F449264
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 464 | 213 | 463 | 260 |
Family's Representative Sequence
| Representative Sequence | 3300005618|Ga0068864_100046033|Ga0068864_1000460333 |
| Length | 271 |
| Sequence | MERRLNGAAHHHKLAIEAVGRTFAGVRGGTPTVALEPVTLRVEDHDFITILGPSGCGKSTLLRIVAGLDTPTAGRVLLDGTPVVAPGADRGMVFQSYTLFPWLTVHENICFGLREKNMPQNEQQRIAAHYIARVGLGGFEHHYPKMLSGGMQQRTAIARALANDPKILLLDEPFGALDNQTRALMQELLLGIWEAEKKTVLFVTHDIEEAIFMAGRVIVMSARPGRIKAEVAVDLPHPRHYTVKTTPEFSALKARLTEEIRSEALKVAAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 154 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 155 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 156 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 157 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 158 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 159 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 160 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 162 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 163 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 165 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 166 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 168 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 169 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 172 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 173 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 180 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 181 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 182 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 183 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 184 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 203 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 211 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.78 |
| Metatranscriptomes | 0 |
| Isolates | 0.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.29 |
| Nodule | 0 |
| Rhizoplane | 1.08 |
| Rhizosphere | 97.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10111531 | 3300005293 | Bacteria | 2570 |
| 2 | Ga0065707_10017671 | 3300005295 | Bacteria | 1738 |
| 3 | Ga0070676_10330853 | 3300005328 | Bacteria | 1042 |
| 4 | Ga0070690_100000701 | 3300005330 | Bacteria | 17178 |
| 5 | Ga0070690_100049474 | 3300005330 | Bacteria | 2680 |
| 6 | Ga0070690_100287628 | 3300005330 | Bacteria | 1175 |
| 7 | Ga0070670_100014823 | 3300005331 | Bacteria | 6685 |
| 8 | Ga0070670_100077764 | 3300005331 | Bacteria | 2850 |
| 9 | Ga0070670_100165509 | 3300005331 | Bacteria | 1917 |
| 10 | Ga0070670_100236372 | 3300005331 | Bacteria | 1590 |
| 11 | Ga0068869_100000240 | 3300005334 | Bacteria | 28811 |
| 12 | Ga0068869_100004298 | 3300005334 | Bacteria | 8845 |
| 13 | Ga0068869_100039144 | 3300005334 | Bacteria | 3384 |
| 14 | Ga0070666_10085117 | 3300005335 | Bacteria | 2165 |
| 15 | Ga0070680_100002168 | 3300005336 | Bacteria | 14465 |
| 16 | Ga0070680_100351406 | 3300005336 | Bacteria | 1254 |
| 17 | Ga0068868_100000471 | 3300005338 | Bacteria | 26837 |
| 18 | Ga0068868_100011298 | 3300005338 | Bacteria | 6501 |
| 19 | Ga0070689_100000540 | 3300005340 | Bacteria | 22545 |
| 20 | Ga0070689_100035324 | 3300005340 | Bacteria | 3819 |
| 21 | Ga0070689_100300577 | 3300005340 | Bacteria | 1336 |
| 22 | Ga0070691_10001174 | 3300005341 | Bacteria | 10949 |
| 23 | Ga0070687_100000416 | 3300005343 | Bacteria | 14397 |
| 24 | Ga0070661_100421558 | 3300005344 | Bacteria | 1058 |
| 25 | Ga0070668_100001341 | 3300005347 | Bacteria | 17586 |
| 26 | Ga0070668_100013667 | 3300005347 | Bacteria | 6061 |
| 27 | Ga0070668_100362326 | 3300005347 | Bacteria | 1230 |
| 28 | Ga0070669_100000668 | 3300005353 | Bacteria | 25208 |
| 29 | Ga0070669_100046538 | 3300005353 | Bacteria | 3164 |
| 30 | Ga0070669_100198613 | 3300005353 | Bacteria | 1577 |
| 31 | Ga0070669_100279268 | 3300005353 | Bacteria | 1338 |
| 32 | Ga0070669_100281900 | 3300005353 | Bacteria | 1332 |
| 33 | Ga0070675_100001258 | 3300005354 | Bacteria | 18530 |
| 34 | Ga0070675_100051570 | 3300005354 | Bacteria | 3381 |
| 35 | Ga0070675_100580603 | 3300005354 | Bacteria | 1016 |
| 36 | Ga0070671_100010289 | 3300005355 | Bacteria | 7504 |
| 37 | Ga0070671_100092362 | 3300005355 | Bacteria | 2536 |
| 38 | Ga0070674_100163424 | 3300005356 | Bacteria | 1691 |
| 39 | Ga0070673_100015219 | 3300005364 | Bacteria | 5395 |
| 40 | Ga0070673_100092350 | 3300005364 | Bacteria | 2476 |
| 41 | Ga0070673_100307305 | 3300005364 | Bacteria | 1398 |
| 42 | Ga0070688_100038958 | 3300005365 | Bacteria | 2906 |
| 43 | Ga0070667_100004919 | 3300005367 | Bacteria | 11200 |
| 44 | Ga0070667_100005264 | 3300005367 | Bacteria | 10819 |
| 45 | Ga0070667_100037796 | 3300005367 | Bacteria | 4047 |
| 46 | Ga0070667_100095033 | 3300005367 | Bacteria | 2569 |
| 47 | Ga0070701_10001283 | 3300005438 | Bacteria | 9233 |
| 48 | Ga0070705_100001316 | 3300005440 | Bacteria | 13312 |
| 49 | Ga0070700_100005090 | 3300005441 | Bacteria | 6935 |
| 50 | Ga0070700_100496299 | 3300005441 | Bacteria | 938 |
| 51 | Ga0070694_100000418 | 3300005444 | Bacteria | 23163 |
| 52 | Ga0070694_100022197 | 3300005444 | Bacteria | 4064 |
| 53 | Ga0070694_100229579 | 3300005444 | Bacteria | 1396 |
| 54 | Ga0070708_100000538 | 3300005445 | Bacteria | 28503 |
| 55 | Ga0070708_100003225 | 3300005445 | Bacteria | 12725 |
| 56 | Ga0070708_100477347 | 3300005445 | Bacteria | 1176 |
| 57 | Ga0070663_100058005 | 3300005455 | Bacteria | 2779 |
| 58 | Ga0070678_100003201 | 3300005456 | Bacteria | 9087 |
| 59 | Ga0070678_100024961 | 3300005456 | Bacteria | 4012 |
| 60 | Ga0070678_100042104 | 3300005456 | Bacteria | 3243 |
| 61 | Ga0070678_100266690 | 3300005456 | Bacteria | 1442 |
| 62 | Ga0070681_10137436 | 3300005458 | Bacteria | 2374 |
| 63 | Ga0068867_100000442 | 3300005459 | Bacteria | 27552 |
| 64 | Ga0068867_100000975 | 3300005459 | Bacteria | 19545 |
| 65 | Ga0068867_100061803 | 3300005459 | Bacteria | 2782 |
| 66 | Ga0068867_100241645 | 3300005459 | Bacteria | 1465 |
| 67 | Ga0068867_100387442 | 3300005459 | Bacteria | 1175 |
| 68 | Ga0068867_100429930 | 3300005459 | Bacteria | 1120 |
| 69 | Ga0070706_100314631 | 3300005467 | Bacteria | 1460 |
| 70 | Ga0070707_100740903 | 3300005468 | Bacteria | 946 |
| 71 | Ga0070699_100456665 | 3300005518 | Bacteria | 1158 |
| 72 | Ga0070697_100018516 | 3300005536 | Bacteria | 5490 |
| 73 | Ga0070697_100091416 | 3300005536 | Bacteria | 2516 |
| 74 | Ga0068853_100110480 | 3300005539 | Bacteria | 2442 |
| 75 | Ga0068853_100283465 | 3300005539 | Bacteria | 1528 |
| 76 | Ga0070672_100000287 | 3300005543 | Bacteria | 28567 |
| 77 | Ga0070672_100005272 | 3300005543 | Bacteria | 8552 |
| 78 | Ga0070672_100013687 | 3300005543 | Bacteria | 5736 |
| 79 | Ga0070672_100014087 | 3300005543 | Bacteria | 5659 |
| 80 | Ga0070686_100082250 | 3300005544 | Bacteria | 2135 |
| 81 | Ga0070695_100002769 | 3300005545 | Bacteria | 10170 |
| 82 | Ga0070696_100084812 | 3300005546 | Bacteria | 2248 |
| 83 | Ga0070693_100001954 | 3300005547 | Bacteria | 9438 |
| 84 | Ga0070665_100008986 | 3300005548 | Bacteria | 10122 |
| 85 | Ga0070665_100013659 | 3300005548 | Bacteria | 8169 |
| 86 | Ga0070704_100002922 | 3300005549 | Bacteria | 9706 |
| 87 | Ga0068855_100083397 | 3300005563 | Bacteria | 3702 |
| 88 | Ga0070664_100062389 | 3300005564 | Bacteria | 3177 |
| 89 | Ga0070664_100173075 | 3300005564 | Bacteria | 1916 |
| 90 | Ga0068857_100046789 | 3300005577 | Bacteria | 3839 |
| 91 | Ga0068854_100033950 | 3300005578 | Bacteria | 3560 |
| 92 | Ga0068854_100098147 | 3300005578 | Bacteria | 2192 |
| 93 | Ga0068856_100021812 | 3300005614 | Bacteria | 6224 |
| 94 | Ga0068856_100408970 | 3300005614 | Bacteria | 1376 |
| 95 | Ga0070702_100000090 | 3300005615 | Bacteria | 26645 |
| 96 | Ga0070702_100128753 | 3300005615 | Bacteria | 1596 |
| 97 | Ga0068852_100151372 | 3300005616 | Bacteria | 2158 |
| 98 | Ga0068852_100516969 | 3300005616 | Bacteria | 1191 |
| 99 | Ga0068859_100001633 | 3300005617 | Bacteria | 22912 |
| 100 | Ga0068859_100050936 | 3300005617 | Bacteria | 4161 |
| 101 | Ga0068859_100063117 | 3300005617 | Bacteria | 3735 |
| 102 | Ga0068859_100083674 | 3300005617 | Bacteria | 3234 |
