0117457 3300049824 Bacteria 1974
440 nmdc:mga03n38_108505_c1 3300050490 Bacteria 1348
441 nmdc:mga0yw44_40155_c1 3300050492 Bacteria 2778
442 nmdc:mga07m45_324976_c1 3300050496 Bacteria 894
443 nmdc:mga05p37_162916_c1 3300050507 Bacteria 2723
444 nmdc:mga08y16_61061_c1 3300050511 Bacteria 3936
445 nmdc:mga0n895_322599_c1 3300050512 Bacteria 1565
446 nmdc:mga0n895_322955_c1 3300050512 Bacteria 1564
447 nmdc:mga0a205_152915_c1 3300050515 Bacteria 2206
448 Ga0495601_0083701 3300053077 Bacteria 2049
449 Ga0495601_0560699 3300053077 Bacteria 734
450 Ga0495612_0307808 3300053078 Bacteria 711
451 Ga0495595_0094646 3300053084 Bacteria 1436
452 Ga0495595_0402666 3300053084 Bacteria 693
453 Ga0495619_0188232 3300053085 Bacteria 1429
454 Ga0495619_1033067 3300053085 Bacteria 549
455 Ga0501084_0000342 3300054114 Bacteria 35514
456 Ga0501084_0016265 3300054114 Bacteria 6176
457 Ga0501084_0722727 3300054114 Bacteria 839
458 Ga0501082_0000278 3300060353 Bacteria 45190
459 Ga0501082_0013960 3300060353 Bacteria 6908
460 Ga0501082_0024673 3300060353 Bacteria 5182
461 Ga0466962_0110961 3300061719 Bacteria 1320
462 Ga0530510_0004652 3300061734 Bacteria 9493
463 Ga0530510_0005624 3300061734 Bacteria 8686
464 Ga0530510_0049671 3300061734 Bacteria 3030
465 Ga0157378_11574639
466 Ga0070683_100092214
467 Ga0070683_100771579
468 Ga0070680_100000261
469 Ga0070680_100093559
470 Ga0070682_100065902
471 Ga0070682_100479059
472 Ga0068868_100431153
473 Ga0070691_10796675
474 Ga0070661_100267486
475 Ga0070675_100905107
476 Ga0070674_100666293
477 Ga0070688_100658575
478 Ga0070688_100902777
479 Ga0070659_100017115
480 Ga0070714_100003930
481 Ga0070714_100245526
482 Ga0070714_100580720
483 Ga0070714_100692838
484 Ga0070713_100446994
485 Ga0070710_10137587
486 Ga0070711_100779966
487 Ga0070708_100516333
488 Ga0070678_100332602
489 Ga0070681_10000079
490 Ga0070706_100034752
491 Ga0070707_101668324
492 Ga0070698_100159093
493 Ga0070679_100000056
494 Ga0070679_100095620
495 Ga0070679_101158417
496 Ga0070684_100007969
497 Ga0070684_100140143
498 Ga0070684_100688561
499 Ga0070686_100709522
500 Ga0070693_100381075
501 Ga0068855_100067742
502 Ga0070664_100843425
503 Ga0070664_100848385
504 Ga0068857_100027819
505 Ga0068857_100146490
506 Ga0068856_100017364
507 Ga0070702_101383947
508 Ga0068859_100408387
509 Ga0068861_100732347
510 Ga0068860_101560998
511 Ga0081455_10087121
512 Ga0081538_10000992
513 Ga0081538_10023620
514 Ga0081538_10091867
515 Ga0081538_10162578
516 Ga0081540_1002342
517 Ga0081540_1008932
518 Ga0081539_10057309
519 Ga0070717_10004838
520 Ga0070717_10578920
521 Ga0070717_11442621
522 Ga0070717_11667875
523 Ga0075363_100510471
524 Ga0070716_100062395
525 Ga0070712_100558163
526 Ga0070712_101868665
527 Ga0075362_10166671
528 Ga0097621_102057848
529 Ga0068871_101091329
530 Ga0075428_100016431
531 Ga0075430_101560006
532 Ga0068865_100966546
533 Ga0097620_100408334
534 Ga0105240_10152788
535 Ga0105245_10731138
536 Ga0105245_12606685
537 Ga0114129_10007643
538 Ga0105243_10029877
539 Ga0105241_10160497
540 Ga0105242_10037450
541 Ga0105242_10062143
542 Ga0105242_10689324
543 Ga0105237_12406456
544 Ga0157327_1081600
545 Ga0157369_10058501
546 Ga0157369_12228324
547 Ga0157369_12699199
548 Ga0157378_10129706
549 Ga0157372_11294293
