F449264

General Info

Members Datasets Scaffolds Average Seq Length
464 213 463 260

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100046033|Ga0068864_1000460333
Length 271
Sequence MERRLNGAAHHHKLAIEAVGRTFAGVRGGTPTVALEPVTLRVEDHDFITILGPSGCGKSTLLRIVAGLDTPTAGRVLLDGTPVVAPGADRGMVFQSYTLFPWLTVHENICFGLREKNMPQNEQQRIAAHYIARVGLGGFEHHYPKMLSGGMQQRTAIARALANDPKILLLDEPFGALDNQTRALMQELLLGIWEAEKKTVLFVTHDIEEAIFMAGRVIVMSARPGRIKAEVAVDLPHPRHYTVKTTPEFSALKARLTEEIRSEALKVAAAA

Samples

Sample ID Description Type Environment
1 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
156 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
157 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
158 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
161 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.29
Nodule 0
Rhizoplane 1.08
Rhizosphere 97.41
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10111531 3300005293 Bacteria 2570
2 Ga0065707_10017671 3300005295 Bacteria 1738
3 Ga0070676_10330853 3300005328 Bacteria 1042
4 Ga0070690_100000701 3300005330 Bacteria 17178
5 Ga0070690_100049474 3300005330 Bacteria 2680
6 Ga0070690_100287628 3300005330 Bacteria 1175
7 Ga0070670_100014823 3300005331 Bacteria 6685
8 Ga0070670_100077764 3300005331 Bacteria 2850
9 Ga0070670_100165509 3300005331 Bacteria 1917
10 Ga0070670_100236372 3300005331 Bacteria 1590
11 Ga0068869_100000240 3300005334 Bacteria 28811
12 Ga0068869_100004298 3300005334 Bacteria 8845
13 Ga0068869_100039144 3300005334 Bacteria 3384
14 Ga0070666_10085117 3300005335 Bacteria 2165
15 Ga0070680_100002168 3300005336 Bacteria 14465
16 Ga0070680_100351406 3300005336 Bacteria 1254
17 Ga0068868_100000471 3300005338 Bacteria 26837
18 Ga0068868_100011298 3300005338 Bacteria 6501
19 Ga0070689_100000540 3300005340 Bacteria 22545
20 Ga0070689_100035324 3300005340 Bacteria 3819
21 Ga0070689_100300577 3300005340 Bacteria 1336
22 Ga0070691_10001174 3300005341 Bacteria 10949
23 Ga0070687_100000416 3300005343 Bacteria 14397
24 Ga0070661_100421558 3300005344 Bacteria 1058
25 Ga0070668_100001341 3300005347 Bacteria 17586
26 Ga0070668_100013667 3300005347 Bacteria 6061
27 Ga0070668_100362326 3300005347 Bacteria 1230
28 Ga0070669_100000668 3300005353 Bacteria 25208
29 Ga0070669_100046538 3300005353 Bacteria 3164
30 Ga0070669_100198613 3300005353 Bacteria 1577
31 Ga0070669_100279268 3300005353 Bacteria 1338
32 Ga0070669_100281900 3300005353 Bacteria 1332
33 Ga0070675_100001258 3300005354 Bacteria 18530
34 Ga0070675_100051570 3300005354 Bacteria 3381
35 Ga0070675_100580603 3300005354 Bacteria 1016
36 Ga0070671_100010289 3300005355 Bacteria 7504
37 Ga0070671_100092362 3300005355 Bacteria 2536
38 Ga0070674_100163424 3300005356 Bacteria 1691
39 Ga0070673_100015219 3300005364 Bacteria 5395
40 Ga0070673_100092350 3300005364 Bacteria 2476
41 Ga0070673_100307305 3300005364 Bacteria 1398
42 Ga0070688_100038958 3300005365 Bacteria 2906
43 Ga0070667_100004919 3300005367 Bacteria 11200
44 Ga0070667_100005264 3300005367 Bacteria 10819
45 Ga0070667_100037796 3300005367 Bacteria 4047
46 Ga0070667_100095033 3300005367 Bacteria 2569
47 Ga0070701_10001283 3300005438 Bacteria 9233
48 Ga0070705_100001316 3300005440 Bacteria 13312
49 Ga0070700_100005090 3300005441 Bacteria 6935
50 Ga0070700_100496299 3300005441 Bacteria 938
51 Ga0070694_100000418 3300005444 Bacteria 23163
52 Ga0070694_100022197 3300005444 Bacteria 4064
53 Ga0070694_100229579 3300005444 Bacteria 1396
54 Ga0070708_100000538 3300005445 Bacteria 28503
55 Ga0070708_100003225 3300005445 Bacteria 12725
56 Ga0070708_100477347 3300005445 Bacteria 1176
57 Ga0070663_100058005 3300005455 Bacteria 2779
58 Ga0070678_100003201 3300005456 Bacteria 9087
59 Ga0070678_100024961 3300005456 Bacteria 4012
60 Ga0070678_100042104 3300005456 Bacteria 3243
61 Ga0070678_100266690 3300005456 Bacteria 1442
62 Ga0070681_10137436 3300005458 Bacteria 2374
63 Ga0068867_100000442 3300005459 Bacteria 27552
64 Ga0068867_100000975 3300005459 Bacteria 19545
65 Ga0068867_100061803 3300005459 Bacteria 2782
66 Ga0068867_100241645 3300005459 Bacteria 1465
67 Ga0068867_100387442 3300005459 Bacteria 1175
68 Ga0068867_100429930 3300005459 Bacteria 1120
69 Ga0070706_100314631 3300005467 Bacteria 1460
70 Ga0070707_100740903 3300005468 Bacteria 946
71 Ga0070699_100456665 3300005518 Bacteria 1158
72 Ga0070697_100018516 3300005536 Bacteria 5490
73 Ga0070697_100091416 3300005536 Bacteria 2516
74 Ga0068853_100110480 3300005539 Bacteria 2442
75 Ga0068853_100283465 3300005539 Bacteria 1528
76 Ga0070672_100000287 3300005543 Bacteria 28567
77 Ga0070672_100005272 3300005543 Bacteria 8552
78 Ga0070672_100013687 3300005543 Bacteria 5736
79 Ga0070672_100014087 3300005543 Bacteria 5659
80 Ga0070686_100082250 3300005544 Bacteria 2135
81 Ga0070695_100002769 3300005545 Bacteria 10170
82 Ga0070696_100084812 3300005546 Bacteria 2248
83 Ga0070693_100001954 3300005547 Bacteria 9438
84 Ga0070665_100008986 3300005548 Bacteria 10122
85 Ga0070665_100013659 3300005548 Bacteria 8169
86 Ga0070704_100002922 3300005549 Bacteria 9706
87 Ga0068855_100083397 3300005563 Bacteria 3702
88 Ga0070664_100062389 3300005564 Bacteria 3177
89 Ga0070664_100173075 3300005564 Bacteria 1916
90 Ga0068857_100046789 3300005577 Bacteria 3839
91 Ga0068854_100033950 3300005578 Bacteria 3560
92 Ga0068854_100098147 3300005578 Bacteria 2192
93 Ga0068856_100021812 3300005614 Bacteria 6224
94 Ga0068856_100408970 3300005614 Bacteria 1376
95 Ga0070702_100000090 3300005615 Bacteria 26645
96 Ga0070702_100128753 3300005615 Bacteria 1596
97 Ga0068852_100151372 3300005616 Bacteria 2158
98 Ga0068852_100516969 3300005616 Bacteria 1191
99 Ga0068859_100001633 3300005617 Bacteria 22912
100 Ga0068859_100050936 3300005617 Bacteria 4161
101 Ga0068859_100063117 3300005617 Bacteria 3735
102 Ga0068859_100083674 3300005617 Bacteria 3234
103 Ga0068859_100216526 3300005617 Bacteria 2002
104 Ga0068859_100486400 3300005617 Bacteria 1329
105 Ga0068864_100003577 3300005618 Bacteria 12845
106 Ga0068864_100005258 3300005618 Bacteria 10611
107 Ga0068864_100046033 3300005618 Bacteria 3743
108 Ga0068864_100365432 3300005618 Bacteria 1364
109 Ga0068864_100550979 3300005618 Bacteria 1114
110 Ga0068864_100839833 3300005618 Bacteria 904
111 Ga0068866_10000485 3300005718 Bacteria 18232
112 Ga0068861_100000853 3300005719 Bacteria 18466
113 Ga0068861_100027365 3300005719 Bacteria 4152
114 Ga0068861_100240065 3300005719 Bacteria 1541
115 Ga0068870_10040353 3300005840 Bacteria 2420
116 Ga0068863_100001368 3300005841 Bacteria 24235
117 Ga0068863_100428358 3300005841 Bacteria 1297
118 Ga0068863_100738773 3300005841 Bacteria 979
119 Ga0068858_100006176 3300005842 Bacteria 11684