| 103 | Ga0068859_100216526 | 3300005617 | Bacteria | 2002 |
| 104 | Ga0068859_100486400 | 3300005617 | Bacteria | 1329 |
| 105 | Ga0068864_100003577 | 3300005618 | Bacteria | 12845 |
| 106 | Ga0068864_100005258 | 3300005618 | Bacteria | 10611 |
| 107 | Ga0068864_100046033 | 3300005618 | Bacteria | 3743 |
| 108 | Ga0068864_100365432 | 3300005618 | Bacteria | 1364 |
| 109 | Ga0068864_100550979 | 3300005618 | Bacteria | 1114 |
| 110 | Ga0068864_100839833 | 3300005618 | Bacteria | 904 |
| 111 | Ga0068866_10000485 | 3300005718 | Bacteria | 18232 |
| 112 | Ga0068861_100000853 | 3300005719 | Bacteria | 18466 |
| 113 | Ga0068861_100027365 | 3300005719 | Bacteria | 4152 |
| 114 | Ga0068861_100240065 | 3300005719 | Bacteria | 1541 |
| 115 | Ga0068870_10040353 | 3300005840 | Bacteria | 2420 |
| 116 | Ga0068863_100001368 | 3300005841 | Bacteria | 24235 |
| 117 | Ga0068863_100428358 | 3300005841 | Bacteria | 1297 |
| 118 | Ga0068863_100738773 | 3300005841 | Bacteria | 979 |
| 119 | Ga0068858_100006176 | 3300005842 | Bacteria | 11684 |
| 120 | Ga0068858_100016320 | 3300005842 | Bacteria | 6976 |
| 121 | Ga0068858_100031100 | 3300005842 | Bacteria | 4957 |
| 122 | Ga0068858_100153373 | 3300005842 | Bacteria | 2167 |
| 123 | Ga0068860_100004808 | 3300005843 | Bacteria | 13752 |
| 124 | Ga0068860_100011979 | 3300005843 | Bacteria | 8543 |
| 125 | Ga0068860_100091904 | 3300005843 | Bacteria | 2891 |
| 126 | Ga0068860_100138622 | 3300005843 | Bacteria | 2337 |
| 127 | Ga0068860_100352962 | 3300005843 | Bacteria | 1447 |
| 128 | Ga0068860_100536019 | 3300005843 | Bacteria | 1171 |
| 129 | Ga0068860_100832521 | 3300005843 | Bacteria | 937 |
| 130 | Ga0068862_100027133 | 3300005844 | Bacteria | 4819 |
| 131 | Ga0068862_100034244 | 3300005844 | Bacteria | 4296 |
| 132 | Ga0068862_100050180 | 3300005844 | Bacteria | 3565 |
| 133 | Ga0068862_100118197 | 3300005844 | Bacteria | 2334 |
| 134 | Ga0068862_100245188 | 3300005844 | Bacteria | 1631 |
| 135 | Ga0068862_100272594 | 3300005844 | Bacteria | 1548 |
| 136 | Ga0081539_10127382 | 3300005985 | Bacteria | 1256 |
| 137 | Ga0075368_10003446 | 3300006042 | Bacteria | 5281 |
| 138 | Ga0075367_10035836 | 3300006178 | Bacteria | 2874 |
| 139 | Ga0075369_10069329 | 3300006186 | Bacteria | 1550 |
| 140 | Ga0097621_100008005 | 3300006237 | Bacteria | 7587 |
| 141 | Ga0097621_100055936 | 3300006237 | Bacteria | 3222 |
| 142 | Ga0097621_100066231 | 3300006237 | Bacteria | 2975 |
| 143 | Ga0097621_100450904 | 3300006237 | Bacteria | 1159 |
| 144 | Ga0075370_10018238 | 3300006353 | Bacteria | 3806 |
| 145 | Ga0068871_100000834 | 3300006358 | Bacteria | 20645 |
| 146 | Ga0068871_100007397 | 3300006358 | Bacteria | 7841 |
| 147 | Ga0068871_100216817 | 3300006358 | Bacteria | 1657 |
| 148 | Ga0068871_100223182 | 3300006358 | Bacteria | 1633 |
| 149 | Ga0075428_100000602 | 3300006844 | Bacteria | 36732 |
| 150 | Ga0075428_100157357 | 3300006844 | Bacteria | 2467 |
| 151 | Ga0075428_100530836 | 3300006844 | Bacteria | 1258 |
| 152 | Ga0075430_100018438 | 3300006846 | Bacteria | 5938 |
| 153 | Ga0075431_100008190 | 3300006847 | Bacteria | 10445 |
| 154 | Ga0075431_100065119 | 3300006847 | Bacteria | 3763 |
| 155 | Ga0075433_10005230 | 3300006852 | Bacteria | 10170 |
| 156 | Ga0075433_10005479 | 3300006852 | Bacteria | 9971 |
| 157 | Ga0075433_10540591 | 3300006852 | Bacteria | 1025 |
| 158 | Ga0075434_100010081 | 3300006871 | Bacteria | 8848 |
| 159 | Ga0075434_100035645 | 3300006871 | Bacteria | 4919 |
| 160 | Ga0075434_100085157 | 3300006871 | Bacteria | 3160 |
| 161 | Ga0075434_100087823 | 3300006871 | Bacteria | 3111 |
| 162 | Ga0075434_100244727 | 3300006871 | Bacteria | 1813 |
| 163 | Ga0075434_100247992 | 3300006871 | Bacteria | 1800 |
| 164 | Ga0075434_100648714 | 3300006871 | Bacteria | 1074 |
| 165 | Ga0075429_100002384 | 3300006880 | Bacteria | 15832 |
| 166 | Ga0075429_100175665 | 3300006880 | Bacteria | 1876 |
| 167 | Ga0068865_100051778 | 3300006881 | Bacteria | 2843 |
| 168 | Ga0068865_100245756 | 3300006881 | Bacteria | 1410 |
| 169 | Ga0075436_100000364 | 3300006914 | Bacteria | 28914 |
| 170 | Ga0075436_100002227 | 3300006914 | Bacteria | 13395 |
| 171 | Ga0075436_100022540 | 3300006914 | Bacteria | 4325 |
| 172 | Ga0075436_100066204 | 3300006914 | Bacteria | 2497 |
| 173 | Ga0097620_100001633 | 3300006931 | Bacteria | 22912 |
| 174 | Ga0097620_100050936 | 3300006931 | Bacteria | 4161 |
| 175 | Ga0097620_100063116 | 3300006931 | Bacteria | 3735 |
| 176 | Ga0097620_100083685 | 3300006931 | Bacteria | 3234 |
| 177 | Ga0097620_100216535 | 3300006931 | Bacteria | 2002 |
| 178 | Ga0097620_100486419 | 3300006931 | Bacteria | 1329 |
| 179 | Ga0075435_100000438 | 3300007076 | Bacteria | 25453 |
| 180 | Ga0075435_100018242 | 3300007076 | Bacteria | 5330 |
| 181 | Ga0075435_100504794 | 3300007076 | Bacteria | 1046 |
| 182 | Ga0105251_10086280 | 3300009011 | Bacteria | 1446 |
| 183 | Ga0105240_10146257 | 3300009093 | Bacteria | 2820 |
| 184 | Ga0105240_10693701 | 3300009093 | Bacteria | 1112 |
| 185 | Ga0111539_10003451 | 3300009094 | Bacteria | 20821 |
| 186 | Ga0111539_10054814 | 3300009094 | Bacteria | 4742 |
| 187 | Ga0111539_10182697 | 3300009094 | Bacteria | 2449 |
| 188 | Ga0105245_10000944 | 3300009098 | Bacteria | 26426 |
| 189 | Ga0105245_10402157 | 3300009098 | Bacteria | 1369 |
| 190 | Ga0114129_10001652 | 3300009147 | Bacteria | 30334 |
| 191 | Ga0114129_10036182 | 3300009147 | Bacteria | 6972 |
| 192 | Ga0114129_10239171 | 3300009147 | Bacteria | 2441 |
| 193 | Ga0114129_10526922 | 3300009147 | Bacteria | 1540 |
| 194 | Ga0114129_10762918 | 3300009147 | Bacteria | 1237 |
| 195 | Ga0105243_10000576 | 3300009148 | Bacteria | 36922 |
| 196 | Ga0105243_10019715 | 3300009148 | Bacteria | 5114 |
| 197 | Ga0105243_10311362 | 3300009148 | Bacteria | 1431 |
| 198 | Ga0105243_10335026 | 3300009148 | Bacteria | 1384 |
| 199 | Ga0105243_10736124 | 3300009148 | Bacteria | 965 |
| 200 | Ga0105242_10101892 | 3300009176 | Bacteria | 2434 |
| 201 | Ga0105242_10145836 | 3300009176 | Bacteria | 2059 |
| 202 | Ga0105248_10017795 | 3300009177 | Bacteria | 7842 |
| 203 | Ga0105248_10056706 | 3300009177 | Bacteria | 4395 |
| 204 | Ga0105248_10070234 | 3300009177 | Bacteria | 3933 |
| 205 | Ga0105248_10337262 | 3300009177 | Bacteria | 1697 |
| 206 | Ga0105248_10555250 | 3300009177 | Bacteria | 1296 |
| 207 | Ga0105249_10108380 | 3300009553 | Bacteria | 2622 |
| 208 | Ga0105249_10421148 | 3300009553 | Bacteria | 1369 |
| 209 | Ga0105239_10027181 | 3300010375 | Bacteria | 6298 |
| 210 | Ga0157374_10003813 | 3300013296 | Bacteria | 12661 |
| 211 | Ga0157374_10153023 | 3300013296 | Bacteria | 2243 |
| 212 | Ga0157378_10007092 | 3300013297 | Bacteria | 9785 |
| 213 | Ga0157378_10073830 | 3300013297 | Bacteria | 3067 |
| 214 | Ga0157378_10110726 | 3300013297 | Bacteria | 2517 |
| 215 | Ga0163162_10003831 | 3300013306 | Bacteria | 14422 |
| 216 | Ga0163162_10018668 | 3300013306 | Bacteria | 6794 |
| 217 | Ga0163162_10158115 | 3300013306 | Bacteria | 2387 |
| 218 | Ga0163162_10173898 | 3300013306 | Bacteria | 2278 |
| 219 | Ga0157372_10338025 | 3300013307 | Bacteria | 1754 |
| 220 | Ga0157375_10003753 | 3300013308 | Bacteria | 13176 |
| 221 | Ga0157375_10005930 | 3300013308 | Bacteria | 10648 |
| 222 | Ga0157375_10135518 | 3300013308 | Bacteria | 2586 |
| 223 | Ga0157375_10257872 | 3300013308 | Bacteria | 1905 |
| 224 | Ga0157375_10352924 | 3300013308 | Bacteria | 1636 |
| 225 | Ga0163163_10014074 | 3300014325 | Bacteria | 7345 |
| 226 | Ga0163163_10038318 | 3300014325 | Bacteria | 4671 |
| 227 | Ga0163163_10484347 | 3300014325 | Bacteria | 1298 |
| 228 | Ga0157380_10098924 | 3300014326 | Bacteria | 2424 |
| 229 | Ga0157380_10132403 | 3300014326 | Bacteria | 2129 |
| 230 | Ga0157380_10167084 | 3300014326 | Bacteria | 1918 |
| 231 | Ga0157377_10058515 | 3300014745 | Bacteria | 2195 |
| 232 | Ga0157379_10000858 | 3300014968 | Bacteria | 24649 |
| 233 | Ga0157379_10028643 | 3300014968 | Bacteria | 4954 |
| 234 | Ga0157379_10040595 | 3300014968 | Bacteria | 4154 |
| 235 | Ga0157379_10104870 | 3300014968 | Bacteria | 2537 |
| 236 | Ga0157376_10000797 | 3300014969 | Bacteria | 20664 |