550 Ga0157375_10120590
551 Ga0157375_11386989
552 Ga0157379_11835379
553 Ga0157376_12417923
554 Ga0182005_1209902
555 Ga0163161_11005657
556 Ga0163161_11526437
557 Ga0206356_10480109
558 Ga0206354_10138253
559 Ga0206354_11005905
560 Ga0206353_11072158
561 Ga0206353_11180034
562 Ga0213875_10002359
563 Ga0224712_10450254
564 Ga0207647_10666996
565 Ga0207705_10365254
566 Ga0207707_10000103
567 Ga0207707_10636277
568 Ga0207671_11272813
569 Ga0207693_10194172
570 Ga0207693_10531652
571 Ga0207657_10001594
572 Ga0207649_10199795
573 Ga0207652_10172357
574 Ga0207652_11264667
575 Ga0207646_10527558
576 Ga0207646_11159316
577 Ga0207694_10125843
578 Ga0207700_11499378
579 Ga0207664_10003005
580 Ga0207664_10029914
581 Ga0207664_10331821
582 Ga0207664_10595858
583 Ga0207644_11167873
584 Ga0207686_10011579
585 Ga0207709_10035134
586 Ga0207709_11121973
587 Ga0207665_10498033
588 Ga0207665_11540174
589 Ga0207661_10116356
590 Ga0207661_10719945
591 Ga0207661_10898322
592 Ga0207679_10707461
593 Ga0207679_10858170
594 Ga0207667_10392815
595 Ga0207712_11094599
596 Ga0207677_10358071
597 Ga0207678_10225914
598 Ga0207702_10108224
599 Ga0207674_10002616
600 Ga0207674_10078562
601 Ga0207683_10024534
602 Ga0265319_1032225
603 Ga0307511_10287618
604 Ga0265320_10072209
605 Ga0373926_0468685
606 Ga0373941_0374607
607 Ga0373957_0244809
608 Ga0373943_0165806
609 Ga0373955_0680369
610 Ga0373935_0777268
611 Ga0373933_0471602
612 Ga0373947_0116863
613 Ga0373937_0102046
614 Ga0373937_0114468
615 Ga0373937_1814486
616 Ga0373925_0146460
617 Ga0395899_0588563
618 Ga0395900_0060987
619 Ga0395900_0082568
620 Ga0395900_0469297
621 Ga0395900_0912365
622 Ga0395898_0041969
623 Ga0395898_0046635
624 Ga0395898_0588809
625 Ga0395905_0113689
626 Ga0395905_0330531
627 Ga0395905_0736106
628 Ga0395905_1081648
629 Ga0436364_0940223
630 Ga0395901_0039761
631 Ga0395901_0070101
632 Ga0395901_0184393
633 Ga0395901_0188935
634 Ga0395901_0229171
635 Ga0395901_0384898
636 Ga0395901_0563587
637 Ga0395901_0691169
638 Ga0395901_0906598
639 Ga0436365_1053121
640 Ga0436363_0848127
641 Ga0451847_0971047
642 Ga0451853_1746272
643 Ga0451853_3466388
644 Ga0451853_3990359
645 Ga0466969_0010583
646 Ga0466965_0036652
647 Ga0466965_0062281
648 Ga0466965_0085403
649 Ga0466965_0701089
650 Ga0466966_0824441
651 Ga0466961_0056448
652 Ga0466961_0141264
653 Ga0466961_0180391
654 Ga0466963_0003398
655 Ga0466963_0036275
656 Ga0466963_0054083
657 Ga0466963_0101012
658 Ga0466963_0128115
659 Ga0466963_0144748
660 Ga0466963_0302610
661 Ga0466963_0617456
662 Ga0466963_1201543
663 Ga0466964_0020144
664 Ga0466964_0037591
665 Ga0466964_0040005
666 Ga0466964_0045300
667 Ga0466964_0129293
668 Ga0466964_0172134
669 Ga0466964_0255813
670 Ga0466971_0004319
671 Ga0466971_0114626
672 Ga0466968_0008592
673 Ga0466968_0022620
674 Ga0466968_0025554
675 Ga0466968_0076910
676 Ga0466968_0097979
677 Ga0466968_0242525
678 Ga0466968_0478051
679 Ga0466968_0663212
680 Ga0466970_0581749
681 Ga0466970_0585839
682 Ga0466957_0005018
683 Ga0466957_0012203
684 Ga0466960_0165646
685 Ga0466960_0660552
686 Ga0466959_0502047
687 Ga0451576_1164086
688 Ga0466958_0002518
689 Ga0466958_0003210
690 Ga0466958_0024283
691 Ga0466958_0072790
692 Ga0466967_0010182
693 Ga0466967_0014056
694 Ga0466967_0054770
695 Ga0466967_0054911