120 Ga0068858_100016320 3300005842 Bacteria 6976
121 Ga0068858_100031100 3300005842 Bacteria 4957
122 Ga0068858_100153373 3300005842 Bacteria 2167
123 Ga0068860_100004808 3300005843 Bacteria 13752
124 Ga0068860_100011979 3300005843 Bacteria 8543
125 Ga0068860_100091904 3300005843 Bacteria 2891
126 Ga0068860_100138622 3300005843 Bacteria 2337
127 Ga0068860_100352962 3300005843 Bacteria 1447
128 Ga0068860_100536019 3300005843 Bacteria 1171
129 Ga0068860_100832521 3300005843 Bacteria 937
130 Ga0068862_100027133 3300005844 Bacteria 4819
131 Ga0068862_100034244 3300005844 Bacteria 4296
132 Ga0068862_100050180 3300005844 Bacteria 3565
133 Ga0068862_100118197 3300005844 Bacteria 2334
134 Ga0068862_100245188 3300005844 Bacteria 1631
135 Ga0068862_100272594 3300005844 Bacteria 1548
136 Ga0081539_10127382 3300005985 Bacteria 1256
137 Ga0075368_10003446 3300006042 Bacteria 5281
138 Ga0075367_10035836 3300006178 Bacteria 2874
139 Ga0075369_10069329 3300006186 Bacteria 1550
140 Ga0097621_100008005 3300006237 Bacteria 7587
141 Ga0097621_100055936 3300006237 Bacteria 3222
142 Ga0097621_100066231 3300006237 Bacteria 2975
143 Ga0097621_100450904 3300006237 Bacteria 1159
144 Ga0075370_10018238 3300006353 Bacteria 3806
145 Ga0068871_100000834 3300006358 Bacteria 20645
146 Ga0068871_100007397 3300006358 Bacteria 7841
147 Ga0068871_100216817 3300006358 Bacteria 1657
148 Ga0068871_100223182 3300006358 Bacteria 1633
149 Ga0075428_100000602 3300006844 Bacteria 36732
150 Ga0075428_100157357 3300006844 Bacteria 2467
151 Ga0075428_100530836 3300006844 Bacteria 1258
152 Ga0075430_100018438 3300006846 Bacteria 5938
153 Ga0075431_100008190 3300006847 Bacteria 10445
154 Ga0075431_100065119 3300006847 Bacteria 3763
155 Ga0075433_10005230 3300006852 Bacteria 10170
156 Ga0075433_10005479 3300006852 Bacteria 9971
157 Ga0075433_10540591 3300006852 Bacteria 1025
158 Ga0075434_100010081 3300006871 Bacteria 8848
159 Ga0075434_100035645 3300006871 Bacteria 4919
160 Ga0075434_100085157 3300006871 Bacteria 3160
161 Ga0075434_100087823 3300006871 Bacteria 3111
162 Ga0075434_100244727 3300006871 Bacteria 1813
163 Ga0075434_100247992 3300006871 Bacteria 1800
164 Ga0075434_100648714 3300006871 Bacteria 1074
165 Ga0075429_100002384 3300006880 Bacteria 15832
166 Ga0075429_100175665 3300006880 Bacteria 1876
167 Ga0068865_100051778 3300006881 Bacteria 2843
168 Ga0068865_100245756 3300006881 Bacteria 1410
169 Ga0075436_100000364 3300006914 Bacteria 28914
170 Ga0075436_100002227 3300006914 Bacteria 13395
171 Ga0075436_100022540 3300006914 Bacteria 4325
172 Ga0075436_100066204 3300006914 Bacteria 2497
173 Ga0097620_100001633 3300006931 Bacteria 22912
174 Ga0097620_100050936 3300006931 Bacteria 4161
175 Ga0097620_100063116 3300006931 Bacteria 3735
176 Ga0097620_100083685 3300006931 Bacteria 3234
177 Ga0097620_100216535 3300006931 Bacteria 2002
178 Ga0097620_100486419 3300006931 Bacteria 1329
179 Ga0075435_100000438 3300007076 Bacteria 25453
180 Ga0075435_100018242 3300007076 Bacteria 5330
181 Ga0075435_100504794 3300007076 Bacteria 1046
182 Ga0105251_10086280 3300009011 Bacteria 1446
183 Ga0105240_10146257 3300009093 Bacteria 2820
184 Ga0105240_10693701 3300009093 Bacteria 1112
185 Ga0111539_10003451 3300009094 Bacteria 20821
186 Ga0111539_10054814 3300009094 Bacteria 4742
187 Ga0111539_10182697 3300009094 Bacteria 2449
188 Ga0105245_10000944 3300009098 Bacteria 26426
189 Ga0105245_10402157 3300009098 Bacteria 1369
190 Ga0114129_10001652 3300009147 Bacteria 30334
191 Ga0114129_10036182 3300009147 Bacteria 6972
192 Ga0114129_10239171 3300009147 Bacteria 2441
193 Ga0114129_10526922 3300009147 Bacteria 1540
194 Ga0114129_10762918 3300009147 Bacteria 1237
195 Ga0105243_10000576 3300009148 Bacteria 36922
196 Ga0105243_10019715 3300009148 Bacteria 5114
197 Ga0105243_10311362 3300009148 Bacteria 1431
198 Ga0105243_10335026 3300009148 Bacteria 1384
199 Ga0105243_10736124 3300009148 Bacteria 965
200 Ga0105242_10101892 3300009176 Bacteria 2434
201 Ga0105242_10145836 3300009176 Bacteria 2059
202 Ga0105248_10017795 3300009177 Bacteria 7842
203 Ga0105248_10056706 3300009177 Bacteria 4395
204 Ga0105248_10070234 3300009177 Bacteria 3933
205 Ga0105248_10337262 3300009177 Bacteria 1697
206 Ga0105248_10555250 3300009177 Bacteria 1296
207 Ga0105249_10108380 3300009553 Bacteria 2622
208 Ga0105249_10421148 3300009553 Bacteria 1369
209 Ga0105239_10027181 3300010375 Bacteria 6298
210 Ga0157374_10003813 3300013296 Bacteria 12661
211 Ga0157374_10153023 3300013296 Bacteria 2243
212 Ga0157378_10007092 3300013297 Bacteria 9785
213 Ga0157378_10073830 3300013297 Bacteria 3067
214 Ga0157378_10110726 3300013297 Bacteria 2517
215 Ga0163162_10003831 3300013306 Bacteria 14422
216 Ga0163162_10018668 3300013306 Bacteria 6794
217 Ga0163162_10158115 3300013306 Bacteria 2387
218 Ga0163162_10173898 3300013306 Bacteria 2278
219 Ga0157372_10338025 3300013307 Bacteria 1754
220 Ga0157375_10003753 3300013308 Bacteria 13176
221 Ga0157375_10005930 3300013308 Bacteria 10648
222 Ga0157375_10135518 3300013308 Bacteria 2586
223 Ga0157375_10257872 3300013308 Bacteria 1905
224 Ga0157375_10352924 3300013308 Bacteria 1636
225 Ga0163163_10014074 3300014325 Bacteria 7345
226 Ga0163163_10038318 3300014325 Bacteria 4671
227 Ga0163163_10484347 3300014325 Bacteria 1298
228 Ga0157380_10098924 3300014326 Bacteria 2424
229 Ga0157380_10132403 3300014326 Bacteria 2129
230 Ga0157380_10167084 3300014326 Bacteria 1918
231 Ga0157377_10058515 3300014745 Bacteria 2195
232 Ga0157379_10000858 3300014968 Bacteria 24649
233 Ga0157379_10028643 3300014968 Bacteria 4954
234 Ga0157379_10040595 3300014968 Bacteria 4154
235 Ga0157379_10104870 3300014968 Bacteria 2537
236 Ga0157376_10000797 3300014969 Bacteria 20664
237 Ga0157376_10000986 3300014969 Bacteria 18545
238 Ga0157376_10046493 3300014969 Bacteria 3579
239 Ga0157376_10136174 3300014969 Bacteria 2198
240 Ga0163161_10022856 3300017792 Bacteria 4406
241 Ga0163161_10050915 3300017792 Bacteria 2998
242 Ga0163161_10298116 3300017792 Bacteria 1269
243 Ga0207697_10051367 3300025315 Bacteria 1704
244 Ga0207642_10013333 3300025899 Bacteria 2997
245 Ga0207642_10045055 3300025899 Bacteria 1956
246 Ga0207645_10000157 3300025907 Bacteria 53374
247 Ga0207643_10064236 3300025908 Bacteria 2101
248 Ga0207684_10013485 3300025910 Bacteria 7070
249 Ga0207695_10338316 3300025913 Bacteria 1393
250 Ga0207671_10202282 3300025914 Bacteria 1551
251 Ga0207660_10004806 3300025917 Bacteria 8789
252 Ga0207662_10056537 3300025918 Bacteria 2343
253 Ga0207662_10169022 3300025918 Bacteria 1401
254 Ga0207662_10318559 3300025918 Bacteria 1038