| 237 | Ga0157376_10000986 | 3300014969 | Bacteria | 18545 |
| 238 | Ga0157376_10046493 | 3300014969 | Bacteria | 3579 |
| 239 | Ga0157376_10136174 | 3300014969 | Bacteria | 2198 |
| 240 | Ga0163161_10022856 | 3300017792 | Bacteria | 4406 |
| 241 | Ga0163161_10050915 | 3300017792 | Bacteria | 2998 |
| 242 | Ga0163161_10298116 | 3300017792 | Bacteria | 1269 |
| 243 | Ga0207697_10051367 | 3300025315 | Bacteria | 1704 |
| 244 | Ga0207642_10013333 | 3300025899 | Bacteria | 2997 |
| 245 | Ga0207642_10045055 | 3300025899 | Bacteria | 1956 |
| 246 | Ga0207645_10000157 | 3300025907 | Bacteria | 53374 |
| 247 | Ga0207643_10064236 | 3300025908 | Bacteria | 2101 |
| 248 | Ga0207684_10013485 | 3300025910 | Bacteria | 7070 |
| 249 | Ga0207695_10338316 | 3300025913 | Bacteria | 1393 |
| 250 | Ga0207671_10202282 | 3300025914 | Bacteria | 1551 |
| 251 | Ga0207660_10004806 | 3300025917 | Bacteria | 8789 |
| 252 | Ga0207662_10056537 | 3300025918 | Bacteria | 2343 |
| 253 | Ga0207662_10169022 | 3300025918 | Bacteria | 1401 |
| 254 | Ga0207662_10318559 | 3300025918 | Bacteria | 1038 |
| 255 | Ga0207649_10334165 | 3300025920 | Bacteria | 1117 |
| 256 | Ga0207652_10064194 | 3300025921 | Bacteria | 3177 |
| 257 | Ga0207646_10030223 | 3300025922 | Bacteria | 4914 |
| 258 | Ga0207681_10034153 | 3300025923 | Bacteria | 3341 |
| 259 | Ga0207681_10051406 | 3300025923 | Bacteria | 2792 |
| 260 | Ga0207681_10062517 | 3300025923 | Bacteria | 2564 |
| 261 | Ga0207681_10086435 | 3300025923 | Bacteria | 2228 |
| 262 | Ga0207681_10098674 | 3300025923 | Bacteria | 2102 |
| 263 | Ga0207681_10517196 | 3300025923 | Bacteria | 979 |
| 264 | Ga0207650_10005693 | 3300025925 | Bacteria | 8503 |
| 265 | Ga0207650_10023375 | 3300025925 | Bacteria | 4382 |
| 266 | Ga0207650_10082918 | 3300025925 | Bacteria | 2435 |
| 267 | Ga0207650_10115176 | 3300025925 | Bacteria | 2086 |
| 268 | Ga0207650_10274734 | 3300025925 | Bacteria | 1370 |
| 269 | Ga0207659_10006435 | 3300025926 | Bacteria | 7196 |
| 270 | Ga0207659_10014554 | 3300025926 | Bacteria | 5078 |
| 271 | Ga0207687_10028966 | 3300025927 | Bacteria | 3722 |
| 272 | Ga0207644_10012783 | 3300025931 | Bacteria | 5582 |
| 273 | Ga0207644_10019823 | 3300025931 | Bacteria | 4566 |
| 274 | Ga0207706_10046268 | 3300025933 | Bacteria | 3853 |
| 275 | Ga0207706_10184281 | 3300025933 | Bacteria | 1833 |
| 276 | Ga0207706_10196785 | 3300025933 | Bacteria | 1768 |
| 277 | Ga0207686_10029754 | 3300025934 | Bacteria | 3226 |
| 278 | Ga0207686_10100126 | 3300025934 | Bacteria | 1933 |
| 279 | Ga0207709_10000515 | 3300025935 | Bacteria | 33987 |
| 280 | Ga0207709_10011114 | 3300025935 | Bacteria | 4964 |
| 281 | Ga0207670_10041021 | 3300025936 | Bacteria | 3041 |
| 282 | Ga0207669_10047016 | 3300025937 | Bacteria | 2553 |
| 283 | Ga0207669_10421061 | 3300025937 | Bacteria | 1051 |
| 284 | Ga0207669_10453032 | 3300025937 | Bacteria | 1017 |
| 285 | Ga0207704_10022926 | 3300025938 | Bacteria | 3355 |
| 286 | Ga0207704_10102093 | 3300025938 | Bacteria | 1915 |
| 287 | Ga0207704_10147208 | 3300025938 | Bacteria | 1656 |
| 288 | Ga0207704_10304627 | 3300025938 | Bacteria | 1222 |
| 289 | Ga0207665_10434923 | 3300025939 | Bacteria | 1004 |
| 290 | Ga0207691_10000249 | 3300025940 | Bacteria | 53276 |
| 291 | Ga0207691_10006443 | 3300025940 | Bacteria | 11337 |
| 292 | Ga0207691_10017092 | 3300025940 | Bacteria | 6882 |
| 293 | Ga0207691_10023580 | 3300025940 | Bacteria | 5794 |
| 294 | Ga0207711_10026251 | 3300025941 | Bacteria | 4887 |
| 295 | Ga0207711_10058461 | 3300025941 | Bacteria | 3318 |
| 296 | Ga0207711_10286932 | 3300025941 | Bacteria | 1516 |
| 297 | Ga0207689_10001166 | 3300025942 | Bacteria | 25290 |
| 298 | Ga0207689_10009790 | 3300025942 | Bacteria | 8258 |
| 299 | Ga0207689_10069117 | 3300025942 | Bacteria | 2902 |
| 300 | Ga0207679_10032761 | 3300025945 | Bacteria | 3652 |
| 301 | Ga0207679_10546825 | 3300025945 | Bacteria | 1038 |
| 302 | Ga0207667_10498472 | 3300025949 | Bacteria | 1235 |
| 303 | Ga0207651_10018887 | 3300025960 | Bacteria | 4116 |
| 304 | Ga0207651_10074685 | 3300025960 | Bacteria | 2415 |
| 305 | Ga0207651_10393557 | 3300025960 | Bacteria | 1177 |
| 306 | Ga0207712_10022600 | 3300025961 | Unclassified | 4143 |
| 307 | Ga0207668_10004378 | 3300025972 | Bacteria | 8295 |
| 308 | Ga0207668_10024536 | 3300025972 | Bacteria | 3893 |
| 309 | Ga0207668_10091756 | 3300025972 | Bacteria | 2233 |
| 310 | Ga0207668_10094552 | 3300025972 | Bacteria | 2204 |
| 311 | Ga0207668_10248535 | 3300025972 | Bacteria | 1443 |
| 312 | Ga0207640_10053609 | 3300025981 | Bacteria | 2633 |
| 313 | Ga0207640_10197883 | 3300025981 | Bacteria | 1520 |
| 314 | Ga0207658_10093160 | 3300025986 | Bacteria | 2342 |
| 315 | Ga0207677_10058613 | 3300026023 | Bacteria | 2652 |
| 316 | Ga0207677_10201663 | 3300026023 | Bacteria | 1582 |
| 317 | Ga0207703_10002253 | 3300026035 | Bacteria | 16857 |
| 318 | Ga0207703_10002446 | 3300026035 | Bacteria | 16111 |
| 319 | Ga0207703_10021879 | 3300026035 | Bacteria | 5007 |
| 320 | Ga0207703_10023868 | 3300026035 | Bacteria | 4809 |
| 321 | Ga0207703_10120015 | 3300026035 | Bacteria | 2256 |
| 322 | Ga0207703_10288732 | 3300026035 | Bacteria | 1492 |
| 323 | Ga0207703_10369916 | 3300026035 | Bacteria | 1324 |
| 324 | Ga0207639_10041011 | 3300026041 | Bacteria | 3460 |
| 325 | Ga0207678_10123279 | 3300026067 | Bacteria | 2211 |
| 326 | Ga0207708_10012396 | 3300026075 | Bacteria | 6354 |
| 327 | Ga0207708_10064825 | 3300026075 | Bacteria | 2792 |
| 328 | Ga0207708_10425440 | 3300026075 | Bacteria | 1102 |
| 329 | Ga0207702_10066725 | 3300026078 | Bacteria | 3085 |
| 330 | Ga0207641_10000374 | 3300026088 | Bacteria | 53088 |
| 331 | Ga0207641_10033047 | 3300026088 | Bacteria | 4298 |
| 332 | Ga0207641_10203479 | 3300026088 | Bacteria | 1827 |
| 333 | Ga0207641_10407038 | 3300026088 | Bacteria | 1307 |
| 334 | Ga0207641_10490734 | 3300026088 | Bacteria | 1191 |
| 335 | Ga0207648_10000523 | 3300026089 | Bacteria | 42961 |
| 336 | Ga0207648_10013639 | 3300026089 | Bacteria | 7544 |
| 337 | Ga0207648_10021215 | 3300026089 | Bacteria | 5839 |
| 338 | Ga0207648_10121188 | 3300026089 | Bacteria | 2300 |
| 339 | Ga0207648_10229450 | 3300026089 | Bacteria | 1651 |
| 340 | Ga0207648_10432299 | 3300026089 | Bacteria | 1197 |
| 341 | Ga0207676_10001665 | 3300026095 | Bacteria | 16379 |
| 342 | Ga0207676_10008789 | 3300026095 | Bacteria | 7187 |
| 343 | Ga0207676_10016930 | 3300026095 | Bacteria | 5279 |
| 344 | Ga0207676_10161167 | 3300026095 | Bacteria | 1943 |
| 345 | Ga0207675_100000564 | 3300026118 | Bacteria | 36294 |
| 346 | Ga0207675_100024242 | 3300026118 | Bacteria | 5642 |
| 347 | Ga0207675_100040177 | 3300026118 | Bacteria | 4367 |
| 348 | Ga0207675_100108631 | 3300026118 | Bacteria | 2616 |
| 349 | Ga0207675_100615189 | 3300026118 | Bacteria | 1090 |
| 350 | Ga0207683_10000476 | 3300026121 | Bacteria | 37318 |
| 351 | Ga0207683_10038039 | 3300026121 | Bacteria | 4191 |
| 352 | Ga0207683_10040510 | 3300026121 | Bacteria | 4065 |
| 353 | Ga0207683_10044604 | 3300026121 | Bacteria | 3876 |
| 354 | Ga0207683_10372961 | 3300026121 | Bacteria | 1311 |
| 355 | Ga0207698_10171437 | 3300026142 | Bacteria | 1911 |
| 356 | Ga0207698_10479790 | 3300026142 | Bacteria | 1206 |
| 357 | Ga0209982_1009593 | 3300027552 | Bacteria | 1432 |
| 358 | Ga0209983_1004525 | 3300027665 | Bacteria | 2918 |
| 359 | Ga0209971_1024395 | 3300027682 | Bacteria | 1444 |
| 360 | Ga0209974_10000388 | 3300027876 | Bacteria | 14607 |
| 361 | Ga0209974_10009103 | 3300027876 | Bacteria | 3374 |
| 362 | Ga0207428_10002128 | 3300027907 | Bacteria | 19921 |
| 363 | Ga0268266_10004526 | 3300028379 | Bacteria | 13283 |
| 364 | Ga0268266_10313817 | 3300028379 | Bacteria | 1465 |
| 365 | Ga0268266_10338513 | 3300028379 | Bacteria | 1412 |
| 366 | Ga0268265_10004995 | 3300028380 | Bacteria | 9105 |
| 367 | Ga0268265_10024395 | 3300028380 | Unclassified | 4277 |
| 368 | Ga0268265_10072810 | 3300028380 | Bacteria | 2681 |
| 369 | Ga0268265_10084594 | 3300028380 | Bacteria | 2515 |
| 370 | Ga0268265_10623173 | 3300028380 | Bacteria | 1034 |
| 371 | Ga0268264_10007867 | 3300028381 | Bacteria | 8871 |
| 372 | Ga0268264_10008187 | 3300028381 | Bacteria | 8681 |