696 Ga0466967_0083421
697 Ga0466967_0108125
698 Ga0466967_0108511
699 Ga0466967_0116603
700 Ga0466967_0169162
701 Ga0466967_0238542
702 Ga0466967_0266037
703 Ga0466967_0444642
704 Ga0466967_2489457
705 Ga0495617_114150
706 Ga0495592_0042180
707 Ga0495603_0260195
708 Ga0495629_0135594
709 Ga0495641_0005639
710 Ga0495641_0040826
711 Ga0495641_0406155
712 Ga0495641_0433963
713 Ga0495651_0177427
714 Ga0495653_0110211
715 Ga0495653_0309900
716 Ga0495653_0874667
717 Ga0495582_0069307
718 Ga0495639_0110479
719 Ga0495639_0431336
720 Ga0495639_0667558
721 Ga0495662_0100599
722 Ga0495662_0171741
723 Ga0495596_0224962
724 Ga0495607_0300973
725 Ga0495608_0019502
726 Ga0495616_0399693
727 Ga0495618_0169866
728 Ga0495628_0144879
729 Ga0495628_0189851
730 Ga0495630_0035159
731 Ga0495630_0417089
732 Ga0495630_0859967
733 Ga0495652_0438754
734 Ga0495652_0455417
735 Ga0495640_0045469
736 Ga0495586_0310670
737 Ga0495587_0194411
738 Ga0495598_0239685
739 Ga0495645_0479276
740 Ga0495667_0241274
741 Ga0495656_0556454
742 Ga0495635_0444020
743 Ga0495659_0138147
744 Ga0495623_0375536
745 Ga0495647_0189566
746 Ga0495658_0013930
747 Ga0495658_0065725
748 Ga0495613_0003036
749 Ga0495613_0410170
750 Ga0495624_0010409
751 Ga0495624_0067451
752 Ga0495624_0363691
753 Ga0495670_0302152
754 Ga0495671_0385202
755 Ga0495589_0367546
756 Ga0495600_0068175
757 Ga0495660_0396048
758 Ga0495581_0124080
759 Ga0495604_0079172
760 Ga0495604_0197646
761 Ga0495674_0004634
762 Ga0495674_0117722
763 Ga0495674_0279442
764 Ga0495674_1006158
765 Ga0495676_0084489
766 Ga0495676_0097277
767 Ga0495676_0165412
768 Ga0495676_0622640
769 Ga0495676_0810130
770 Ga0495676_1051375
771 Ga0495680_0096352
772 Ga0495680_0153910
773 Ga0495680_0412348
774 Ga0495680_0487483
775 Ga0495593_0172904
776 Ga0495593_0340376
777 Ga0495614_0331994
778 Ga0495614_0538148
779 Ga0496100_0035316
780 Ga0496100_0173501
781 Ga0496100_0747579
782 Ga0496100_1153768
783 Ga0496101_0083014
784 Ga0496101_0626504
785 Ga0496101_1349200
786 Ga0496102_0730662
787 Ga0496103_0408938
788 Ga0496104_0022717
789 Ga0496104_0523109
790 Ga0496105_0001677
791 Ga0496106_0067256
792 Ga0496107_0110668
793 Ga0496107_0314873
794 Ga0496107_0611363
795 Ga0496107_0922955
796 Ga0496108_0149462
797 Ga0496109_0003799
798 Ga0496109_0197688
799 Ga0496109_0432825
800 Ga0496109_1159700
801 Ga0496109_1351809
802 Ga0496110_0480415
803 Ga0496111_0211842
804 Ga0496111_0752032
805 Ga0496111_0966663
806 Ga0496111_1067250
807 Ga0496112_0027493
808 Ga0496112_1048138
809 Ga0496113_0135500
810 Ga0496113_0152614
811 Ga0496114_0931437
812 Ga0496115_0074281
813 Ga0496115_0599381
814 Ga0496115_1012402
815 Ga0501031_0000579
816 Ga0501031_0065056
817 Ga0501032_0009823
818 Ga0501032_0048020
819 Ga0501033_0007326
820 Ga0501033_0019246
821 Ga0501033_0384910
822 Ga0501034_0895099
823 Ga0501036_0001333
824 Ga0501036_0022824
825 Ga0501037_0001891
826 Ga0501037_0003358
827 Ga0501038_0004714
828 Ga0501038_0029053
829 Ga0501038_0553546
830 Ga0501039_0002177
831 Ga0501039_0004237
832 Ga0501039_0050682
833 Ga0501040_0000543
834 Ga0501040_0001465
835 Ga0501040_0059622
836 Ga0501041_0001394
837 Ga0501041_0012244
838 Ga0501041_0050029
839 Ga0501041_0193259
840 Ga0501042_0000869
841 Ga0501042_0006630
842 Ga0501042_0503384
843 Ga0501043_0040830