255 Ga0207649_10334165 3300025920 Bacteria 1117
256 Ga0207652_10064194 3300025921 Bacteria 3177
257 Ga0207646_10030223 3300025922 Bacteria 4914
258 Ga0207681_10034153 3300025923 Bacteria 3341
259 Ga0207681_10051406 3300025923 Bacteria 2792
260 Ga0207681_10062517 3300025923 Bacteria 2564
261 Ga0207681_10086435 3300025923 Bacteria 2228
262 Ga0207681_10098674 3300025923 Bacteria 2102
263 Ga0207681_10517196 3300025923 Bacteria 979
264 Ga0207650_10005693 3300025925 Bacteria 8503
265 Ga0207650_10023375 3300025925 Bacteria 4382
266 Ga0207650_10082918 3300025925 Bacteria 2435
267 Ga0207650_10115176 3300025925 Bacteria 2086
268 Ga0207650_10274734 3300025925 Bacteria 1370
269 Ga0207659_10006435 3300025926 Bacteria 7196
270 Ga0207659_10014554 3300025926 Bacteria 5078
271 Ga0207687_10028966 3300025927 Bacteria 3722
272 Ga0207644_10012783 3300025931 Bacteria 5582
273 Ga0207644_10019823 3300025931 Bacteria 4566
274 Ga0207706_10046268 3300025933 Bacteria 3853
275 Ga0207706_10184281 3300025933 Bacteria 1833
276 Ga0207706_10196785 3300025933 Bacteria 1768
277 Ga0207686_10029754 3300025934 Bacteria 3226
278 Ga0207686_10100126 3300025934 Bacteria 1933
279 Ga0207709_10000515 3300025935 Bacteria 33987
280 Ga0207709_10011114 3300025935 Bacteria 4964
281 Ga0207670_10041021 3300025936 Bacteria 3041
282 Ga0207669_10047016 3300025937 Bacteria 2553
283 Ga0207669_10421061 3300025937 Bacteria 1051
284 Ga0207669_10453032 3300025937 Bacteria 1017
285 Ga0207704_10022926 3300025938 Bacteria 3355
286 Ga0207704_10102093 3300025938 Bacteria 1915
287 Ga0207704_10147208 3300025938 Bacteria 1656
288 Ga0207704_10304627 3300025938 Bacteria 1222
289 Ga0207665_10434923 3300025939 Bacteria 1004
290 Ga0207691_10000249 3300025940 Bacteria 53276
291 Ga0207691_10006443 3300025940 Bacteria 11337
292 Ga0207691_10017092 3300025940 Bacteria 6882
293 Ga0207691_10023580 3300025940 Bacteria 5794
294 Ga0207711_10026251 3300025941 Bacteria 4887
295 Ga0207711_10058461 3300025941 Bacteria 3318
296 Ga0207711_10286932 3300025941 Bacteria 1516
297 Ga0207689_10001166 3300025942 Bacteria 25290
298 Ga0207689_10009790 3300025942 Bacteria 8258
299 Ga0207689_10069117 3300025942 Bacteria 2902
300 Ga0207679_10032761 3300025945 Bacteria 3652
301 Ga0207679_10546825 3300025945 Bacteria 1038
302 Ga0207667_10498472 3300025949 Bacteria 1235
303 Ga0207651_10018887 3300025960 Bacteria 4116
304 Ga0207651_10074685 3300025960 Bacteria 2415
305 Ga0207651_10393557 3300025960 Bacteria 1177
306 Ga0207712_10022600 3300025961 Unclassified 4143
307 Ga0207668_10004378 3300025972 Bacteria 8295
308 Ga0207668_10024536 3300025972 Bacteria 3893
309 Ga0207668_10091756 3300025972 Bacteria 2233
310 Ga0207668_10094552 3300025972 Bacteria 2204
311 Ga0207668_10248535 3300025972 Bacteria 1443
312 Ga0207640_10053609 3300025981 Bacteria 2633
313 Ga0207640_10197883 3300025981 Bacteria 1520
314 Ga0207658_10093160 3300025986 Bacteria 2342
315 Ga0207677_10058613 3300026023 Bacteria 2652
316 Ga0207677_10201663 3300026023 Bacteria 1582
317 Ga0207703_10002253 3300026035 Bacteria 16857
318 Ga0207703_10002446 3300026035 Bacteria 16111
319 Ga0207703_10021879 3300026035 Bacteria 5007
320 Ga0207703_10023868 3300026035 Bacteria 4809
321 Ga0207703_10120015 3300026035 Bacteria 2256
322 Ga0207703_10288732 3300026035 Bacteria 1492
323 Ga0207703_10369916 3300026035 Bacteria 1324
324 Ga0207639_10041011 3300026041 Bacteria 3460
325 Ga0207678_10123279 3300026067 Bacteria 2211
326 Ga0207708_10012396 3300026075 Bacteria 6354
327 Ga0207708_10064825 3300026075 Bacteria 2792
328 Ga0207708_10425440 3300026075 Bacteria 1102
329 Ga0207702_10066725 3300026078 Bacteria 3085
330 Ga0207641_10000374 3300026088 Bacteria 53088
331 Ga0207641_10033047 3300026088 Bacteria 4298
332 Ga0207641_10203479 3300026088 Bacteria 1827
333 Ga0207641_10407038 3300026088 Bacteria 1307
334 Ga0207641_10490734 3300026088 Bacteria 1191
335 Ga0207648_10000523 3300026089 Bacteria 42961
336 Ga0207648_10013639 3300026089 Bacteria 7544
337 Ga0207648_10021215 3300026089 Bacteria 5839
338 Ga0207648_10121188 3300026089 Bacteria 2300
339 Ga0207648_10229450 3300026089 Bacteria 1651
340 Ga0207648_10432299 3300026089 Bacteria 1197
341 Ga0207676_10001665 3300026095 Bacteria 16379
342 Ga0207676_10008789 3300026095 Bacteria 7187
343 Ga0207676_10016930 3300026095 Bacteria 5279
344 Ga0207676_10161167 3300026095 Bacteria 1943
345 Ga0207675_100000564 3300026118 Bacteria 36294
346 Ga0207675_100024242 3300026118 Bacteria 5642
347 Ga0207675_100040177 3300026118 Bacteria 4367
348 Ga0207675_100108631 3300026118 Bacteria 2616
349 Ga0207675_100615189 3300026118 Bacteria 1090
350 Ga0207683_10000476 3300026121 Bacteria 37318
351 Ga0207683_10038039 3300026121 Bacteria 4191
352 Ga0207683_10040510 3300026121 Bacteria 4065
353 Ga0207683_10044604 3300026121 Bacteria 3876
354 Ga0207683_10372961 3300026121 Bacteria 1311
355 Ga0207698_10171437 3300026142 Bacteria 1911
356 Ga0207698_10479790 3300026142 Bacteria 1206
357 Ga0209982_1009593 3300027552 Bacteria 1432
358 Ga0209983_1004525 3300027665 Bacteria 2918
359 Ga0209971_1024395 3300027682 Bacteria 1444
360 Ga0209974_10000388 3300027876 Bacteria 14607
361 Ga0209974_10009103 3300027876 Bacteria 3374
362 Ga0207428_10002128 3300027907 Bacteria 19921
363 Ga0268266_10004526 3300028379 Bacteria 13283
364 Ga0268266_10313817 3300028379 Bacteria 1465
365 Ga0268266_10338513 3300028379 Bacteria 1412
366 Ga0268265_10004995 3300028380 Bacteria 9105
367 Ga0268265_10024395 3300028380 Unclassified 4277
368 Ga0268265_10072810 3300028380 Bacteria 2681
369 Ga0268265_10084594 3300028380 Bacteria 2515
370 Ga0268265_10623173 3300028380 Bacteria 1034
371 Ga0268264_10007867 3300028381 Bacteria 8871
372 Ga0268264_10008187 3300028381 Bacteria 8681
373 Ga0268264_10034214 3300028381 Bacteria 4178
374 Ga0268264_10111092 3300028381 Bacteria 2401
375 Ga0268264_10311816 3300028381 Bacteria 1485
376 Ga0268264_10505696 3300028381 Bacteria 1179
377 Ga0265327_10028220 3300031251 Bacteria 3214
378 Ga0307408_100605125 3300031548 Bacteria 974
379 Ga0307413_10066343 3300031824 Bacteria 2252
380 Ga0373950_0023477 3300034818 Bacteria 1103
381 Ga0373958_0006595 3300034819 Bacteria 1815
382 Ga0373928_0003811 3300035084 Bacteria 2876
383 Ga0373929_0015039 3300035085 Bacteria 1502
384 Ga0373923_0038221 3300035111 Bacteria 1966
385 Ga0373932_0013232 3300035112 Bacteria 2047
386 Ga0373936_0010494 3300035113 Bacteria 3495
387 Ga0373939_0035897 3300035114 Bacteria 1463
388 Ga0373945_0001129 3300035116 Bacteria 8075
389 Ga0373943_0195502 3300035170 Bacteria 1117
390 Ga0373931_0009521 3300035691 Bacteria 4645
391 Ga0373931_0032500 3300035691 Bacteria 2700
392 Ga0373931_0056573 3300035691 Bacteria 2102