| 373 | Ga0268264_10034214 | 3300028381 | Bacteria | 4178 |
| 374 | Ga0268264_10111092 | 3300028381 | Bacteria | 2401 |
| 375 | Ga0268264_10311816 | 3300028381 | Bacteria | 1485 |
| 376 | Ga0268264_10505696 | 3300028381 | Bacteria | 1179 |
| 377 | Ga0265327_10028220 | 3300031251 | Bacteria | 3214 |
| 378 | Ga0307408_100605125 | 3300031548 | Bacteria | 974 |
| 379 | Ga0307413_10066343 | 3300031824 | Bacteria | 2252 |
| 380 | Ga0373950_0023477 | 3300034818 | Bacteria | 1103 |
| 381 | Ga0373958_0006595 | 3300034819 | Bacteria | 1815 |
| 382 | Ga0373928_0003811 | 3300035084 | Bacteria | 2876 |
| 383 | Ga0373929_0015039 | 3300035085 | Bacteria | 1502 |
| 384 | Ga0373923_0038221 | 3300035111 | Bacteria | 1966 |
| 385 | Ga0373932_0013232 | 3300035112 | Bacteria | 2047 |
| 386 | Ga0373936_0010494 | 3300035113 | Bacteria | 3495 |
| 387 | Ga0373939_0035897 | 3300035114 | Bacteria | 1463 |
| 388 | Ga0373945_0001129 | 3300035116 | Bacteria | 8075 |
| 389 | Ga0373943_0195502 | 3300035170 | Bacteria | 1117 |
| 390 | Ga0373931_0009521 | 3300035691 | Bacteria | 4645 |
| 391 | Ga0373931_0032500 | 3300035691 | Bacteria | 2700 |
| 392 | Ga0373931_0056573 | 3300035691 | Bacteria | 2102 |
| 393 | Ga0373935_0020681 | 3300035692 | Bacteria | 4023 |
| 394 | Ga0373935_0148764 | 3300035692 | Bacteria | 1587 |
| 395 | Ga0373927_0336980 | 3300035695 | Bacteria | 993 |
| 396 | Ga0373947_0006859 | 3300035725 | Bacteria | 6604 |
| 397 | Ga0373937_0158684 | 3300036401 | Bacteria | 2120 |
| 398 | Ga0373925_0223018 | 3300037068 | Bacteria | 1505 |
| 399 | Ga0451577_0145267 | 3300042876 | Bacteria | 2132 |
| 400 | Ga0451577_0389925 | 3300042876 | Bacteria | 1264 |
| 401 | Ga0451576_0296510 | 3300045051 | Bacteria | 1690 |
| 402 | Ga0495580_0002018 | 3300046472 | Bacteria | 17865 |
| 403 | Ga0495666_0008870 | 3300046526 | Bacteria | 5037 |
| 404 | Ga0495665_0012134 | 3300046531 | Bacteria | 4666 |
| 405 | Ga0495621_0059346 | 3300046539 | Bacteria | 1386 |
| 406 | Ga0495647_0002247 | 3300046681 | Bacteria | 6056 |
| 407 | Ga0495676_0117597 | 3300047321 | Bacteria | 1939 |
| 408 | Ga0496102_0470292 | 3300048905 | Bacteria | 1178 |
| 409 | Ga0496104_0398469 | 3300048907 | Bacteria | 1289 |
| 410 | Ga0496106_0085071 | 3300048909 | Bacteria | 2434 |
| 411 | Ga0496112_0012289 | 3300048915 | Bacteria | 7863 |
| 412 | Ga0496113_0169277 | 3300048916 | Bacteria | 1730 |
| 413 | Ga0501036_0704522 | 3300049572 | Bacteria | 834 |
| 414 | Ga0501038_0251364 | 3300049574 | Bacteria | 1400 |
| 415 | Ga0501039_0292174 | 3300049575 | Bacteria | 1281 |
| 416 | Ga0501040_0003556 | 3300049576 | Bacteria | 10074 |
| 417 | Ga0501042_0027494 | 3300049578 | Bacteria | 4000 |
| 418 | Ga0501047_0534844 | 3300049581 | Bacteria | 997 |
| 419 | Ga0501048_0020006 | 3300049582 | Bacteria | 4910 |
| 420 | Ga0501071_0031121 | 3300049587 | Bacteria | 3780 |
| 421 | Ga0501072_0261436 | 3300049588 | Bacteria | 1377 |
| 422 | Ga0501073_0174509 | 3300049589 | Bacteria | 1488 |
| 423 | Ga0501074_0302068 | 3300049590 | Bacteria | 1137 |
| 424 | Ga0501075_0000740 | 3300049591 | Bacteria | 20286 |
| 425 | Ga0501076_0226369 | 3300049592 | Bacteria | 1528 |
| 426 | Ga0501080_0048109 | 3300049742 | Bacteria | 3970 |
| 427 | Ga0501080_0497501 | 3300049742 | Bacteria | 1090 |
| 428 | Ga0501081_0118012 | 3300049743 | Bacteria | 1887 |
| 429 | Ga0501081_0120592 | 3300049743 | Bacteria | 1867 |
| 430 | Ga0501083_0036465 | 3300049744 | Bacteria | 3354 |
| 431 | Ga0501035_0094929 | 3300049822 | Bacteria | 2622 |
| 432 | Ga0501045_0011981 | 3300049824 | Bacteria | 6095 |
| 433 | Ga0501045_0188883 | 3300049824 | Bacteria | 1535 |
| 434 | nmdc:mga07m45_11542_c1 | 3300050496 | Bacteria | 4646 |
| 435 | nmdc:mga05p37_198820_c1 | 3300050507 | Bacteria | 2429 |
| 436 | nmdc:mga05p37_2170_c1 | 3300050507 | Bacteria | 22883 |
| 437 | nmdc:mga05p37_302821_c1 | 3300050507 | Bacteria | 1898 |
| 438 | nmdc:mga09592_193_c1 | 3300050508 | Bacteria | 43770 |
| 439 | nmdc:mga09592_37120_c1 | 3300050508 | Bacteria | 4086 |
| 440 | nmdc:mga08y16_23077_c1 | 3300050511 | Bacteria | 6569 |
| 441 | nmdc:mga08y16_262_c1 | 3300050511 | Bacteria | 47546 |
| 442 | nmdc:mga08y16_514191_c1 | 3300050511 | Bacteria | 1215 |
| 443 | nmdc:mga0n895_124289_c1 | 3300050512 | Bacteria | 2603 |
| 444 | nmdc:mga0n895_232177_c1 | 3300050512 | Bacteria | 1872 |
| 445 | nmdc:mga0n895_39828_c1 | 3300050512 | Bacteria | 4563 |
| 446 | nmdc:mga0n895_53927_c1 | 3300050512 | Bacteria | 3953 |
| 447 | nmdc:mga0n895_696720_c1 | 3300050512 | Bacteria | 1012 |
| 448 | nmdc:mga0rr50_209962_c1 | 3300050513 | Bacteria | 1604 |
| 449 | nmdc:mga0rr50_262647_c1 | 3300050513 | Bacteria | 1437 |
| 450 | nmdc:mga08x19_14376_c1 | 3300050514 | Bacteria | 4800 |
| 451 | nmdc:mga08x19_1508_c1 | 3300050514 | Bacteria | 14424 |
| 452 | nmdc:mga08x19_27911_c1 | 3300050514 | Bacteria | 3532 |
| 453 | nmdc:mga08x19_55025_c1 | 3300050514 | Bacteria | 2563 |
| 454 | nmdc:mga0a205_111208_c1 | 3300050515 | Bacteria | 2638 |
| 455 | nmdc:mga0a205_1117_c1 | 3300050515 | Bacteria | 22221 |
| 456 | nmdc:mga0a205_207545_c1 | 3300050515 | Bacteria | 1848 |
| 457 | nmdc:mga0a205_22451_c1 | 3300050515 | Bacteria | 5978 |
| 458 | nmdc:mga0a205_341336_c1 | 3300050515 | Bacteria | 1366 |
| 459 | Ga0500616_0081761 | 3300053153 | Bacteria | 1622 |
| 460 | Ga0501084_0037861 | 3300054114 | Bacteria | 4031 |
| 461 | Ga0501082_0006109 | 3300060353 | Bacteria | 10454 |
| 462 | Ga0530510_0004686 | 3300061734 | Bacteria | 9460 |
| 463 | Ga0530510_0222571 | 3300061734 | Bacteria | 1403 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005330 | Ga0070690_100287628 | Ga0070690_1002876281 | 239 |
| 2 | 3300005340 | Ga0070689_100035324 | Ga0070689_1000353242 | 239 |
| 3 | 3300005354 | Ga0070675_100580603 | Ga0070675_1005806031 | 239 |
| 4 | 3300005618 | Ga0068864_100839833 | Ga0068864_1008398331 | 239 |
| 5 | 3300005843 | Ga0068860_100536019 | Ga0068860_1005360192 | 239 |
| 6 | 3300005844 | Ga0068862_100027133 | Ga0068862_1000271331 | 239 |
| 7 | 3300006358 | Ga0068871_100223182 | Ga0068871_1002231822 | 239 |
| 8 | 3300013297 | Ga0157378_10073830 | Ga0157378_100738303 | 239 |
| 9 | 3300014326 | Ga0157380_10167084 | Ga0157380_101670842 | 239 |
| 10 | 3300025899 | Ga0207642_10045055 | Ga0207642_100450552 | 239 |
| 11 | 3300035114 | Ga0373939_0035897 | Ga0373939_0035897_727_1452 | 239 |
| 12 | 3300005456 | Ga0070678_100266690 | Ga0070678_1002666901 | 246 |
| 13 | 3300005459 | Ga0068867_100429930 | Ga0068867_1004299302 | 246 |
| 14 | 3300025908 | Ga0207643_10064236 | Ga0207643_100642362 | 246 |
| 15 | 3300025940 | Ga0207691_10017092 | Ga0207691_100170922 | 246 |
| 16 | 3300026088 | Ga0207641_10033047 | Ga0207641_100330473 | 246 |
| 17 | 3300026121 | Ga0207683_10038039 | Ga0207683_100380392 | 246 |
| 18 | 3300009147 | Ga0114129_10036182 | Ga0114129_100361823 | 248 |
| 19 | 3300050508 | nmdc:mga09592_37120_c1 | nmdc:mga09592_37120_c1_369_1115 | 248 |
| 20 | 3300027876 | Ga0209974_10009103 | Ga0209974_100091032 | 250 |
| 21 | 3300049590 | Ga0501074_0302068 | Ga0501074_0302068_370_1125 | 250 |
| 22 | 3300049572 | Ga0501036_0704522 | Ga0501036_0704522_37_795 | 251 |
| 23 | 3300006914 | Ga0075436_100000364 | Ga0075436_10000036428 | 253 |
| 24 | 3300007076 | Ga0075435_100504794 | Ga0075435_1005047942 | 253 |
| 25 | 3300050514 | nmdc:mga08x19_1508_c1 | nmdc:mga08x19_1508_c1_4913_5680 | 253 |
| 26 | 3300005295 | Ga0065707_10017671 | Ga0065707_100176713 | 254 |
| 27 | 3300005330 | Ga0070690_100000701 | Ga0070690_1000007013 | 254 |
| 28 | 3300005334 | Ga0068869_100000240 | Ga0068869_1000002403 | 254 |
| 29 | 3300005334 | Ga0068869_100039144 | Ga0068869_1000391444 | 254 |
| 30 | 3300005336 | Ga0070680_100002168 | Ga0070680_1000021687 | 254 |
| 31 | 3300005338 | Ga0068868_100000471 | Ga0068868_1000004713 | 254 |
| 32 | 3300005340 | Ga0070689_100000540 | Ga0070689_10000054019 | 254 |
| 33 | 3300005341 | Ga0070691_10001174 | Ga0070691_100011742 | 254 |
| 34 | 3300005343 | Ga0070687_100000416 | Ga0070687_1000004162 | 254 |
| 35 | 3300005364 | Ga0070673_100307305 | Ga0070673_1003073052 | 254 |
| 36 | 3300005438 | Ga0070701_10001283 | Ga0070701_100012833 | 254 |
| 37 | 3300005440 | Ga0070705_100001316 | Ga0070705_1000013165 | 254 |