844 Ga0501043_0123307
845 Ga0501046_0001721
846 Ga0501046_0009662
847 Ga0501046_0041428
848 Ga0501048_0000307
849 Ga0501048_0035911
850 Ga0501048_0064356
851 Ga0501067_0095647
852 Ga0501067_0186245
853 Ga0501067_0219118
854 Ga0501068_0003870
855 Ga0501068_0005694
856 Ga0501068_0081344
857 Ga0501069_0000848
858 Ga0501069_0047812
859 Ga0501070_0007384
860 Ga0501070_0251653
861 Ga0501070_0599761
862 Ga0501071_0000691
863 Ga0501071_0004755
864 Ga0501071_0005985
865 Ga0501072_0002727
866 Ga0501072_0010887
867 Ga0501072_0011031
868 Ga0501072_0634342
869 Ga0501072_0894897
870 Ga0501073_0067669
871 Ga0501073_0173526
872 Ga0501074_0000964
873 Ga0501074_0001509
874 Ga0501074_0117635
875 Ga0501075_0000233
876 Ga0501075_0881544
877 Ga0501076_0000267
878 Ga0501076_0029133
879 Ga0501076_0071507
880 Ga0501077_0001021
881 Ga0501077_0006994
882 Ga0501077_0012199
883 Ga0501079_0000710
884 Ga0501079_0005613
885 Ga0501079_0063770
886 Ga0501080_0043222
887 Ga0501080_0047757
888 Ga0501080_0140109
889 Ga0501080_0326033
890 Ga0501081_0017975
891 Ga0501081_0128152
892 Ga0501081_1318182
893 Ga0501083_0006378
894 Ga0501083_0150498
895 Ga0501035_0002907
896 Ga0501035_0009240
897 Ga0501035_0134312
898 Ga0501035_0218963
899 Ga0501044_0113739
900 Ga0501045_0000233
901 Ga0501045_0004284
902 Ga0501045_0057012
903 Ga0501045_0117457
904 nmdc:mga03n38_108505_c1
905 nmdc:mga0yw44_40155_c1
906 nmdc:mga07m45_324976_c1
907 nmdc:mga05p37_162916_c1
908 nmdc:mga08y16_61061_c1
909 nmdc:mga0n895_322599_c1
910 nmdc:mga0n895_322955_c1
911 nmdc:mga0a205_152915_c1
912 Ga0495601_0083701
913 Ga0495601_0560699
914 Ga0495612_0307808
915 Ga0495595_0094646
916 Ga0495595_0402666
917 Ga0495619_0188232
918 Ga0495619_1033067
919 Ga0501084_0000342
920 Ga0501084_0016265
921 Ga0501084_0722727
922 Ga0501082_0000278
923 Ga0501082_0013960
924 Ga0501082_0024673
925 Ga0466962_0110961
926 Ga0530510_0004652
927 Ga0530510_0005624
928 Ga0530510_0049671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04993

TfoX_N

TfoX N-terminal domain

30

120

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.739 8 102
6lnw-assembly1.cif.gz_A crystal structure of accessory secretory protein 1,2 and 3 in streptococcus pneumoniae 0.6699 16 50
5vae-assembly5.cif.gz_E crystal structure of accessory secretion protein 1 and 3 0.66 16 53
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.6483 8 102
5vaf-assembly1.cif.gz_A crystal structure of accessory secretion protein 1 0.6479 16 50
ID Description Score Start End Superfamily
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7493 8 97 3.90.1150.30
af_O14306_468_764_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7345 20 34 2.130.10.10
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7241 5 102 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6892 1 110 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6787 1 110 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A7W0KXJ2-F1-model_v4 TfoX/Sxy family protein 0.9814 1 110
AF-A0A7V9DNC1-F1-model_v4 TfoX/Sxy family protein 0.9811 1 110
AF-A0A538DXJ4-F1-model_v4 Dienelactone hydrolase family protein 0.9762 1 110 GO:0016787
AF-K0FBP8-F1-model_v4 TfoX N-terminal domain-containing protein 0.9738 1 110
AF-A0A7W0KXJ2-F1-model_v4 TfoX/Sxy family protein 0.9726 1 110

Map