393 Ga0373935_0020681 3300035692 Bacteria 4023
394 Ga0373935_0148764 3300035692 Bacteria 1587
395 Ga0373927_0336980 3300035695 Bacteria 993
396 Ga0373947_0006859 3300035725 Bacteria 6604
397 Ga0373937_0158684 3300036401 Bacteria 2120
398 Ga0373925_0223018 3300037068 Bacteria 1505
399 Ga0451577_0145267 3300042876 Bacteria 2132
400 Ga0451577_0389925 3300042876 Bacteria 1264
401 Ga0451576_0296510 3300045051 Bacteria 1690
402 Ga0495580_0002018 3300046472 Bacteria 17865
403 Ga0495666_0008870 3300046526 Bacteria 5037
404 Ga0495665_0012134 3300046531 Bacteria 4666
405 Ga0495621_0059346 3300046539 Bacteria 1386
406 Ga0495647_0002247 3300046681 Bacteria 6056
407 Ga0495676_0117597 3300047321 Bacteria 1939
408 Ga0496102_0470292 3300048905 Bacteria 1178
409 Ga0496104_0398469 3300048907 Bacteria 1289
410 Ga0496106_0085071 3300048909 Bacteria 2434
411 Ga0496112_0012289 3300048915 Bacteria 7863
412 Ga0496113_0169277 3300048916 Bacteria 1730
413 Ga0501036_0704522 3300049572 Bacteria 834
414 Ga0501038_0251364 3300049574 Bacteria 1400
415 Ga0501039_0292174 3300049575 Bacteria 1281
416 Ga0501040_0003556 3300049576 Bacteria 10074
417 Ga0501042_0027494 3300049578 Bacteria 4000
418 Ga0501047_0534844 3300049581 Bacteria 997
419 Ga0501048_0020006 3300049582 Bacteria 4910
420 Ga0501071_0031121 3300049587 Bacteria 3780
421 Ga0501072_0261436 3300049588 Bacteria 1377
422 Ga0501073_0174509 3300049589 Bacteria 1488
423 Ga0501074_0302068 3300049590 Bacteria 1137
424 Ga0501075_0000740 3300049591 Bacteria 20286
425 Ga0501076_0226369 3300049592 Bacteria 1528
426 Ga0501080_0048109 3300049742 Bacteria 3970
427 Ga0501080_0497501 3300049742 Bacteria 1090
428 Ga0501081_0118012 3300049743 Bacteria 1887
429 Ga0501081_0120592 3300049743 Bacteria 1867
430 Ga0501083_0036465 3300049744 Bacteria 3354
431 Ga0501035_0094929 3300049822 Bacteria 2622
432 Ga0501045_0011981 3300049824 Bacteria 6095
433 Ga0501045_0188883 3300049824 Bacteria 1535
434 nmdc:mga07m45_11542_c1 3300050496 Bacteria 4646
435 nmdc:mga05p37_198820_c1 3300050507 Bacteria 2429
436 nmdc:mga05p37_2170_c1 3300050507 Bacteria 22883
437 nmdc:mga05p37_302821_c1 3300050507 Bacteria 1898
438 nmdc:mga09592_193_c1 3300050508 Bacteria 43770
439 nmdc:mga09592_37120_c1 3300050508 Bacteria 4086
440 nmdc:mga08y16_23077_c1 3300050511 Bacteria 6569
441 nmdc:mga08y16_262_c1 3300050511 Bacteria 47546
442 nmdc:mga08y16_514191_c1 3300050511 Bacteria 1215
443 nmdc:mga0n895_124289_c1 3300050512 Bacteria 2603
444 nmdc:mga0n895_232177_c1 3300050512 Bacteria 1872
445 nmdc:mga0n895_39828_c1 3300050512 Bacteria 4563
446 nmdc:mga0n895_53927_c1 3300050512 Bacteria 3953
447 nmdc:mga0n895_696720_c1 3300050512 Bacteria 1012
448 nmdc:mga0rr50_209962_c1 3300050513 Bacteria 1604
449 nmdc:mga0rr50_262647_c1 3300050513 Bacteria 1437
450 nmdc:mga08x19_14376_c1 3300050514 Bacteria 4800
451 nmdc:mga08x19_1508_c1 3300050514 Bacteria 14424
452 nmdc:mga08x19_27911_c1 3300050514 Bacteria 3532
453 nmdc:mga08x19_55025_c1 3300050514 Bacteria 2563
454 nmdc:mga0a205_111208_c1 3300050515 Bacteria 2638
455 nmdc:mga0a205_1117_c1 3300050515 Bacteria 22221
456 nmdc:mga0a205_207545_c1 3300050515 Bacteria 1848
457 nmdc:mga0a205_22451_c1 3300050515 Bacteria 5978
458 nmdc:mga0a205_341336_c1 3300050515 Bacteria 1366
459 Ga0500616_0081761 3300053153 Bacteria 1622
460 Ga0501084_0037861 3300054114 Bacteria 4031
461 Ga0501082_0006109 3300060353 Bacteria 10454
462 Ga0530510_0004686 3300061734 Bacteria 9460
463 Ga0530510_0222571 3300061734 Bacteria 1403

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005330 Ga0070690_100287628 Ga0070690_1002876281 239
2 3300005340 Ga0070689_100035324 Ga0070689_1000353242 239
3 3300005354 Ga0070675_100580603 Ga0070675_1005806031 239
4 3300005618 Ga0068864_100839833 Ga0068864_1008398331 239
5 3300005843 Ga0068860_100536019 Ga0068860_1005360192 239
6 3300005844 Ga0068862_100027133 Ga0068862_1000271331 239
7 3300006358 Ga0068871_100223182 Ga0068871_1002231822 239
8 3300013297 Ga0157378_10073830 Ga0157378_100738303 239
9 3300014326 Ga0157380_10167084 Ga0157380_101670842 239
10 3300025899 Ga0207642_10045055 Ga0207642_100450552 239
11 3300035114 Ga0373939_0035897 Ga0373939_0035897_727_1452 239
12 3300005456 Ga0070678_100266690 Ga0070678_1002666901 246
13 3300005459 Ga0068867_100429930 Ga0068867_1004299302 246
14 3300025908 Ga0207643_10064236 Ga0207643_100642362 246
15 3300025940 Ga0207691_10017092 Ga0207691_100170922 246
16 3300026088 Ga0207641_10033047 Ga0207641_100330473 246
17 3300026121 Ga0207683_10038039 Ga0207683_100380392 246
18 3300009147 Ga0114129_10036182 Ga0114129_100361823 248
19 3300050508 nmdc:mga09592_37120_c1 nmdc:mga09592_37120_c1_369_1115 248
20 3300027876 Ga0209974_10009103 Ga0209974_100091032 250
21 3300049590 Ga0501074_0302068 Ga0501074_0302068_370_1125 250
22 3300049572 Ga0501036_0704522 Ga0501036_0704522_37_795 251
23 3300006914 Ga0075436_100000364 Ga0075436_10000036428 253
24 3300007076 Ga0075435_100504794 Ga0075435_1005047942 253
25 3300050514 nmdc:mga08x19_1508_c1 nmdc:mga08x19_1508_c1_4913_5680 253
26 3300005295 Ga0065707_10017671 Ga0065707_100176713 254
27 3300005330 Ga0070690_100000701 Ga0070690_1000007013 254
28 3300005334 Ga0068869_100000240 Ga0068869_1000002403 254
29 3300005334 Ga0068869_100039144 Ga0068869_1000391444 254
30 3300005336 Ga0070680_100002168 Ga0070680_1000021687 254
31 3300005338 Ga0068868_100000471 Ga0068868_1000004713 254
32 3300005340 Ga0070689_100000540 Ga0070689_10000054019 254
33 3300005341 Ga0070691_10001174 Ga0070691_100011742 254
34 3300005343 Ga0070687_100000416 Ga0070687_1000004162 254
35 3300005364 Ga0070673_100307305 Ga0070673_1003073052 254
36 3300005438 Ga0070701_10001283 Ga0070701_100012833 254
37 3300005440 Ga0070705_100001316 Ga0070705_1000013165 254
38 3300005441 Ga0070700_100005090 Ga0070700_1000050906 254
39 3300005444 Ga0070694_100000418 Ga0070694_10000041819 254
40 3300005458 Ga0070681_10137436 Ga0070681_101374361 254
41 3300005459 Ga0068867_100000442 Ga0068867_10000044220 254
42 3300005536 Ga0070697_100018516 Ga0070697_1000185164 254
43 3300005544 Ga0070686_100082250 Ga0070686_1000822502 254
44 3300005545 Ga0070695_100002769 Ga0070695_1000027693 254
45 3300005547 Ga0070693_100001954 Ga0070693_1000019543 254
46 3300005549 Ga0070704_100002922 Ga0070704_1000029228 254
47 3300005578 Ga0068854_100033950 Ga0068854_1000339503 254
48 3300005614 Ga0068856_100408970 Ga0068856_1004089702 254
49 3300005615 Ga0070702_100000090 Ga0070702_10000009020 254
50 3300005615 Ga0070702_100128753 Ga0070702_1001287532 254
51 3300005616 Ga0068852_100516969 Ga0068852_1005169691 254
52 3300005617 Ga0068859_100001633 Ga0068859_1000016333 254