| 38 | 3300005441 | Ga0070700_100005090 | Ga0070700_1000050906 | 254 |
| 39 | 3300005444 | Ga0070694_100000418 | Ga0070694_10000041819 | 254 |
| 40 | 3300005458 | Ga0070681_10137436 | Ga0070681_101374361 | 254 |
| 41 | 3300005459 | Ga0068867_100000442 | Ga0068867_10000044220 | 254 |
| 42 | 3300005536 | Ga0070697_100018516 | Ga0070697_1000185164 | 254 |
| 43 | 3300005544 | Ga0070686_100082250 | Ga0070686_1000822502 | 254 |
| 44 | 3300005545 | Ga0070695_100002769 | Ga0070695_1000027693 | 254 |
| 45 | 3300005547 | Ga0070693_100001954 | Ga0070693_1000019543 | 254 |
| 46 | 3300005549 | Ga0070704_100002922 | Ga0070704_1000029228 | 254 |
| 47 | 3300005578 | Ga0068854_100033950 | Ga0068854_1000339503 | 254 |
| 48 | 3300005614 | Ga0068856_100408970 | Ga0068856_1004089702 | 254 |
| 49 | 3300005615 | Ga0070702_100000090 | Ga0070702_10000009020 | 254 |
| 50 | 3300005615 | Ga0070702_100128753 | Ga0070702_1001287532 | 254 |
| 51 | 3300005616 | Ga0068852_100516969 | Ga0068852_1005169691 | 254 |
| 52 | 3300005617 | Ga0068859_100001633 | Ga0068859_1000016333 | 254 |
| 53 | 3300005617 | Ga0068859_100486400 | Ga0068859_1004864001 | 254 |
| 54 | 3300005618 | Ga0068864_100365432 | Ga0068864_1003654322 | 254 |
| 55 | 3300005718 | Ga0068866_10000485 | Ga0068866_1000048518 | 254 |
| 56 | 3300005719 | Ga0068861_100000853 | Ga0068861_1000008533 | 254 |
| 57 | 3300005840 | Ga0068870_10040353 | Ga0068870_100403533 | 254 |
| 58 | 3300005842 | Ga0068858_100031100 | Ga0068858_1000311005 | 254 |
| 59 | 3300005843 | Ga0068860_100011979 | Ga0068860_1000119793 | 254 |
| 60 | 3300005844 | Ga0068862_100245188 | Ga0068862_1002451882 | 254 |
| 61 | 3300006237 | Ga0097621_100055936 | Ga0097621_1000559363 | 254 |
| 62 | 3300006358 | Ga0068871_100007397 | Ga0068871_1000073973 | 254 |
| 63 | 3300006844 | Ga0075428_100000602 | Ga0075428_10000060213 | 254 |
| 64 | 3300006852 | Ga0075433_10005230 | Ga0075433_100052302 | 254 |
| 65 | 3300006871 | Ga0075434_100085157 | Ga0075434_1000851572 | 254 |
| 66 | 3300006880 | Ga0075429_100002384 | Ga0075429_1000023843 | 254 |
| 67 | 3300006881 | Ga0068865_100051778 | Ga0068865_1000517782 | 254 |
| 68 | 3300006914 | Ga0075436_100002227 | Ga0075436_10000222710 | 254 |
| 69 | 3300006931 | Ga0097620_100001633 | Ga0097620_1000016333 | 254 |
| 70 | 3300006931 | Ga0097620_100486419 | Ga0097620_1004864191 | 254 |
| 71 | 3300007076 | Ga0075435_100000438 | Ga0075435_1000004382 | 254 |
| 72 | 3300009093 | Ga0105240_10693701 | Ga0105240_106937012 | 254 |
| 73 | 3300009094 | Ga0111539_10003451 | Ga0111539_1000345117 | 254 |
| 74 | 3300009094 | Ga0111539_10054814 | Ga0111539_100548144 | 254 |
| 75 | 3300009098 | Ga0105245_10000944 | Ga0105245_100009442 | 254 |
| 76 | 3300009147 | Ga0114129_10001652 | Ga0114129_1000165211 | 254 |
| 77 | 3300009147 | Ga0114129_10239171 | Ga0114129_102391713 | 254 |
| 78 | 3300009148 | Ga0105243_10000576 | Ga0105243_100005763 | 254 |
| 79 | 3300009148 | Ga0105243_10736124 | Ga0105243_107361242 | 254 |
| 80 | 3300009176 | Ga0105242_10101892 | Ga0105242_101018922 | 254 |
| 81 | 3300009553 | Ga0105249_10108380 | Ga0105249_101083802 | 254 |
| 82 | 3300014745 | Ga0157377_10058515 | Ga0157377_100585152 | 254 |
| 83 | 3300014969 | Ga0157376_10000797 | Ga0157376_100007972 | 254 |
| 84 | 3300025899 | Ga0207642_10013333 | Ga0207642_100133332 | 254 |
| 85 | 3300025914 | Ga0207671_10202282 | Ga0207671_102022822 | 254 |
| 86 | 3300025917 | Ga0207660_10004806 | Ga0207660_100048064 | 254 |
| 87 | 3300025918 | Ga0207662_10056537 | Ga0207662_100565372 | 254 |
| 88 | 3300025918 | Ga0207662_10318559 | Ga0207662_103185592 | 254 |
| 89 | 3300025921 | Ga0207652_10064194 | Ga0207652_100641942 | 254 |
| 90 | 3300025923 | Ga0207681_10517196 | Ga0207681_105171961 | 254 |
| 91 | 3300025927 | Ga0207687_10028966 | Ga0207687_100289664 | 254 |
| 92 | 3300025934 | Ga0207686_10029754 | Ga0207686_100297543 | 254 |
| 93 | 3300025935 | Ga0207709_10000515 | Ga0207709_100005154 | 254 |
| 94 | 3300025936 | Ga0207670_10041021 | Ga0207670_100410213 | 254 |
| 95 | 3300025937 | Ga0207669_10421061 | Ga0207669_104210612 | 254 |
| 96 | 3300025938 | Ga0207704_10022926 | Ga0207704_100229262 | 254 |
| 97 | 3300025939 | Ga0207665_10434923 | Ga0207665_104349232 | 254 |
| 98 | 3300025942 | Ga0207689_10001166 | Ga0207689_1000116619 | 254 |
| 99 | 3300025942 | Ga0207689_10069117 | Ga0207689_100691174 | 254 |
| 100 | 3300025960 | Ga0207651_10393557 | Ga0207651_103935572 | 254 |
| 101 | 3300025981 | Ga0207640_10053609 | Ga0207640_100536093 | 254 |
| 102 | 3300026023 | Ga0207677_10201663 | Ga0207677_102016632 | 254 |
| 103 | 3300026035 | Ga0207703_10002446 | Ga0207703_1000244614 | 254 |
| 104 | 3300026075 | Ga0207708_10012396 | Ga0207708_100123962 | 254 |
| 105 | 3300026078 | Ga0207702_10066725 | Ga0207702_100667254 | 254 |
| 106 | 3300026089 | Ga0207648_10121188 | Ga0207648_101211882 | 254 |
| 107 | 3300026118 | Ga0207675_100000564 | Ga0207675_1000005642 | 254 |
| 108 | 3300027907 | Ga0207428_10002128 | Ga0207428_100021286 | 254 |
| 109 | 3300028381 | Ga0268264_10505696 | Ga0268264_105056962 | 254 |
| 110 | 3300031548 | Ga0307408_100605125 | Ga0307408_1006051252 | 254 |
| 111 | 3300034818 | Ga0373950_0023477 | Ga0373950_0023477_107_877 | 254 |
| 112 | 3300034819 | Ga0373958_0006595 | Ga0373958_0006595_216_986 | 254 |
| 113 | 3300035084 | Ga0373928_0003811 | Ga0373928_0003811_598_1368 | 254 |
| 114 | 3300035085 | Ga0373929_0015039 | Ga0373929_0015039_201_971 | 254 |
| 115 | 3300035111 | Ga0373923_0038221 | Ga0373923_0038221_600_1370 | 254 |
| 116 | 3300035112 | Ga0373932_0013232 | Ga0373932_0013232_640_1410 | 254 |
| 117 | 3300035113 | Ga0373936_0010494 | Ga0373936_0010494_1385_2155 | 254 |
| 118 | 3300035116 | Ga0373945_0001129 | Ga0373945_0001129_877_1671 | 254 |
| 119 | 3300035170 | Ga0373943_0195502 | Ga0373943_0195502_328_1098 | 254 |
| 120 | 3300035691 | Ga0373931_0032500 | Ga0373931_0032500_509_1279 | 254 |
| 121 | 3300035691 | Ga0373931_0056573 | Ga0373931_0056573_153_923 | 254 |
| 122 | 3300035692 | Ga0373935_0020681 | Ga0373935_0020681_1061_1855 | 254 |
| 123 | 3300035695 | Ga0373927_0336980 | Ga0373927_0336980_18_788 | 254 |
| 124 | 3300035725 | Ga0373947_0006859 | Ga0373947_0006859_4642_5412 | 254 |
| 125 | 3300042876 | Ga0451577_0145267 | Ga0451577_0145267_1207_1980 | 254 |
| 126 | 3300045051 | Ga0451576_0296510 | Ga0451576_0296510_54_848 | 254 |
| 127 | 3300046472 | Ga0495580_0002018 | Ga0495580_0002018_13349_14119 | 254 |
| 128 | 3300046526 | Ga0495666_0008870 | Ga0495666_0008870_3643_4413 | 254 |
| 129 | 3300046531 | Ga0495665_0012134 | Ga0495665_0012134_2526_3320 | 254 |
| 130 | 3300046539 | Ga0495621_0059346 | Ga0495621_0059346_17_787 | 254 |
| 131 | 3300046681 | Ga0495647_0002247 | Ga0495647_0002247_1874_2644 | 254 |
| 132 | 3300047321 | Ga0495676_0117597 | Ga0495676_0117597_894_1664 | 254 |
| 133 | 3300049742 | Ga0501080_0497501 | Ga0501080_0497501_118_888 | 254 |
| 134 | 3300050507 | nmdc:mga05p37_2170_c1 | nmdc:mga05p37_2170_c1_10515_11285 | 254 |
| 135 | 3300050508 | nmdc:mga09592_193_c1 | nmdc:mga09592_193_c1_29600_30370 | 254 |
| 136 | 3300050511 | nmdc:mga08y16_23077_c1 | nmdc:mga08y16_23077_c1_5446_6216 | 254 |
| 137 | 3300050511 | nmdc:mga08y16_262_c1 | nmdc:mga08y16_262_c1_24020_24790 | 254 |
| 138 | 3300050512 | nmdc:mga0n895_53927_c1 | nmdc:mga0n895_53927_c1_221_991 | 254 |
| 139 | 3300050513 | nmdc:mga0rr50_209962_c1 | nmdc:mga0rr50_209962_c1_614_1384 | 254 |
| 140 | 3300050514 | nmdc:mga08x19_14376_c1 | nmdc:mga08x19_14376_c1_2272_3042 | 254 |
| 141 | 3300050515 | nmdc:mga0a205_1117_c1 | nmdc:mga0a205_1117_c1_18288_19058 | 254 |
| 142 | 3300050515 | nmdc:mga0a205_341336_c1 | nmdc:mga0a205_341336_c1_89_859 | 254 |
| 143 | iso_pu_bacteria | 2821443989 | 2821448462 | 257 |
| 144 | 3300005355 | Ga0070671_100010289 | Ga0070671_1000102893 | 258 |
| 145 | 3300005543 | Ga0070672_100014087 | Ga0070672_1000140872 | 258 |
| 146 | 3300005843 | Ga0068860_100352962 | Ga0068860_1003529622 | 258 |
| 147 | 3300025933 | Ga0207706_10046268 | Ga0207706_100462684 | 258 |
| 148 | 3300025940 | Ga0207691_10023580 | Ga0207691_100235802 | 258 |
| 149 | 3300025945 | Ga0207679_10032761 | Ga0207679_100327613 | 258 |
| 150 | 3300026035 | Ga0207703_10120015 | Ga0207703_101200152 | 258 |
| 151 | 3300026142 | Ga0207698_10171437 | Ga0207698_101714372 | 258 |
| 152 | 3300027552 | Ga0209982_1009593 | Ga0209982_10095932 | 258 |
| 153 | 3300027665 | Ga0209983_1004525 | Ga0209983_10045253 | 258 |
| 154 | 3300027682 | Ga0209971_1024395 | Ga0209971_10243952 | 258 |
| 155 | 3300027876 | Ga0209974_10000388 | Ga0209974_1000038810 | 258 |
| 156 | 3300048907 | Ga0496104_0398469 | Ga0496104_0398469_295_1074 | 258 |
| 157 | 3300048909 | Ga0496106_0085071 | Ga0496106_0085071_1555_2331 | 258 |
| 158 | 3300006871 | Ga0075434_100247992 | Ga0075434_1002479923 | 259 |
| 159 | 3300013307 | Ga0157372_10338025 | Ga0157372_103380252 | 259 |
| 160 | 3300031824 | Ga0307413_10066343 | Ga0307413_100663432 | 259 |
| 161 | 3300050512 | nmdc:mga0n895_232177_c1 | nmdc:mga0n895_232177_c1_309_1088 | 259 |
| 162 | 3300005356 | Ga0070674_100163424 | Ga0070674_1001634242 | 260 |
| 163 | 3300005364 | Ga0070673_100092350 | Ga0070673_1000923501 | 260 |
| 164 | 3300005367 | Ga0070667_100004919 | Ga0070667_1000049197 | 260 |
| 165 | 3300005367 | Ga0070667_100037796 | Ga0070667_1000377962 | 260 |
| 166 | 3300005456 | Ga0070678_100024961 | Ga0070678_1000249613 | 260 |
| 167 | 3300005459 | Ga0068867_100387442 | Ga0068867_1003874421 | 260 |
| 168 | 3300005468 | Ga0070707_100740903 | Ga0070707_1007409032 | 260 |
| 169 | 3300005543 | Ga0070672_100013687 | Ga0070672_1000136874 | 260 |
| 170 | 3300005548 | Ga0070665_100013659 | Ga0070665_1000136594 | 260 |
| 171 | 3300005577 | Ga0068857_100046789 | Ga0068857_1000467891 | 260 |
| 172 | 3300005617 | Ga0068859_100083674 | Ga0068859_1000836742 | 260 |
| 173 | 3300005618 | Ga0068864_100550979 | Ga0068864_1005509792 | 260 |
| 174 | 3300005843 | Ga0068860_100832521 | Ga0068860_1008325212 | 260 |
| 175 | 3300005985 | Ga0081539_10127382 | Ga0081539_101273822 | 260 |
| 176 | 3300006847 | Ga0075431_100008190 | Ga0075431_1000081902 | 260 |
| 177 | 3300006931 | Ga0097620_100083685 | Ga0097620_1000836852 | 260 |
| 178 | 3300009147 | Ga0114129_10526922 | Ga0114129_105269222 | 260 |
| 179 | 3300009177 | Ga0105248_10056706 | Ga0105248_100567061 | 260 |
| 180 | 3300013296 | Ga0157374_10153023 | Ga0157374_101530233 | 260 |
| 181 | 3300013308 | Ga0157375_10135518 | Ga0157375_101355182 | 260 |
| 182 | 3300013308 | Ga0157375_10257872 | Ga0157375_102578721 | 260 |
| 183 | 3300014325 | Ga0163163_10014074 | Ga0163163_100140744 | 260 |
| 184 | 3300014968 | Ga0157379_10040595 | Ga0157379_100405951 | 260 |
| 185 | 3300014969 | Ga0157376_10136174 | Ga0157376_101361743 | 260 |
| 186 | 3300025918 | Ga0207662_10169022 | Ga0207662_101690222 | 260 |
| 187 | 3300025923 | Ga0207681_10086435 | Ga0207681_100864351 | 260 |
| 188 | 3300025925 | Ga0207650_10082918 | Ga0207650_100829182 | 260 |
| 189 | 3300025933 | Ga0207706_10196785 | Ga0207706_101967852 | 260 |
| 190 | 3300025938 | Ga0207704_10102093 | Ga0207704_101020931 | 260 |
| 191 | 3300025938 | Ga0207704_10304627 | Ga0207704_103046271 | 260 |
| 192 | 3300025941 | Ga0207711_10286932 | Ga0207711_102869322 | 260 |
| 193 | 3300025945 | Ga0207679_10546825 | Ga0207679_105468251 | 260 |
| 194 | 3300025960 | Ga0207651_10074685 | Ga0207651_100746853 | 260 |
| 195 | 3300025972 | Ga0207668_10248535 | Ga0207668_102485351 | 260 |
| 196 | 3300026035 | Ga0207703_10023868 | Ga0207703_100238682 | 260 |
| 197 | 3300026035 | Ga0207703_10369916 | Ga0207703_103699162 | 260 |
| 198 | 3300026088 | Ga0207641_10407038 | Ga0207641_104070382 | 260 |
| 199 | 3300026089 | Ga0207648_10021215 | Ga0207648_100212151 | 260 |
| 200 | 3300026095 | Ga0207676_10161167 | Ga0207676_101611672 | 260 |
| 201 | 3300026121 | Ga0207683_10040510 | Ga0207683_100405103 | 260 |
| 202 | 3300028379 | Ga0268266_10313817 | Ga0268266_103138172 | 260 |
| 203 | 3300028380 | Ga0268265_10004995 | Ga0268265_100049951 | 260 |
| 204 | 3300028381 | Ga0268264_10034214 | Ga0268264_100342142 | 260 |
| 205 | 3300035692 | Ga0373935_0148764 | Ga0373935_0148764_768_1577 | 260 |
| 206 | 3300037068 | Ga0373925_0223018 | Ga0373925_0223018_697_1479 | 260 |
| 207 | 3300048905 | Ga0496102_0470292 | Ga0496102_0470292_297_1079 | 260 |
| 208 | 3300005293 | Ga0065715_10111531 | Ga0065715_101115312 | 261 |
| 209 | 3300005328 | Ga0070676_10330853 | Ga0070676_103308532 | 261 |
| 210 | 3300005330 | Ga0070690_100049474 | Ga0070690_1000494742 | 261 |
| 211 | 3300005331 | Ga0070670_100014823 | Ga0070670_1000148232 | 261 |
| 212 | 3300005331 | Ga0070670_100077764 | Ga0070670_1000777642 | 261 |
| 213 | 3300005331 | Ga0070670_100165509 | Ga0070670_1001655092 | 261 |
| 214 | 3300005331 | Ga0070670_100236372 | Ga0070670_1002363722 | 261 |
| 215 | 3300005334 | Ga0068869_100004298 | Ga0068869_1000042983 | 261 |
| 216 | 3300005335 | Ga0070666_10085117 | Ga0070666_100851172 | 261 |
| 217 | 3300005336 | Ga0070680_100351406 | Ga0070680_1003514062 | 261 |
| 218 | 3300005338 | Ga0068868_100011298 | Ga0068868_1000112985 | 261 |
| 219 | 3300005340 | Ga0070689_100300577 | Ga0070689_1003005772 | 261 |
| 220 | 3300005344 | Ga0070661_100421558 | Ga0070661_1004215582 | 261 |
| 221 | 3300005347 | Ga0070668_100001341 | Ga0070668_10000134110 | 261 |
| 222 | 3300005347 | Ga0070668_100013667 | Ga0070668_1000136672 | 261 |
| 223 | 3300005347 | Ga0070668_100362326 | Ga0070668_1003623261 | 261 |
| 224 | 3300005353 | Ga0070669_100000668 | Ga0070669_1000006684 | 261 |
| 225 | 3300005353 | Ga0070669_100046538 | Ga0070669_1000465383 | 261 |
| 226 | 3300005353 | Ga0070669_100198613 | Ga0070669_1001986131 | 261 |
| 227 | 3300005353 | Ga0070669_100279268 | Ga0070669_1002792682 | 261 |
| 228 | 3300005353 | Ga0070669_100281900 | Ga0070669_1002819001 | 261 |
| 229 | 3300005354 | Ga0070675_100001258 | Ga0070675_10000125815 | 261 |
| 230 | 3300005354 | Ga0070675_100051570 | Ga0070675_1000515702 | 261 |
| 231 | 3300005355 | Ga0070671_100092362 | Ga0070671_1000923622 | 261 |
| 232 | 3300005364 | Ga0070673_100015219 | Ga0070673_1000152195 | 261 |
| 233 | 3300005365 | Ga0070688_100038958 | Ga0070688_1000389583 | 261 |
| 234 | 3300005367 | Ga0070667_100005264 | Ga0070667_1000052646 | 261 |
| 235 | 3300005367 | Ga0070667_100095033 | Ga0070667_1000950332 | 261 |
| 236 | 3300005441 | Ga0070700_100496299 | Ga0070700_1004962991 | 261 |
| 237 | 3300005444 | Ga0070694_100022197 | Ga0070694_1000221974 | 261 |
| 238 | 3300005444 | Ga0070694_100229579 | Ga0070694_1002295792 | 261 |
| 239 | 3300005445 | Ga0070708_100000538 | Ga0070708_10000053817 | 261 |
| 240 | 3300005445 | Ga0070708_100003225 | Ga0070708_10000322512 | 261 |
| 241 | 3300005445 | Ga0070708_100477347 | Ga0070708_1004773471 | 261 |
| 242 | 3300005455 | Ga0070663_100058005 | Ga0070663_1000580053 | 261 |
| 243 | 3300005456 | Ga0070678_100003201 | Ga0070678_1000032015 | 261 |
| 244 | 3300005456 | Ga0070678_100042104 | Ga0070678_1000421042 | 261 |
| 245 | 3300005459 | Ga0068867_100000975 | Ga0068867_1000009756 | 261 |
| 246 | 3300005459 | Ga0068867_100061803 | Ga0068867_1000618034 | 261 |
| 247 | 3300005459 | Ga0068867_100241645 | Ga0068867_1002416452 | 261 |
| 248 | 3300005467 | Ga0070706_100314631 | Ga0070706_1003146311 | 261 |
| 249 | 3300005518 | Ga0070699_100456665 | Ga0070699_1004566651 | 261 |
| 250 | 3300005536 | Ga0070697_100091416 | Ga0070697_1000914162 | 261 |
| 251 | 3300005539 | Ga0068853_100110480 | Ga0068853_1001104803 | 261 |
| 252 | 3300005539 | Ga0068853_100283465 | Ga0068853_1002834652 | 261 |
| 253 | 3300005543 | Ga0070672_100000287 | Ga0070672_10000028711 | 261 |
| 254 | 3300005543 | Ga0070672_100005272 | Ga0070672_1000052726 | 261 |
| 255 | 3300005546 | Ga0070696_100084812 | Ga0070696_1000848122 | 261 |
| 256 | 3300005548 | Ga0070665_100008986 | Ga0070665_1000089867 | 261 |
| 257 | 3300005563 | Ga0068855_100083397 | Ga0068855_1000833973 | 261 |
| 258 | 3300005564 | Ga0070664_100062389 | Ga0070664_1000623893 | 261 |
| 259 | 3300005564 | Ga0070664_100173075 | Ga0070664_1001730752 | 261 |
| 260 | 3300005578 | Ga0068854_100098147 | Ga0068854_1000981472 | 261 |
| 261 | 3300005614 | Ga0068856_100021812 | Ga0068856_1000218126 | 261 |
| 262 | 3300005616 | Ga0068852_100151372 | Ga0068852_1001513722 | 261 |
| 263 | 3300005617 | Ga0068859_100050936 | Ga0068859_1000509365 | 261 |