53 3300005617 Ga0068859_100486400 Ga0068859_1004864001 254
54 3300005618 Ga0068864_100365432 Ga0068864_1003654322 254
55 3300005718 Ga0068866_10000485 Ga0068866_1000048518 254
56 3300005719 Ga0068861_100000853 Ga0068861_1000008533 254
57 3300005840 Ga0068870_10040353 Ga0068870_100403533 254
58 3300005842 Ga0068858_100031100 Ga0068858_1000311005 254
59 3300005843 Ga0068860_100011979 Ga0068860_1000119793 254
60 3300005844 Ga0068862_100245188 Ga0068862_1002451882 254
61 3300006237 Ga0097621_100055936 Ga0097621_1000559363 254
62 3300006358 Ga0068871_100007397 Ga0068871_1000073973 254
63 3300006844 Ga0075428_100000602 Ga0075428_10000060213 254
64 3300006852 Ga0075433_10005230 Ga0075433_100052302 254
65 3300006871 Ga0075434_100085157 Ga0075434_1000851572 254
66 3300006880 Ga0075429_100002384 Ga0075429_1000023843 254
67 3300006881 Ga0068865_100051778 Ga0068865_1000517782 254
68 3300006914 Ga0075436_100002227 Ga0075436_10000222710 254
69 3300006931 Ga0097620_100001633 Ga0097620_1000016333 254
70 3300006931 Ga0097620_100486419 Ga0097620_1004864191 254
71 3300007076 Ga0075435_100000438 Ga0075435_1000004382 254
72 3300009093 Ga0105240_10693701 Ga0105240_106937012 254
73 3300009094 Ga0111539_10003451 Ga0111539_1000345117 254
74 3300009094 Ga0111539_10054814 Ga0111539_100548144 254
75 3300009098 Ga0105245_10000944 Ga0105245_100009442 254
76 3300009147 Ga0114129_10001652 Ga0114129_1000165211 254
77 3300009147 Ga0114129_10239171 Ga0114129_102391713 254
78 3300009148 Ga0105243_10000576 Ga0105243_100005763 254
79 3300009148 Ga0105243_10736124 Ga0105243_107361242 254
80 3300009176 Ga0105242_10101892 Ga0105242_101018922 254
81 3300009553 Ga0105249_10108380 Ga0105249_101083802 254
82 3300014745 Ga0157377_10058515 Ga0157377_100585152 254
83 3300014969 Ga0157376_10000797 Ga0157376_100007972 254
84 3300025899 Ga0207642_10013333 Ga0207642_100133332 254
85 3300025914 Ga0207671_10202282 Ga0207671_102022822 254
86 3300025917 Ga0207660_10004806 Ga0207660_100048064 254
87 3300025918 Ga0207662_10056537 Ga0207662_100565372 254
88 3300025918 Ga0207662_10318559 Ga0207662_103185592 254
89 3300025921 Ga0207652_10064194 Ga0207652_100641942 254
90 3300025923 Ga0207681_10517196 Ga0207681_105171961 254
91 3300025927 Ga0207687_10028966 Ga0207687_100289664 254
92 3300025934 Ga0207686_10029754 Ga0207686_100297543 254
93 3300025935 Ga0207709_10000515 Ga0207709_100005154 254
94 3300025936 Ga0207670_10041021 Ga0207670_100410213 254
95 3300025937 Ga0207669_10421061 Ga0207669_104210612 254
96 3300025938 Ga0207704_10022926 Ga0207704_100229262 254
97 3300025939 Ga0207665_10434923 Ga0207665_104349232 254
98 3300025942 Ga0207689_10001166 Ga0207689_1000116619 254
99 3300025942 Ga0207689_10069117 Ga0207689_100691174 254
100 3300025960 Ga0207651_10393557 Ga0207651_103935572 254
101 3300025981 Ga0207640_10053609 Ga0207640_100536093 254
102 3300026023 Ga0207677_10201663 Ga0207677_102016632 254
103 3300026035 Ga0207703_10002446 Ga0207703_1000244614 254
104 3300026075 Ga0207708_10012396 Ga0207708_100123962 254
105 3300026078 Ga0207702_10066725 Ga0207702_100667254 254
106 3300026089 Ga0207648_10121188 Ga0207648_101211882 254
107 3300026118 Ga0207675_100000564 Ga0207675_1000005642 254
108 3300027907 Ga0207428_10002128 Ga0207428_100021286 254
109 3300028381 Ga0268264_10505696 Ga0268264_105056962 254
110 3300031548 Ga0307408_100605125 Ga0307408_1006051252 254
111 3300034818 Ga0373950_0023477 Ga0373950_0023477_107_877 254
112 3300034819 Ga0373958_0006595 Ga0373958_0006595_216_986 254
113 3300035084 Ga0373928_0003811 Ga0373928_0003811_598_1368 254
114 3300035085 Ga0373929_0015039 Ga0373929_0015039_201_971 254
115 3300035111 Ga0373923_0038221 Ga0373923_0038221_600_1370 254
116 3300035112 Ga0373932_0013232 Ga0373932_0013232_640_1410 254
117 3300035113 Ga0373936_0010494 Ga0373936_0010494_1385_2155 254
118 3300035116 Ga0373945_0001129 Ga0373945_0001129_877_1671 254
119 3300035170 Ga0373943_0195502 Ga0373943_0195502_328_1098 254
120 3300035691 Ga0373931_0032500 Ga0373931_0032500_509_1279 254
121 3300035691 Ga0373931_0056573 Ga0373931_0056573_153_923 254
122 3300035692 Ga0373935_0020681 Ga0373935_0020681_1061_1855 254
123 3300035695 Ga0373927_0336980 Ga0373927_0336980_18_788 254
124 3300035725 Ga0373947_0006859 Ga0373947_0006859_4642_5412 254
125 3300042876 Ga0451577_0145267 Ga0451577_0145267_1207_1980 254
126 3300045051 Ga0451576_0296510 Ga0451576_0296510_54_848 254
127 3300046472 Ga0495580_0002018 Ga0495580_0002018_13349_14119 254
128 3300046526 Ga0495666_0008870 Ga0495666_0008870_3643_4413 254
129 3300046531 Ga0495665_0012134 Ga0495665_0012134_2526_3320 254
130 3300046539 Ga0495621_0059346 Ga0495621_0059346_17_787 254
131 3300046681 Ga0495647_0002247 Ga0495647_0002247_1874_2644 254
132 3300047321 Ga0495676_0117597 Ga0495676_0117597_894_1664 254
133 3300049742 Ga0501080_0497501 Ga0501080_0497501_118_888 254
134 3300050507 nmdc:mga05p37_2170_c1 nmdc:mga05p37_2170_c1_10515_11285 254
135 3300050508 nmdc:mga09592_193_c1 nmdc:mga09592_193_c1_29600_30370 254
136 3300050511 nmdc:mga08y16_23077_c1 nmdc:mga08y16_23077_c1_5446_6216 254
137 3300050511 nmdc:mga08y16_262_c1 nmdc:mga08y16_262_c1_24020_24790 254
138 3300050512 nmdc:mga0n895_53927_c1 nmdc:mga0n895_53927_c1_221_991 254
139 3300050513 nmdc:mga0rr50_209962_c1 nmdc:mga0rr50_209962_c1_614_1384 254
140 3300050514 nmdc:mga08x19_14376_c1 nmdc:mga08x19_14376_c1_2272_3042 254
141 3300050515 nmdc:mga0a205_1117_c1 nmdc:mga0a205_1117_c1_18288_19058 254
142 3300050515 nmdc:mga0a205_341336_c1 nmdc:mga0a205_341336_c1_89_859 254
143 iso_pu_bacteria 2821443989 2821448462 257
144 3300005355 Ga0070671_100010289 Ga0070671_1000102893 258
145 3300005543 Ga0070672_100014087 Ga0070672_1000140872 258
146 3300005843 Ga0068860_100352962 Ga0068860_1003529622 258
147 3300025933 Ga0207706_10046268 Ga0207706_100462684 258
148 3300025940 Ga0207691_10023580 Ga0207691_100235802 258
149 3300025945 Ga0207679_10032761 Ga0207679_100327613 258
150 3300026035 Ga0207703_10120015 Ga0207703_101200152 258
151 3300026142 Ga0207698_10171437 Ga0207698_101714372 258
152 3300027552 Ga0209982_1009593 Ga0209982_10095932 258
153 3300027665 Ga0209983_1004525 Ga0209983_10045253 258
154 3300027682 Ga0209971_1024395 Ga0209971_10243952 258
155 3300027876 Ga0209974_10000388 Ga0209974_1000038810 258
156 3300048907 Ga0496104_0398469 Ga0496104_0398469_295_1074 258
157 3300048909 Ga0496106_0085071 Ga0496106_0085071_1555_2331 258
158 3300006871 Ga0075434_100247992 Ga0075434_1002479923 259
159 3300013307 Ga0157372_10338025 Ga0157372_103380252 259
160 3300031824 Ga0307413_10066343 Ga0307413_100663432 259
161 3300050512 nmdc:mga0n895_232177_c1 nmdc:mga0n895_232177_c1_309_1088 259
162 3300005356 Ga0070674_100163424 Ga0070674_1001634242 260
163 3300005364 Ga0070673_100092350 Ga0070673_1000923501 260
164 3300005367 Ga0070667_100004919 Ga0070667_1000049197 260
165 3300005367 Ga0070667_100037796 Ga0070667_1000377962 260
166 3300005456 Ga0070678_100024961 Ga0070678_1000249613 260
167 3300005459 Ga0068867_100387442 Ga0068867_1003874421 260
168 3300005468 Ga0070707_100740903 Ga0070707_1007409032 260
169 3300005543 Ga0070672_100013687 Ga0070672_1000136874 260
170 3300005548 Ga0070665_100013659 Ga0070665_1000136594 260
171 3300005577 Ga0068857_100046789 Ga0068857_1000467891 260
172 3300005617 Ga0068859_100083674 Ga0068859_1000836742 260
173 3300005618 Ga0068864_100550979 Ga0068864_1005509792 260
174 3300005843 Ga0068860_100832521 Ga0068860_1008325212 260
175 3300005985 Ga0081539_10127382 Ga0081539_101273822 260
176 3300006847 Ga0075431_100008190 Ga0075431_1000081902 260
177 3300006931 Ga0097620_100083685 Ga0097620_1000836852 260
178 3300009147 Ga0114129_10526922 Ga0114129_105269222 260
179 3300009177 Ga0105248_10056706 Ga0105248_100567061 260
180 3300013296 Ga0157374_10153023 Ga0157374_101530233 260
181 3300013308 Ga0157375_10135518 Ga0157375_101355182 260
182 3300013308 Ga0157375_10257872 Ga0157375_102578721 260
183 3300014325 Ga0163163_10014074 Ga0163163_100140744 260
184 3300014968 Ga0157379_10040595 Ga0157379_100405951 260
185 3300014969 Ga0157376_10136174 Ga0157376_101361743 260
186 3300025918 Ga0207662_10169022 Ga0207662_101690222 260
187 3300025923 Ga0207681_10086435 Ga0207681_100864351 260
188 3300025925 Ga0207650_10082918 Ga0207650_100829182 260
189 3300025933 Ga0207706_10196785 Ga0207706_101967852 260
190 3300025938 Ga0207704_10102093 Ga0207704_101020931 260
191 3300025938 Ga0207704_10304627 Ga0207704_103046271 260
192 3300025941 Ga0207711_10286932 Ga0207711_102869322 260
193 3300025945 Ga0207679_10546825 Ga0207679_105468251 260
194 3300025960 Ga0207651_10074685 Ga0207651_100746853 260
195 3300025972 Ga0207668_10248535 Ga0207668_102485351 260
196 3300026035 Ga0207703_10023868 Ga0207703_100238682 260
197 3300026035 Ga0207703_10369916 Ga0207703_103699162 260
198 3300026088 Ga0207641_10407038 Ga0207641_104070382 260
199 3300026089 Ga0207648_10021215 Ga0207648_100212151 260
200 3300026095 Ga0207676_10161167 Ga0207676_101611672 260
201 3300026121 Ga0207683_10040510 Ga0207683_100405103 260
202 3300028379 Ga0268266_10313817 Ga0268266_103138172 260
203 3300028380 Ga0268265_10004995 Ga0268265_100049951 260
204 3300028381 Ga0268264_10034214 Ga0268264_100342142 260
205 3300035692 Ga0373935_0148764 Ga0373935_0148764_768_1577 260
206 3300037068 Ga0373925_0223018 Ga0373925_0223018_697_1479 260
207 3300048905 Ga0496102_0470292 Ga0496102_0470292_297_1079 260
208 3300005293 Ga0065715_10111531 Ga0065715_101115312 261
209 3300005328 Ga0070676_10330853 Ga0070676_103308532 261
210 3300005330 Ga0070690_100049474 Ga0070690_1000494742 261
211 3300005331 Ga0070670_100014823 Ga0070670_1000148232 261
212 3300005331 Ga0070670_100077764 Ga0070670_1000777642 261
213 3300005331 Ga0070670_100165509 Ga0070670_1001655092 261
214 3300005331 Ga0070670_100236372 Ga0070670_1002363722 261
215 3300005334 Ga0068869_100004298 Ga0068869_1000042983 261
216 3300005335 Ga0070666_10085117 Ga0070666_100851172 261
217 3300005336 Ga0070680_100351406 Ga0070680_1003514062 261
218 3300005338 Ga0068868_100011298 Ga0068868_1000112985 261
219 3300005340 Ga0070689_100300577 Ga0070689_1003005772 261
220 3300005344 Ga0070661_100421558 Ga0070661_1004215582 261
221 3300005347 Ga0070668_100001341 Ga0070668_10000134110 261
222 3300005347 Ga0070668_100013667 Ga0070668_1000136672 261
223 3300005347 Ga0070668_100362326 Ga0070668_1003623261 261
224 3300005353 Ga0070669_100000668 Ga0070669_1000006684 261
225 3300005353 Ga0070669_100046538 Ga0070669_1000465383 261
226 3300005353 Ga0070669_100198613 Ga0070669_1001986131 261
227 3300005353 Ga0070669_100279268 Ga0070669_1002792682 261
228 3300005353 Ga0070669_100281900 Ga0070669_1002819001 261
229 3300005354 Ga0070675_100001258 Ga0070675_10000125815 261
230 3300005354 Ga0070675_100051570 Ga0070675_1000515702 261
231 3300005355 Ga0070671_100092362 Ga0070671_1000923622 261
232 3300005364 Ga0070673_100015219 Ga0070673_1000152195 261
233 3300005365 Ga0070688_100038958 Ga0070688_1000389583 261
234 3300005367 Ga0070667_100005264 Ga0070667_1000052646 261
235 3300005367 Ga0070667_100095033 Ga0070667_1000950332 261
236 3300005441 Ga0070700_100496299 Ga0070700_1004962991 261
237 3300005444 Ga0070694_100022197 Ga0070694_1000221974 261
238 3300005444 Ga0070694_100229579 Ga0070694_1002295792 261
239 3300005445 Ga0070708_100000538 Ga0070708_10000053817 261
240 3300005445 Ga0070708_100003225 Ga0070708_10000322512 261
241 3300005445 Ga0070708_100477347 Ga0070708_1004773471 261
242 3300005455 Ga0070663_100058005 Ga0070663_1000580053 261
243 3300005456 Ga0070678_100003201 Ga0070678_1000032015 261
244 3300005456 Ga0070678_100042104 Ga0070678_1000421042 261
245 3300005459 Ga0068867_100000975 Ga0068867_1000009756 261
246 3300005459 Ga0068867_100061803 Ga0068867_1000618034 261
247 3300005459 Ga0068867_100241645 Ga0068867_1002416452 261
248 3300005467 Ga0070706_100314631 Ga0070706_1003146311 261
249 3300005518 Ga0070699_100456665 Ga0070699_1004566651 261
250 3300005536 Ga0070697_100091416 Ga0070697_1000914162 261
251 3300005539 Ga0068853_100110480 Ga0068853_1001104803 261
252 3300005539 Ga0068853_100283465 Ga0068853_1002834652 261
253 3300005543 Ga0070672_100000287 Ga0070672_10000028711 261
254 3300005543 Ga0070672_100005272 Ga0070672_1000052726 261
255 3300005546 Ga0070696_100084812 Ga0070696_1000848122 261
256 3300005548 Ga0070665_100008986 Ga0070665_1000089867 261
257 3300005563 Ga0068855_100083397 Ga0068855_1000833973 261
258 3300005564 Ga0070664_100062389 Ga0070664_1000623893 261
259 3300005564 Ga0070664_100173075 Ga0070664_1001730752 261
260 3300005578 Ga0068854_100098147 Ga0068854_1000981472 261
261 3300005614 Ga0068856_100021812 Ga0068856_1000218126 261
262 3300005616 Ga0068852_100151372 Ga0068852_1001513722 261
263 3300005617 Ga0068859_100050936 Ga0068859_1000509365 261
264 3300005617 Ga0068859_100063117 Ga0068859_1000631172 261
265 3300005617 Ga0068859_100216526 Ga0068859_1002165262 261
266 3300005618 Ga0068864_100003577 Ga0068864_10000357711 261
267 3300005618 Ga0068864_100005258 Ga0068864_1000052588 261
268 3300005618 Ga0068864_100046033 Ga0068864_1000460333 261
269 3300005719 Ga0068861_100027365 Ga0068861_1000273653 261
270 3300005719 Ga0068861_100240065 Ga0068861_1002400652 261
271 3300005841 Ga0068863_100001368 Ga0068863_10000136816 261
272 3300005841 Ga0068863_100428358 Ga0068863_1004283582 261
273 3300005841 Ga0068863_100738773 Ga0068863_1007387732 261
274 3300005842 Ga0068858_100006176 Ga0068858_1000061766 261
275 3300005842 Ga0068858_100016320 Ga0068858_1000163206 261
276 3300005842 Ga0068858_100153373 Ga0068858_1001533732 261
277 3300005843 Ga0068860_100004808 Ga0068860_1000048084 261
278 3300005843 Ga0068860_100091904 Ga0068860_1000919042 261
279 3300005843 Ga0068860_100138622 Ga0068860_1001386223 261
280 3300005844 Ga0068862_100034244 Ga0068862_1000342442 261
281 3300005844 Ga0068862_100050180 Ga0068862_1000501804 261
282 3300005844 Ga0068862_100118197 Ga0068862_1001181972 261
283 3300005844 Ga0068862_100272594 Ga0068862_1002725941 261
284 3300006042 Ga0075368_10003446 Ga0075368_100034463 261
285 3300006178 Ga0075367_10035836 Ga0075367_100358363 261
286 3300006186 Ga0075369_10069329 Ga0075369_100693292 261
287 3300006237 Ga0097621_100008005 Ga0097621_1000080056 261
288 3300006237 Ga0097621_100066231 Ga0097621_1000662312 261
289 3300006237 Ga0097621_100450904 Ga0097621_1004509042 261
290 3300006353 Ga0075370_10018238 Ga0075370_100182384 261
291 3300006358 Ga0068871_100000834 Ga0068871_1000008346 261
292 3300006358 Ga0068871_100216817 Ga0068871_1002168172 261
293 3300006844 Ga0075428_100157357 Ga0075428_1001573572 261
294 3300006844 Ga0075428_100530836 Ga0075428_1005308361 261
295 3300006846 Ga0075430_100018438 Ga0075430_1000184384 261
296 3300006847 Ga0075431_100065119 Ga0075431_1000651194 261
297 3300006852 Ga0075433_10005479 Ga0075433_100054796 261
298 3300006852 Ga0075433_10540591 Ga0075433_105405912 261
299 3300006871 Ga0075434_100010081 Ga0075434_1000100811 261
300 3300006871 Ga0075434_100035645 Ga0075434_1000356455 261
301 3300006871 Ga0075434_100087823 Ga0075434_1000878232 261
302 3300006871 Ga0075434_100244727 Ga0075434_1002447273 261
303 3300006871 Ga0075434_100648714 Ga0075434_1006487142 261
304 3300006880 Ga0075429_100175665 Ga0075429_1001756652 261
305 3300006881 Ga0068865_100245756 Ga0068865_1002457561 261
306 3300006914 Ga0075436_100022540 Ga0075436_1000225404 261
307 3300006914 Ga0075436_100066204 Ga0075436_1000662042 261
308 3300006931 Ga0097620_100050936 Ga0097620_1000509365 261
309 3300006931 Ga0097620_100063116 Ga0097620_1000631162 261
310 3300006931 Ga0097620_100216535 Ga0097620_1002165352 261
311 3300007076 Ga0075435_100018242 Ga0075435_1000182422 261
312 3300009011 Ga0105251_10086280 Ga0105251_100862802 261
313 3300009093 Ga0105240_10146257 Ga0105240_101462572 261
314 3300009094 Ga0111539_10182697 Ga0111539_101826972 261
315 3300009098 Ga0105245_10402157 Ga0105245_104021572 261
316 3300009147 Ga0114129_10762918 Ga0114129_107629182 261
317 3300009148 Ga0105243_10019715 Ga0105243_100197156 261
318 3300009148 Ga0105243_10311362 Ga0105243_103113621 261
319 3300009148 Ga0105243_10335026 Ga0105243_103350262 261
320 3300009176 Ga0105242_10145836 Ga0105242_101458362 261
321 3300009177 Ga0105248_10017795 Ga0105248_100177954 261
322 3300009177 Ga0105248_10070234 Ga0105248_100702343 261
323 3300009177 Ga0105248_10337262 Ga0105248_103372622 261
324 3300009177 Ga0105248_10555250 Ga0105248_105552502 261
325 3300009553 Ga0105249_10421148 Ga0105249_104211482 261
326 3300010375 Ga0105239_10027181 Ga0105239_100271816 261
327 3300013296 Ga0157374_10003813 Ga0157374_1000381311 261
328 3300013297 Ga0157378_10007092 Ga0157378_1000709211 261
329 3300013297 Ga0157378_10110726 Ga0157378_101107262 261
330 3300013306 Ga0163162_10003831 Ga0163162_100038314 261
331 3300013306 Ga0163162_10018668 Ga0163162_100186687 261
332 3300013306 Ga0163162_10158115 Ga0163162_101581152 261
333 3300013306 Ga0163162_10173898 Ga0163162_101738983 261
334 3300013308 Ga0157375_10003753 Ga0157375_100037539 261
335 3300013308 Ga0157375_10005930 Ga0157375_100059307 261
336 3300013308 Ga0157375_10352924 Ga0157375_103529242 261
337 3300014325 Ga0163163_10038318 Ga0163163_100383183 261
338 3300014325 Ga0163163_10484347 Ga0163163_104843472 261
339 3300014326 Ga0157380_10098924 Ga0157380_100989242 261
340 3300014326 Ga0157380_10132403 Ga0157380_101324033 261
341 3300014968 Ga0157379_10000858 Ga0157379_1000085827 261
342 3300014968 Ga0157379_10028643 Ga0157379_100286435 261
343 3300014968 Ga0157379_10104870 Ga0157379_101048704 261
344 3300014969 Ga0157376_10000986 Ga0157376_1000098612 261
345 3300014969 Ga0157376_10046493 Ga0157376_100464933 261
346 3300017792 Ga0163161_10022856 Ga0163161_100228564 261
347 3300017792 Ga0163161_10050915 Ga0163161_100509153 261
348 3300017792 Ga0163161_10298116 Ga0163161_102981162 261
349 3300025315 Ga0207697_10051367 Ga0207697_100513672 261
350 3300025907 Ga0207645_10000157 Ga0207645_1000015716 261
351 3300025910 Ga0207684_10013485 Ga0207684_100134858 261
352 3300025913 Ga0207695_10338316 Ga0207695_103383162 261
353 3300025920 Ga0207649_10334165 Ga0207649_103341652 261
354 3300025922 Ga0207646_10030223 Ga0207646_100302235 261
355 3300025923 Ga0207681_10034153 Ga0207681_100341534 261
356 3300025923 Ga0207681_10051406 Ga0207681_100514063 261
357 3300025923 Ga0207681_10062517 Ga0207681_100625172 261
358 3300025923 Ga0207681_10098674 Ga0207681_100986741 261
359 3300025925 Ga0207650_10005693 Ga0207650_100056933 261
360 3300025925 Ga0207650_10023375 Ga0207650_100233751 261
361 3300025925 Ga0207650_10115176 Ga0207650_101151762 261
362 3300025925 Ga0207650_10274734 Ga0207650_102747341 261
363 3300025926 Ga0207659_10006435 Ga0207659_1000643510 261
364 3300025926 Ga0207659_10014554 Ga0207659_100145542 261
365 3300025931 Ga0207644_10012783 Ga0207644_100127833 261
366 3300025931 Ga0207644_10019823 Ga0207644_100198233 261
367 3300025933 Ga0207706_10184281 Ga0207706_101842812 261
368 3300025934 Ga0207686_10100126 Ga0207686_101001262 261
369 3300025935 Ga0207709_10011114 Ga0207709_100111142 261
370 3300025937 Ga0207669_10047016 Ga0207669_100470162 261
371 3300025937 Ga0207669_10453032 Ga0207669_104530322 261
372 3300025938 Ga0207704_10147208 Ga0207704_101472082 261
373 3300025940 Ga0207691_10000249 Ga0207691_1000024939 261
374 3300025940 Ga0207691_10006443 Ga0207691_100064437 261
375 3300025941 Ga0207711_10026251 Ga0207711_100262513 261
376 3300025941 Ga0207711_10058461 Ga0207711_100584612 261
377 3300025942 Ga0207689_10009790 Ga0207689_100097908 261
378 3300025949 Ga0207667_10498472 Ga0207667_104984722 261
379 3300025960 Ga0207651_10018887 Ga0207651_100188874 261
380 3300025961 Ga0207712_10022600 Ga0207712_100226004 261
381 3300025972 Ga0207668_10004378 Ga0207668_100043785 261
382 3300025972 Ga0207668_10024536 Ga0207668_100245363 261
383 3300025972 Ga0207668_10091756 Ga0207668_100917563 261
384 3300025972 Ga0207668_10094552 Ga0207668_100945523 261
385 3300025981 Ga0207640_10197883 Ga0207640_101978832 261
386 3300025986 Ga0207658_10093160 Ga0207658_100931602 261
387 3300026023 Ga0207677_10058613 Ga0207677_100586132 261
388 3300026035 Ga0207703_10002253 Ga0207703_1000225312 261
389 3300026035 Ga0207703_10021879 Ga0207703_100218794 261
390 3300026035 Ga0207703_10288732 Ga0207703_102887322 261
391 3300026041 Ga0207639_10041011 Ga0207639_100410113 261
392 3300026067 Ga0207678_10123279 Ga0207678_101232792 261
393 3300026075 Ga0207708_10064825 Ga0207708_100648251 261
394 3300026075 Ga0207708_10425440 Ga0207708_104254402 261
395 3300026088 Ga0207641_10000374 Ga0207641_1000037436 261
396 3300026088 Ga0207641_10203479 Ga0207641_102034793 261
397 3300026088 Ga0207641_10490734 Ga0207641_104907342 261
398 3300026089 Ga0207648_10000523 Ga0207648_100005236 261
399 3300026089 Ga0207648_10013639 Ga0207648_100136394 261
400 3300026089 Ga0207648_10229450 Ga0207648_102294502 261
401 3300026089 Ga0207648_10432299 Ga0207648_104322992 261
402 3300026095 Ga0207676_10001665 Ga0207676_1000166512 261
403 3300026095 Ga0207676_10008789 Ga0207676_100087895 261
404 3300026095 Ga0207676_10016930 Ga0207676_100169304 261
405 3300026118 Ga0207675_100024242 Ga0207675_1000242427 261
406 3300026118 Ga0207675_100040177 Ga0207675_1000401772 261
407 3300026118 Ga0207675_100108631 Ga0207675_1001086312 261
408 3300026118 Ga0207675_100615189 Ga0207675_1006151891 261
409 3300026121 Ga0207683_10000476 Ga0207683_1000047610 261
410 3300026121 Ga0207683_10044604 Ga0207683_100446045 261
411 3300026121 Ga0207683_10372961 Ga0207683_103729612 261
412 3300026142 Ga0207698_10479790 Ga0207698_104797902 261
413 3300028379 Ga0268266_10004526 Ga0268266_1000452612 261
414 3300028379 Ga0268266_10338513 Ga0268266_103385132 261
415 3300028380 Ga0268265_10024395 Ga0268265_100243952 261
416 3300028380 Ga0268265_10072810 Ga0268265_100728102 261
417 3300028380 Ga0268265_10084594 Ga0268265_100845942 261
418 3300028380 Ga0268265_10623173 Ga0268265_106231731 261
419 3300028381 Ga0268264_10007867 Ga0268264_100078672 261
420 3300028381 Ga0268264_10008187 Ga0268264_100081872 261
421 3300028381 Ga0268264_10111092 Ga0268264_101110923 261
422 3300028381 Ga0268264_10311816 Ga0268264_103118162 261
423 3300031251 Ga0265327_10028220 Ga0265327_100282203 261
424 3300035691 Ga0373931_0009521 Ga0373931_0009521_1657_2445 261
425 3300036401 Ga0373937_0158684 Ga0373937_0158684_665_1483 261
426 3300042876 Ga0451577_0389925 Ga0451577_0389925_207_992 261
427 3300048915 Ga0496112_0012289 Ga0496112_0012289_4868_5671 261
428 3300048916 Ga0496113_0169277 Ga0496113_0169277_515_1318 261
429 3300049574 Ga0501038_0251364 Ga0501038_0251364_518_1306 261
430 3300049575 Ga0501039_0292174 Ga0501039_0292174_372_1160 261
431 3300049576 Ga0501040_0003556 Ga0501040_0003556_8510_9298 261
432 3300049578 Ga0501042_0027494 Ga0501042_0027494_3077_3865 261
433 3300049581 Ga0501047_0534844 Ga0501047_0534844_132_929 261
434 3300049582 Ga0501048_0020006 Ga0501048_0020006_4050_4838 261
435 3300049587 Ga0501071_0031121 Ga0501071_0031121_120_908 261
436 3300049588 Ga0501072_0261436 Ga0501072_0261436_522_1310 261
437 3300049589 Ga0501073_0174509 Ga0501073_0174509_123_911 261
438 3300049591 Ga0501075_0000740 Ga0501075_0000740_16078_16866 261
439 3300049592 Ga0501076_0226369 Ga0501076_0226369_122_910 261
440 3300049742 Ga0501080_0048109 Ga0501080_0048109_746_1534 261
441 3300049743 Ga0501081_0118012 Ga0501081_0118012_869_1657 261
442 3300049743 Ga0501081_0120592 Ga0501081_0120592_521_1309 261
443 3300049744 Ga0501083_0036465 Ga0501083_0036465_336_1124 261
444 3300049822 Ga0501035_0094929 Ga0501035_0094929_805_1593 261
445 3300049824 Ga0501045_0011981 Ga0501045_0011981_661_1449 261
446 3300049824 Ga0501045_0188883 Ga0501045_0188883_734_1522 261
447 3300050496 nmdc:mga07m45_11542_c1 nmdc:mga07m45_11542_c1_3373_4164 261
448 3300050507 nmdc:mga05p37_198820_c1 nmdc:mga05p37_198820_c1_379_1164 261
449 3300050507 nmdc:mga05p37_302821_c1 nmdc:mga05p37_302821_c1_1084_1872 261
450 3300050511 nmdc:mga08y16_514191_c1 nmdc:mga08y16_514191_c1_310_1095 261
451 3300050512 nmdc:mga0n895_124289_c1 nmdc:mga0n895_124289_c1_152_940 261
452 3300050512 nmdc:mga0n895_39828_c1 nmdc:mga0n895_39828_c1_119_907 261
453 3300050512 nmdc:mga0n895_696720_c1 nmdc:mga0n895_696720_c1_121_906 261
454 3300050513 nmdc:mga0rr50_262647_c1 nmdc:mga0rr50_262647_c1_198_986 261
455 3300050514 nmdc:mga08x19_27911_c1 nmdc:mga08x19_27911_c1_2116_2910 261
456 3300050514 nmdc:mga08x19_55025_c1 nmdc:mga08x19_55025_c1_1184_1972 261
457 3300050515 nmdc:mga0a205_111208_c1 nmdc:mga0a205_111208_c1_1828_2613 261
458 3300050515 nmdc:mga0a205_207545_c1 nmdc:mga0a205_207545_c1_158_943 261
459 3300050515 nmdc:mga0a205_22451_c1 nmdc:mga0a205_22451_c1_4440_5228 261
460 3300053153 Ga0500616_0081761 Ga0500616_0081761_522_1310 261
461 3300054114 Ga0501084_0037861 Ga0501084_0037861_21_809 261
462 3300060353 Ga0501082_0006109 Ga0501082_0006109_11_799 261
463 3300061734 Ga0530510_0004686 Ga0530510_0004686_6523_7311 261
464 3300061734 Ga0530510_0222571 Ga0530510_0222571_599_1384 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

35

175

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9459 3 222
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9417 3 222
7cad-assembly1.cif.gz_D mycobacterium smegmatis sugabc complex 0.9413 3 222
4jbw-assembly1.cif.gz_A crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.9381 3 222
8ja7-assembly1.cif.gz_D cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.9369 1 222
ID Description Score Start End Superfamily
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.988 4 247 3.40.50.300
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9718 4 247 3.40.50.300
af_Q47538_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9362 4 239 3.40.50.300
af_Q8T665_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9354 1 226 3.40.50.300
af_P77737_9_333_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9327 1 211 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A858WY56-F1-model_v4 ABC transporter ATP-binding protein 0.9909 4 257 GO:0005524
GO:0016887
AF-Q9AKT5-F1-model_v4 Putative ABC-transporter 0.9812 36 254 GO:0005524
GO:0016887
AF-A0A1Z8P518-F1-model_v4 ABC transporter ATP-binding protein 0.9789 2 251 GO:0005524
GO:0016887
AF-A0A1Q6DVK8-F1-model_v4 ABC-type nitrate/sulfonate/bicarbonate transport system ATPase component 0.9777 1 251 GO:0005524
GO:0016887
AF-A0A536PA20-F1-model_v4 ABC transporter ATP-binding protein 0.9776 1 253 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
92.6 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map