| 264 | 3300005617 | Ga0068859_100063117 | Ga0068859_1000631172 | 261 |
| 265 | 3300005617 | Ga0068859_100216526 | Ga0068859_1002165262 | 261 |
| 266 | 3300005618 | Ga0068864_100003577 | Ga0068864_10000357711 | 261 |
| 267 | 3300005618 | Ga0068864_100005258 | Ga0068864_1000052588 | 261 |
| 268 | 3300005618 | Ga0068864_100046033 | Ga0068864_1000460333 | 261 |
| 269 | 3300005719 | Ga0068861_100027365 | Ga0068861_1000273653 | 261 |
| 270 | 3300005719 | Ga0068861_100240065 | Ga0068861_1002400652 | 261 |
| 271 | 3300005841 | Ga0068863_100001368 | Ga0068863_10000136816 | 261 |
| 272 | 3300005841 | Ga0068863_100428358 | Ga0068863_1004283582 | 261 |
| 273 | 3300005841 | Ga0068863_100738773 | Ga0068863_1007387732 | 261 |
| 274 | 3300005842 | Ga0068858_100006176 | Ga0068858_1000061766 | 261 |
| 275 | 3300005842 | Ga0068858_100016320 | Ga0068858_1000163206 | 261 |
| 276 | 3300005842 | Ga0068858_100153373 | Ga0068858_1001533732 | 261 |
| 277 | 3300005843 | Ga0068860_100004808 | Ga0068860_1000048084 | 261 |
| 278 | 3300005843 | Ga0068860_100091904 | Ga0068860_1000919042 | 261 |
| 279 | 3300005843 | Ga0068860_100138622 | Ga0068860_1001386223 | 261 |
| 280 | 3300005844 | Ga0068862_100034244 | Ga0068862_1000342442 | 261 |
| 281 | 3300005844 | Ga0068862_100050180 | Ga0068862_1000501804 | 261 |
| 282 | 3300005844 | Ga0068862_100118197 | Ga0068862_1001181972 | 261 |
| 283 | 3300005844 | Ga0068862_100272594 | Ga0068862_1002725941 | 261 |
| 284 | 3300006042 | Ga0075368_10003446 | Ga0075368_100034463 | 261 |
| 285 | 3300006178 | Ga0075367_10035836 | Ga0075367_100358363 | 261 |
| 286 | 3300006186 | Ga0075369_10069329 | Ga0075369_100693292 | 261 |
| 287 | 3300006237 | Ga0097621_100008005 | Ga0097621_1000080056 | 261 |
| 288 | 3300006237 | Ga0097621_100066231 | Ga0097621_1000662312 | 261 |
| 289 | 3300006237 | Ga0097621_100450904 | Ga0097621_1004509042 | 261 |
| 290 | 3300006353 | Ga0075370_10018238 | Ga0075370_100182384 | 261 |
| 291 | 3300006358 | Ga0068871_100000834 | Ga0068871_1000008346 | 261 |
| 292 | 3300006358 | Ga0068871_100216817 | Ga0068871_1002168172 | 261 |
| 293 | 3300006844 | Ga0075428_100157357 | Ga0075428_1001573572 | 261 |
| 294 | 3300006844 | Ga0075428_100530836 | Ga0075428_1005308361 | 261 |
| 295 | 3300006846 | Ga0075430_100018438 | Ga0075430_1000184384 | 261 |
| 296 | 3300006847 | Ga0075431_100065119 | Ga0075431_1000651194 | 261 |
| 297 | 3300006852 | Ga0075433_10005479 | Ga0075433_100054796 | 261 |
| 298 | 3300006852 | Ga0075433_10540591 | Ga0075433_105405912 | 261 |
| 299 | 3300006871 | Ga0075434_100010081 | Ga0075434_1000100811 | 261 |
| 300 | 3300006871 | Ga0075434_100035645 | Ga0075434_1000356455 | 261 |
| 301 | 3300006871 | Ga0075434_100087823 | Ga0075434_1000878232 | 261 |
| 302 | 3300006871 | Ga0075434_100244727 | Ga0075434_1002447273 | 261 |
| 303 | 3300006871 | Ga0075434_100648714 | Ga0075434_1006487142 | 261 |
| 304 | 3300006880 | Ga0075429_100175665 | Ga0075429_1001756652 | 261 |
| 305 | 3300006881 | Ga0068865_100245756 | Ga0068865_1002457561 | 261 |
| 306 | 3300006914 | Ga0075436_100022540 | Ga0075436_1000225404 | 261 |
| 307 | 3300006914 | Ga0075436_100066204 | Ga0075436_1000662042 | 261 |
| 308 | 3300006931 | Ga0097620_100050936 | Ga0097620_1000509365 | 261 |
| 309 | 3300006931 | Ga0097620_100063116 | Ga0097620_1000631162 | 261 |
| 310 | 3300006931 | Ga0097620_100216535 | Ga0097620_1002165352 | 261 |
| 311 | 3300007076 | Ga0075435_100018242 | Ga0075435_1000182422 | 261 |
| 312 | 3300009011 | Ga0105251_10086280 | Ga0105251_100862802 | 261 |
| 313 | 3300009093 | Ga0105240_10146257 | Ga0105240_101462572 | 261 |
| 314 | 3300009094 | Ga0111539_10182697 | Ga0111539_101826972 | 261 |
| 315 | 3300009098 | Ga0105245_10402157 | Ga0105245_104021572 | 261 |
| 316 | 3300009147 | Ga0114129_10762918 | Ga0114129_107629182 | 261 |
| 317 | 3300009148 | Ga0105243_10019715 | Ga0105243_100197156 | 261 |
| 318 | 3300009148 | Ga0105243_10311362 | Ga0105243_103113621 | 261 |
| 319 | 3300009148 | Ga0105243_10335026 | Ga0105243_103350262 | 261 |
| 320 | 3300009176 | Ga0105242_10145836 | Ga0105242_101458362 | 261 |
| 321 | 3300009177 | Ga0105248_10017795 | Ga0105248_100177954 | 261 |
| 322 | 3300009177 | Ga0105248_10070234 | Ga0105248_100702343 | 261 |
| 323 | 3300009177 | Ga0105248_10337262 | Ga0105248_103372622 | 261 |
| 324 | 3300009177 | Ga0105248_10555250 | Ga0105248_105552502 | 261 |
| 325 | 3300009553 | Ga0105249_10421148 | Ga0105249_104211482 | 261 |
| 326 | 3300010375 | Ga0105239_10027181 | Ga0105239_100271816 | 261 |
| 327 | 3300013296 | Ga0157374_10003813 | Ga0157374_1000381311 | 261 |
| 328 | 3300013297 | Ga0157378_10007092 | Ga0157378_1000709211 | 261 |
| 329 | 3300013297 | Ga0157378_10110726 | Ga0157378_101107262 | 261 |
| 330 | 3300013306 | Ga0163162_10003831 | Ga0163162_100038314 | 261 |
| 331 | 3300013306 | Ga0163162_10018668 | Ga0163162_100186687 | 261 |
| 332 | 3300013306 | Ga0163162_10158115 | Ga0163162_101581152 | 261 |
| 333 | 3300013306 | Ga0163162_10173898 | Ga0163162_101738983 | 261 |
| 334 | 3300013308 | Ga0157375_10003753 | Ga0157375_100037539 | 261 |
| 335 | 3300013308 | Ga0157375_10005930 | Ga0157375_100059307 | 261 |
| 336 | 3300013308 | Ga0157375_10352924 | Ga0157375_103529242 | 261 |
| 337 | 3300014325 | Ga0163163_10038318 | Ga0163163_100383183 | 261 |
| 338 | 3300014325 | Ga0163163_10484347 | Ga0163163_104843472 | 261 |
| 339 | 3300014326 | Ga0157380_10098924 | Ga0157380_100989242 | 261 |
| 340 | 3300014326 | Ga0157380_10132403 | Ga0157380_101324033 | 261 |
| 341 | 3300014968 | Ga0157379_10000858 | Ga0157379_1000085827 | 261 |
| 342 | 3300014968 | Ga0157379_10028643 | Ga0157379_100286435 | 261 |
| 343 | 3300014968 | Ga0157379_10104870 | Ga0157379_101048704 | 261 |
| 344 | 3300014969 | Ga0157376_10000986 | Ga0157376_1000098612 | 261 |
| 345 | 3300014969 | Ga0157376_10046493 | Ga0157376_100464933 | 261 |
| 346 | 3300017792 | Ga0163161_10022856 | Ga0163161_100228564 | 261 |
| 347 | 3300017792 | Ga0163161_10050915 | Ga0163161_100509153 | 261 |
| 348 | 3300017792 | Ga0163161_10298116 | Ga0163161_102981162 | 261 |
| 349 | 3300025315 | Ga0207697_10051367 | Ga0207697_100513672 | 261 |
| 350 | 3300025907 | Ga0207645_10000157 | Ga0207645_1000015716 | 261 |
| 351 | 3300025910 | Ga0207684_10013485 | Ga0207684_100134858 | 261 |
| 352 | 3300025913 | Ga0207695_10338316 | Ga0207695_103383162 | 261 |
| 353 | 3300025920 | Ga0207649_10334165 | Ga0207649_103341652 | 261 |
| 354 | 3300025922 | Ga0207646_10030223 | Ga0207646_100302235 | 261 |
| 355 | 3300025923 | Ga0207681_10034153 | Ga0207681_100341534 | 261 |
| 356 | 3300025923 | Ga0207681_10051406 | Ga0207681_100514063 | 261 |
| 357 | 3300025923 | Ga0207681_10062517 | Ga0207681_100625172 | 261 |
| 358 | 3300025923 | Ga0207681_10098674 | Ga0207681_100986741 | 261 |
| 359 | 3300025925 | Ga0207650_10005693 | Ga0207650_100056933 | 261 |
| 360 | 3300025925 | Ga0207650_10023375 | Ga0207650_100233751 | 261 |
| 361 | 3300025925 | Ga0207650_10115176 | Ga0207650_101151762 | 261 |
| 362 | 3300025925 | Ga0207650_10274734 | Ga0207650_102747341 | 261 |
| 363 | 3300025926 | Ga0207659_10006435 | Ga0207659_1000643510 | 261 |
| 364 | 3300025926 | Ga0207659_10014554 | Ga0207659_100145542 | 261 |
| 365 | 3300025931 | Ga0207644_10012783 | Ga0207644_100127833 | 261 |
| 366 | 3300025931 | Ga0207644_10019823 | Ga0207644_100198233 | 261 |
| 367 | 3300025933 | Ga0207706_10184281 | Ga0207706_101842812 | 261 |
| 368 | 3300025934 | Ga0207686_10100126 | Ga0207686_101001262 | 261 |
| 369 | 3300025935 | Ga0207709_10011114 | Ga0207709_100111142 | 261 |
| 370 | 3300025937 | Ga0207669_10047016 | Ga0207669_100470162 | 261 |
| 371 | 3300025937 | Ga0207669_10453032 | Ga0207669_104530322 | 261 |
| 372 | 3300025938 | Ga0207704_10147208 | Ga0207704_101472082 | 261 |
| 373 | 3300025940 | Ga0207691_10000249 | Ga0207691_1000024939 | 261 |
| 374 | 3300025940 | Ga0207691_10006443 | Ga0207691_100064437 | 261 |
| 375 | 3300025941 | Ga0207711_10026251 | Ga0207711_100262513 | 261 |
| 376 | 3300025941 | Ga0207711_10058461 | Ga0207711_100584612 | 261 |
| 377 | 3300025942 | Ga0207689_10009790 | Ga0207689_100097908 | 261 |
| 378 | 3300025949 | Ga0207667_10498472 | Ga0207667_104984722 | 261 |
| 379 | 3300025960 | Ga0207651_10018887 | Ga0207651_100188874 | 261 |
| 380 | 3300025961 | Ga0207712_10022600 | Ga0207712_100226004 | 261 |
| 381 | 3300025972 | Ga0207668_10004378 | Ga0207668_100043785 | 261 |
| 382 | 3300025972 | Ga0207668_10024536 | Ga0207668_100245363 | 261 |
| 383 | 3300025972 | Ga0207668_10091756 | Ga0207668_100917563 | 261 |
| 384 | 3300025972 | Ga0207668_10094552 | Ga0207668_100945523 | 261 |
| 385 | 3300025981 | Ga0207640_10197883 | Ga0207640_101978832 | 261 |
| 386 | 3300025986 | Ga0207658_10093160 | Ga0207658_100931602 | 261 |
| 387 | 3300026023 | Ga0207677_10058613 | Ga0207677_100586132 | 261 |
| 388 | 3300026035 | Ga0207703_10002253 | Ga0207703_1000225312 | 261 |
| 389 | 3300026035 | Ga0207703_10021879 | Ga0207703_100218794 | 261 |
| 390 | 3300026035 | Ga0207703_10288732 | Ga0207703_102887322 | 261 |
| 391 | 3300026041 | Ga0207639_10041011 | Ga0207639_100410113 | 261 |
| 392 | 3300026067 | Ga0207678_10123279 | Ga0207678_101232792 | 261 |
| 393 | 3300026075 | Ga0207708_10064825 | Ga0207708_100648251 | 261 |
| 394 | 3300026075 | Ga0207708_10425440 | Ga0207708_104254402 | 261 |
| 395 | 3300026088 | Ga0207641_10000374 | Ga0207641_1000037436 | 261 |
| 396 | 3300026088 | Ga0207641_10203479 | Ga0207641_102034793 | 261 |
| 397 | 3300026088 | Ga0207641_10490734 | Ga0207641_104907342 | 261 |
| 398 | 3300026089 | Ga0207648_10000523 | Ga0207648_100005236 | 261 |
| 399 | 3300026089 | Ga0207648_10013639 | Ga0207648_100136394 | 261 |
| 400 | 3300026089 | Ga0207648_10229450 | Ga0207648_102294502 | 261 |
| 401 | 3300026089 | Ga0207648_10432299 | Ga0207648_104322992 | 261 |
| 402 | 3300026095 | Ga0207676_10001665 | Ga0207676_1000166512 | 261 |
| 403 | 3300026095 | Ga0207676_10008789 | Ga0207676_100087895 | 261 |
| 404 | 3300026095 | Ga0207676_10016930 | Ga0207676_100169304 | 261 |
| 405 | 3300026118 | Ga0207675_100024242 | Ga0207675_1000242427 | 261 |
| 406 | 3300026118 | Ga0207675_100040177 | Ga0207675_1000401772 | 261 |
| 407 | 3300026118 | Ga0207675_100108631 | Ga0207675_1001086312 | 261 |
| 408 | 3300026118 | Ga0207675_100615189 | Ga0207675_1006151891 | 261 |
| 409 | 3300026121 | Ga0207683_10000476 | Ga0207683_1000047610 | 261 |
| 410 | 3300026121 | Ga0207683_10044604 | Ga0207683_100446045 | 261 |
| 411 | 3300026121 | Ga0207683_10372961 | Ga0207683_103729612 | 261 |
| 412 | 3300026142 | Ga0207698_10479790 | Ga0207698_104797902 | 261 |
| 413 | 3300028379 | Ga0268266_10004526 | Ga0268266_1000452612 | 261 |
| 414 | 3300028379 | Ga0268266_10338513 | Ga0268266_103385132 | 261 |
| 415 | 3300028380 | Ga0268265_10024395 | Ga0268265_100243952 | 261 |
| 416 | 3300028380 | Ga0268265_10072810 | Ga0268265_100728102 | 261 |
| 417 | 3300028380 | Ga0268265_10084594 | Ga0268265_100845942 | 261 |
| 418 | 3300028380 | Ga0268265_10623173 | Ga0268265_106231731 | 261 |
| 419 | 3300028381 | Ga0268264_10007867 | Ga0268264_100078672 | 261 |
| 420 | 3300028381 | Ga0268264_10008187 | Ga0268264_100081872 | 261 |
| 421 | 3300028381 | Ga0268264_10111092 | Ga0268264_101110923 | 261 |
| 422 | 3300028381 | Ga0268264_10311816 | Ga0268264_103118162 | 261 |
| 423 | 3300031251 | Ga0265327_10028220 | Ga0265327_100282203 | 261 |
| 424 | 3300035691 | Ga0373931_0009521 | Ga0373931_0009521_1657_2445 | 261 |
| 425 | 3300036401 | Ga0373937_0158684 | Ga0373937_0158684_665_1483 | 261 |
| 426 | 3300042876 | Ga0451577_0389925 | Ga0451577_0389925_207_992 | 261 |
| 427 | 3300048915 | Ga0496112_0012289 | Ga0496112_0012289_4868_5671 | 261 |
| 428 | 3300048916 | Ga0496113_0169277 | Ga0496113_0169277_515_1318 | 261 |
| 429 | 3300049574 | Ga0501038_0251364 | Ga0501038_0251364_518_1306 | 261 |
| 430 | 3300049575 | Ga0501039_0292174 | Ga0501039_0292174_372_1160 | 261 |
| 431 | 3300049576 | Ga0501040_0003556 | Ga0501040_0003556_8510_9298 | 261 |
| 432 | 3300049578 | Ga0501042_0027494 | Ga0501042_0027494_3077_3865 | 261 |
| 433 | 3300049581 | Ga0501047_0534844 | Ga0501047_0534844_132_929 | 261 |
| 434 | 3300049582 | Ga0501048_0020006 | Ga0501048_0020006_4050_4838 | 261 |
| 435 | 3300049587 | Ga0501071_0031121 | Ga0501071_0031121_120_908 | 261 |
| 436 | 3300049588 | Ga0501072_0261436 | Ga0501072_0261436_522_1310 | 261 |
| 437 | 3300049589 | Ga0501073_0174509 | Ga0501073_0174509_123_911 | 261 |
| 438 | 3300049591 | Ga0501075_0000740 | Ga0501075_0000740_16078_16866 | 261 |
| 439 | 3300049592 | Ga0501076_0226369 | Ga0501076_0226369_122_910 | 261 |
| 440 | 3300049742 | Ga0501080_0048109 | Ga0501080_0048109_746_1534 | 261 |
| 441 | 3300049743 | Ga0501081_0118012 | Ga0501081_0118012_869_1657 | 261 |
| 442 | 3300049743 | Ga0501081_0120592 | Ga0501081_0120592_521_1309 | 261 |
| 443 | 3300049744 | Ga0501083_0036465 | Ga0501083_0036465_336_1124 | 261 |
| 444 | 3300049822 | Ga0501035_0094929 | Ga0501035_0094929_805_1593 | 261 |
| 445 | 3300049824 | Ga0501045_0011981 | Ga0501045_0011981_661_1449 | 261 |
| 446 | 3300049824 | Ga0501045_0188883 | Ga0501045_0188883_734_1522 | 261 |
| 447 | 3300050496 | nmdc:mga07m45_11542_c1 | nmdc:mga07m45_11542_c1_3373_4164 | 261 |
| 448 | 3300050507 | nmdc:mga05p37_198820_c1 | nmdc:mga05p37_198820_c1_379_1164 | 261 |
| 449 | 3300050507 | nmdc:mga05p37_302821_c1 | nmdc:mga05p37_302821_c1_1084_1872 | 261 |
| 450 | 3300050511 | nmdc:mga08y16_514191_c1 | nmdc:mga08y16_514191_c1_310_1095 | 261 |
| 451 | 3300050512 | nmdc:mga0n895_124289_c1 | nmdc:mga0n895_124289_c1_152_940 | 261 |
| 452 | 3300050512 | nmdc:mga0n895_39828_c1 | nmdc:mga0n895_39828_c1_119_907 | 261 |
| 453 | 3300050512 | nmdc:mga0n895_696720_c1 | nmdc:mga0n895_696720_c1_121_906 | 261 |
| 454 | 3300050513 | nmdc:mga0rr50_262647_c1 | nmdc:mga0rr50_262647_c1_198_986 | 261 |
| 455 | 3300050514 | nmdc:mga08x19_27911_c1 | nmdc:mga08x19_27911_c1_2116_2910 | 261 |
| 456 | 3300050514 | nmdc:mga08x19_55025_c1 | nmdc:mga08x19_55025_c1_1184_1972 | 261 |
| 457 | 3300050515 | nmdc:mga0a205_111208_c1 | nmdc:mga0a205_111208_c1_1828_2613 | 261 |
| 458 | 3300050515 | nmdc:mga0a205_207545_c1 | nmdc:mga0a205_207545_c1_158_943 | 261 |
| 459 | 3300050515 | nmdc:mga0a205_22451_c1 | nmdc:mga0a205_22451_c1_4440_5228 | 261 |
| 460 | 3300053153 | Ga0500616_0081761 | Ga0500616_0081761_522_1310 | 261 |
| 461 | 3300054114 | Ga0501084_0037861 | Ga0501084_0037861_21_809 | 261 |
| 462 | 3300060353 | Ga0501082_0006109 | Ga0501082_0006109_11_799 | 261 |
| 463 | 3300061734 | Ga0530510_0004686 | Ga0530510_0004686_6523_7311 | 261 |
| 464 | 3300061734 | Ga0530510_0222571 | Ga0530510_0222571_599_1384 | 261 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4khz-assembly1.cif.gz_B | crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose | 0.9459 | 3 | 222 |
| 7caf-assembly1.cif.gz_C | mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state | 0.9417 | 3 | 222 |
| 7cad-assembly1.cif.gz_D | mycobacterium smegmatis sugabc complex | 0.9413 | 3 | 222 |
| 4jbw-assembly1.cif.gz_A | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.9381 | 3 | 222 |
| 8ja7-assembly1.cif.gz_D | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.9369 | 1 | 222 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57855_15_256_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.988 | 4 | 247 | 3.40.50.300 |
| af_Q57855_15_256_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9718 | 4 | 247 | 3.40.50.300 |
| af_Q47538_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9362 | 4 | 239 | 3.40.50.300 |
| af_Q8T665_1_248_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9354 | 1 | 226 | 3.40.50.300 |
| af_P77737_9_333_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9327 | 1 | 211 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A858WY56-F1-model_v4 | ABC transporter ATP-binding protein | 0.9909 | 4 | 257 |
GO:0005524
GO:0016887 |
| AF-Q9AKT5-F1-model_v4 | Putative ABC-transporter | 0.9812 | 36 | 254 |
GO:0005524
GO:0016887 |
| AF-A0A1Z8P518-F1-model_v4 | ABC transporter ATP-binding protein | 0.9789 | 2 | 251 |
GO:0005524
GO:0016887 |
| AF-A0A1Q6DVK8-F1-model_v4 | ABC-type nitrate/sulfonate/bicarbonate transport system ATPase component | 0.9777 | 1 | 251 |
GO:0005524
GO:0016887 |
| AF-A0A536PA20-F1-model_v4 | ABC transporter ATP-binding protein | 0.9776 | 1 | 253 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar