F449234

General Info

Members Datasets Scaffolds Average Seq Length
464 226 928 309

Family's Representative Sequence

Representative Sequence 3300003911|JGI25405J52794_10003831|JGI25405J52794_100038311
Length 324
Sequence VTMAIDQSLPKKIAVLMGGPGSERDVSLATGRGVSXALRSLGAEVVEVDVHDENFALPKDVDLAFNTIHGTFGEDGQLQKILEDRGVPYTGDGVEASRAAFDKILSKEKFREHNVVTPEWEVIEVGERPTIPIPLVVKPARQGSTVGVVIVKNESELDSAMAEAGKYDGKLLIETFVPGRELTIGVLGDQALPILEIIPKGGFYDFNNKYPFLNPQAGGGAEHVCPAKIDPKKTKQIQELALSAFRALGLVVYGRVDVLLTDSGEPFVLEVNNIPGMTEASLLPEAAAAAGINYLDLCARIIALSRLRQGYGGQARTRTEGSRR

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
161 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
181 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
211 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
212 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
213 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
214 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
215 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
216 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.7
Rhizosphere 89.87
Stem 0
Stem Tuber 0
Unclassified 1.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10003831 3300003911 Bacteria 2662
2 SwRhRL2b_contig_537134 2162886007 Bacteria 5802
3 JGI24035J26624_1001491 3300002126 Unclassified 2209
4 JGI24035J26624_1002886 3300002126 Unclassified 1606
5 JGI25406J46586_10000002 3300003203 Bacteria 202415
6 JGI25405J52794_10000742 3300003911 Bacteria 4982
7 JGI25405J52794_10024411 3300003911 Bacteria 1235
8 Ga0065704_10005841 3300005289 Bacteria 5898
9 Ga0065712_10005843 3300005290 Bacteria 4345
10 Ga0065712_10008781 3300005290 Bacteria 4140
11 Ga0065712_10013008 3300005290 Bacteria 2511
12 Ga0065712_10094757 3300005290 Bacteria 2242
13 Ga0065712_10110969 3300005290 Bacteria 1826
14 Ga0065715_10002858 3300005293 Bacteria 8746
15 Ga0065715_10007736 3300005293 Bacteria 2608
16 Ga0065715_10090678 3300005293 Bacteria 6634
17 Ga0065715_10096882 3300005293 Bacteria 3802
18 Ga0065707_10003406 3300005295 Bacteria 11705
19 Ga0065707_10109883 3300005295 Bacteria 2449
20 Ga0070676_10004299 3300005328 Bacteria 7483
21 Ga0070676_10029955 3300005328 Bacteria 3099
22 Ga0070676_10059228 3300005328 Bacteria 2271
23 Ga0070683_100077069 3300005329 Bacteria 3117
24 Ga0070683_100142838 3300005329 Bacteria 2267
25 Ga0070690_100128198 3300005330 Bacteria 1711
26 Ga0070670_100098952 3300005331 Bacteria 2510
27 Ga0070677_10064860 3300005333 Bacteria 1518
28 Ga0070666_10012249 3300005335 Bacteria 5404
29 Ga0070666_10049854 3300005335 Bacteria 2815
30 Ga0070666_10062821 3300005335 Bacteria 2517
31 Ga0070680_100125277 3300005336 Bacteria 2146
32 Ga0068868_100368921 3300005338 Bacteria 1233
33 Ga0070660_100205556 3300005339 Bacteria 1598
34 Ga0070660_100316377 3300005339 Bacteria 1281
35 Ga0070689_100008313 3300005340 Bacteria 7306
36 Ga0070687_100041849 3300005343 Bacteria 2318
37 Ga0070687_100059423 3300005343 Bacteria 2013
38 Ga0070661_100017032 3300005344 Bacteria 5149
39 Ga0070668_100002801 3300005347 Bacteria 12829
40 Ga0070668_100019221 3300005347 Bacteria 5140
41 Ga0070668_100262977 3300005347 Bacteria 1435
42 Ga0070669_100078390 3300005353 Bacteria 2455
43 Ga0070675_100002080 3300005354 Bacteria 14811
44 Ga0070675_100005525 3300005354 Bacteria 9676
45 Ga0070671_100015835 3300005355 Bacteria 6091
46 Ga0070671_100070794 3300005355 Bacteria 2910
47 Ga0070671_100327028 3300005355 Bacteria 1307
48 Ga0070674_100046932 3300005356 Bacteria 2957
49 Ga0070673_100166975 3300005364 Bacteria 1876
50 Ga0070673_100349969 3300005364 Bacteria 1311
51 Ga0070673_100359786 3300005364 Unclassified 1293
52 Ga0070688_100012161 3300005365 Bacteria 4813
53 Ga0070688_100037533 3300005365 Bacteria 2952
54 Ga0070688_100197390 3300005365 Bacteria 1406
55 Ga0070659_100003065 3300005366 Bacteria 11864
56 Ga0070667_100011964 3300005367 Bacteria 7179
57 Ga0070667_100016903 3300005367 Bacteria 6037
58 Ga0070667_100370912 3300005367 Bacteria 1299
59 Ga0070709_10014239 3300005434 Bacteria 4495
60 Ga0070714_100020315 3300005435 Bacteria 5421
61 Ga0070714_100340071 3300005435 Bacteria 1407
62 Ga0070710_10007997 3300005437 Bacteria 5140
63 Ga0070710_10051015 3300005437 Bacteria 2321
64 Ga0070710_10226041 3300005437 Bacteria 1193
65 Ga0070711_100012862 3300005439 Bacteria 5242
66 Ga0070705_100041309 3300005440 Bacteria 2629
67 Ga0070694_100107311 3300005444 Bacteria 1984
68 Ga0070694_100157408 3300005444 Bacteria 1664
69 Ga0070708_100002835 3300005445 Bacteria 13466
70 Ga0070708_100161158 3300005445 Bacteria 2090
71 Ga0070708_100251415 3300005445 Bacteria 1661
72 Ga0070663_100040379 3300005455 Bacteria 3266
73 Ga0070678_100040441 3300005456 Bacteria 3299
74 Ga0070678_100040748 3300005456 Bacteria 3288
75 Ga0070678_100163930 3300005456 Bacteria 1804
76 Ga0070678_100206188 3300005456 Bacteria 1626
77 Ga0070662_100033708 3300005457 Bacteria 3607
78 Ga0070662_100042636 3300005457 Bacteria 3242
79 Ga0070662_100119734 3300005457 Bacteria 2016
80 Ga0070662_100212783 3300005457 Bacteria 1539
81 Ga0070662_100385820 3300005457 Unclassified 1154
82 Ga0068867_100442007 3300005459 Bacteria 1106
83 Ga0070706_100000072 3300005467 Bacteria 117347
84 Ga0070706_100013428 3300005467 Bacteria 7572
85 Ga0070706_100028652 3300005467 Bacteria 5128
86 Ga0070706_100036970 3300005467 Bacteria 4510
87 Ga0070706_100143293 3300005467 Bacteria 2231
88 Ga0070706_100202837 3300005467 Bacteria 1852
89 Ga0070706_100234429 3300005467 Bacteria 1713
90 Ga0070707_100000109 3300005468 Bacteria 75892
91 Ga0070707_100010305 3300005468 Bacteria 8702
92 Ga0070707_100012075 3300005468 Bacteria 8064
93 Ga0070707_100020967 3300005468 Bacteria 6170
94 Ga0070707_100021256 3300005468 Bacteria 6134
95 Ga0070698_100002781 3300005471 Bacteria 19252
96 Ga0070698_100004236 3300005471 Bacteria 15762
97 Ga0070698_100113023 3300005471 Bacteria 2680
98 Ga0070698_100331975 3300005471 Bacteria 1452
99 Ga0070698_100391779 3300005471 Bacteria 1322
100 Ga0070679_100182331 3300005530 Bacteria 2071
101 Ga0070684_100000339 3300005535 Bacteria 32322
102 Ga0070684_100082081 3300005535 Bacteria 2853
103 Ga0070697_100000972 3300005536 Bacteria 21638
104 Ga0070697_100003517 3300005536 Bacteria 12036
105 Ga0070697_100012199 3300005536 Bacteria 6730
106 Ga0070697_100018079 3300005536 Bacteria 5555
107 Ga0068853_100000007 3300005539 Bacteria 283307
108 Ga0070672_100007881 3300005543 Bacteria 7270
109 Ga0070696_100060876 3300005546 Bacteria 2640
110 Ga0070696_100122154 3300005546 Bacteria 1886
111 Ga0070665_100013354 3300005548 Bacteria 8267
112 Ga0070665_100096203 3300005548 Bacteria 2966
113 Ga0070665_100171812 3300005548 Unclassified 2168
114 Ga0070665_100177692 3300005548 Bacteria 2130
115 Ga0070704_100000846 3300005549 Bacteria 15252
116 Ga0068855_100002704 3300005563 Bacteria 21852
117 Ga0070664_100026287 3300005564 Bacteria 4827
118 Ga0068856_100045169 3300005614 Bacteria 4336
119 Ga0068856_100049749 3300005614 Bacteria 4132
120 Ga0068859_100022585 3300005617 Bacteria 6309
121 Ga0068859_100251893 3300005617 Bacteria 1856
122 Ga0068864_100177440 3300005618 Bacteria 1946
123 Ga0068866_10005310 3300005718 Bacteria 5309
124 Ga0068863_100110509 3300005841 Bacteria 2617
125 Ga0068858_100009463 3300005842 Bacteria 9295
126 Ga0068858_100018642 3300005842 Bacteria 6497
127 Ga0068858_100127417 3300005842 Bacteria 2385
128 Ga0068860_100012835 3300005843 Bacteria 8236
129 Ga0068860_100027033 3300005843 Bacteria 5528
130 Ga0068860_100266871 3300005843 Bacteria 1670
131 Ga0081455_10001013 3300005937 Bacteria 35565
132 Ga0081455_10001533 3300005937 Bacteria 28455
133 Ga0081455_10001733 3300005937 Bacteria 26391
134 Ga0081455_10029326 3300005937 Bacteria 5017
135 Ga0081455_10077655 3300005937 Bacteria 2730
136 Ga0081455_10080867 3300005937 Bacteria 2663
137 Ga0081540_1000219 3300005983 Bacteria 60720
138 Ga0081540_1094052 3300005983 Bacteria 1310
139 Ga0081539_10000061 3300005985 Bacteria 250890
140 Ga0081539_10005093 3300005985 Bacteria 13767
141 Ga0081539_10010581 3300005985 Bacteria 7460
142 Ga0081539_10018032 3300005985 Bacteria 4921
143 Ga0081539_10107076 3300005985 Bacteria 1414
144 Ga0070717_10003198 3300006028 Bacteria 11701
145 Ga0070717_10004539 3300006028 Bacteria 10039
146 Ga0070717_10008718 3300006028 Bacteria 7586
147 Ga0070717_10067641 3300006028 Bacteria 2973
148 Ga0070715_10028249 3300006163 Bacteria 2248
149 Ga0070715_10055624 3300006163 Bacteria 1718
150 Ga0070715_10068365 3300006163 Bacteria 1580
151 Ga0070715_10124313 3300006163 Bacteria 1234
152 Ga0070712_100006123 3300006175 Bacteria 7444
153 Ga0070712_100065544 3300006175 Bacteria 2578
154 Ga0070712_100103233 3300006175 Bacteria 2113
155 Ga0070712_100156691 3300006175 Bacteria 1754
156 Ga0070712_100194135 3300006175 Bacteria 1591
157 Ga0070712_100203305 3300006175 Bacteria 1557
158 Ga0097621_100021086 3300006237 Bacteria 5032
159 Ga0097621_100021649 3300006237 Bacteria 4978
160 Ga0068871_100011771 3300006358 Bacteria 6429
161 Ga0068871_100151422 3300006358 Bacteria 1979
162 Ga0068871_100303938 3300006358 Bacteria 1401
163 Ga0075433_10540293 3300006852 Bacteria 1025
164 Ga0075434_100297967 3300006871 Bacteria 1633
165 Ga0068865_100324756 3300006881 Bacteria 1239
166 Ga0075436_100011238 3300006914 Bacteria 6139
167 Ga0075436_100070078 3300006914 Bacteria 2423
168 Ga0075436_100073362 3300006914 Bacteria 2369
169 Ga0075436_100325822 3300006914 Bacteria 1104
170 Ga0097620_100022585 3300006931 Bacteria 6309
171 Ga0097620_100251898 3300006931 Bacteria 1856
172 Ga0075435_100159383 3300007076 Bacteria 1900
173 Ga0075435_100307579 3300007076 Bacteria 1356
174 Ga0099795_10023645 3300007788 Bacteria 2041
175 Ga0111539_10649207 3300009094 Bacteria 1229
176 Ga0105245_10443096 3300009098 Bacteria 1306
177 Ga0114129_10008097 3300009147 Bacteria 14978
178 Ga0105243_10514972 3300009148 Bacteria 1136
179 Ga0105242_10248700 3300009176 Bacteria 1601
180 Ga0105237_10289162 3300009545 Bacteria 1642
181 Ga0105249_10013434 3300009553 Bacteria 7230
182 Ga0105249_10184649 3300009553 Bacteria 2031
183 Ga0099796_10002794 3300010159 Bacteria 3924
184 Ga0105239_10107058 3300010375 Bacteria 3097
185 Ga0105239_10147839 3300010375 Bacteria 2622
186 Ga0105239_10150245 3300010375 Bacteria 2600
187 Ga0105239_10828057 3300010375 Bacteria 1061
188 Ga0157373_10046734 3300013100 Bacteria 3088
189 Ga0157371_10088918 3300013102 Bacteria 2188
190 Ga0157370_10170535 3300013104 Bacteria 2023
191 Ga0157374_10079197 3300013296 Bacteria 3113
192 Ga0157374_10318793 3300013296 Bacteria 1540
193 Ga0157378_10068027 3300013297 Bacteria 3193
194 Ga0157378_10117043 3300013297 Bacteria 2451
195 Ga0157378_10127231 3300013297 Bacteria 2355
196 Ga0157378_10264587 3300013297 Bacteria 1651
197 Ga0157378_10332368 3300013297 Bacteria 1479
198 Ga0163162_10010219 3300013306 Bacteria 9118
199 Ga0163162_10016985 3300013306 Bacteria 7120
200 Ga0163162_10042461 3300013306 Bacteria 4551
201 Ga0157372_10554990 3300013307 Bacteria 1339
202 Ga0157375_10001835 3300013308 Bacteria 18250
203 Ga0157375_10011590 3300013308 Bacteria 7789
204 Ga0157375_10236786 3300013308 Bacteria 1985
205 Ga0163163_10110091 3300014325 Bacteria 2782
206 Ga0163163_10193484 3300014325 Bacteria 2082
207 Ga0157377_10016923 3300014745 Bacteria 3761
208 Ga0157379_10001744 3300014968 Bacteria 17985
209 Ga0157379_10106350 3300014968 Bacteria 2519
210 Ga0157379_10290093 3300014968 Bacteria 1490
211 Ga0157376_10037779 3300014969 Bacteria 3924
212 Ga0157376_10051574 3300014969 Bacteria 3418
213 Ga0157376_10089593 3300014969 Bacteria 2660
214 Ga0157376_10158105 3300014969 Bacteria 2051
215 Ga0163161_10002616 3300017792 Bacteria 12815
216 Ga0207666_1000414 3300025271 Bacteria 5615
217 Ga0207697_10000151 3300025315 Bacteria 34208
218 Ga0207697_10001147 3300025315 Bacteria 14579
219 Ga0207697_10001619 3300025315 Bacteria 12158
220 Ga0207697_10006063 3300025315 Bacteria 5526
221 Ga0207697_10007583 3300025315 Bacteria 4823
222 Ga0207692_10119341 3300025898 Bacteria 1474
223 Ga0207692_10146508 3300025898 Bacteria 1348
224 Ga0207642_10002958 3300025899 Bacteria 5317
225 Ga0207688_10002615 3300025901 Bacteria 9749
226 Ga0207680_10107613 3300025903 Bacteria 1802
227 Ga0207647_10002927 3300025904 Bacteria 12853
228 Ga0207647_10212369 3300025904 Bacteria 1117
229 Ga0207685_10003126 3300025905 Bacteria 3959
230 Ga0207685_10012525 3300025905 Bacteria 2591
231 Ga0207699_10022441 3300025906 Bacteria 3420
232 Ga0207699_10056131 3300025906 Bacteria 2346
233 Ga0207699_10189371 3300025906 Bacteria 1387
234 Ga0207645_10004666 3300025907 Bacteria 10094
235 Ga0207645_10021471 3300025907 Bacteria 4209
236 Ga0207645_10073357 3300025907 Bacteria 2191
237 Ga0207684_10000043 3300025910 Bacteria 259939
238 Ga0207684_10004711 3300025910 Bacteria 12793
239 Ga0207684_10049496 3300025910 Bacteria 3565
240 Ga0207684_10202684 3300025910 Bacteria 1712
241 Ga0207693_10004670 3300025915 Bacteria 11541
242 Ga0207693_10008051 3300025915 Bacteria 8651
243 Ga0207693_10044579 3300025915 Bacteria 3486
244 Ga0207693_10056859 3300025915 Bacteria 3066
245 Ga0207693_10091099 3300025915 Bacteria 2391
246 Ga0207693_10091583 3300025915 Bacteria 2383
247 Ga0207693_10133141 3300025915 Bacteria 1954
248 Ga0207693_10152847 3300025915 Bacteria 1816
249 Ga0207693_10253230 3300025915 Bacteria 1381
250 Ga0207663_10003000 3300025916 Bacteria 8173
251 Ga0207663_10038939 3300025916 Bacteria 2877
252 Ga0207662_10039853 3300025918 Bacteria 2758
253 Ga0207657_10052053 3300025919 Bacteria 3556
254 Ga0207657_10400775 3300025919 Bacteria 1079
255 Ga0207652_10095546 3300025921 Bacteria 2618
256 Ga0207646_10000720 3300025922 Bacteria 42935
257 Ga0207646_10006659 3300025922 Bacteria 11907
258 Ga0207646_10012717 3300025922 Bacteria 8076
259 Ga0207646_10013541 3300025922 Bacteria 7793
260 Ga0207646_10100283 3300025922 Bacteria 2595
261 Ga0207681_10194730 3300025923 Unclassified 1553
262 Ga0207659_10004109 3300025926 Bacteria 8783
263 Ga0207659_10267214 3300025926 Unclassified 1394
264 Ga0207700_10037761 3300025928 Bacteria 3501
265 Ga0207700_10040607 3300025928 Bacteria 3397
266 Ga0207664_10014014 3300025929 Bacteria 5779
267 Ga0207664_10148555 3300025929 Bacteria 1989
268 Ga0207664_10413071 3300025929 Bacteria 1201
269 Ga0207644_10006288 3300025931 Bacteria 7735
270 Ga0207644_10006455 3300025931 Bacteria 7643
271 Ga0207644_10013326 3300025931 Bacteria 5479
272 Ga0207644_10075368 3300025931 Bacteria 2479
273 Ga0207644_10230957 3300025931 Bacteria 1470
274 Ga0207690_10007503 3300025932 Bacteria 6473
275 Ga0207690_10043944 3300025932 Bacteria 2943
276 Ga0207690_10134312 3300025932 Bacteria 1815
277 Ga0207706_10005196 3300025933 Bacteria 12147
278 Ga0207706_10008416 3300025933 Bacteria 9519
279 Ga0207706_10051915 3300025933 Bacteria 3620
280 Ga0207706_10069962 3300025933 Bacteria 3086
281 Ga0207706_10073961 3300025933 Bacteria 2996
282 Ga0207706_10137266 3300025933 Bacteria 2151
283 Ga0207670_10083799 3300025936 Bacteria 2237
284 Ga0207670_10184490 3300025936 Bacteria 1574
285 Ga0207669_10015647 3300025937 Bacteria 3831
286 Ga0207669_10057846 3300025937 Bacteria 2363
287 Ga0207669_10099664 3300025937 Bacteria 1916
288 Ga0207704_10254538 3300025938 Bacteria 1320
289 Ga0207665_10032516 3300025939 Bacteria 3454
290 Ga0207665_10043004 3300025939 Bacteria 3020
291 Ga0207691_10022686 3300025940 Bacteria 5918
292 Ga0207661_10090674 3300025944 Bacteria 2545
293 Ga0207661_10205002 3300025944 Bacteria 1735
294 Ga0207661_10254101 3300025944 Bacteria 1563
295 Ga0207679_10355267 3300025945 Bacteria 1278
296 Ga0207667_10008384 3300025949 Bacteria 12280
297 Ga0207651_10045294 3300025960 Bacteria 2949
298 Ga0207668_10009226 3300025972 Bacteria 5903
299 Ga0207668_10148663 3300025972 Bacteria 1811
300 Ga0207658_10017489 3300025986 Bacteria 4941
301 Ga0207658_10257545 3300025986 Bacteria 1486
302 Ga0207677_10357125 3300026023 Bacteria 1226
303 Ga0207703_10011360 3300026035 Bacteria 6928
304 Ga0207703_10011539 3300026035 Bacteria 6873
305 Ga0207703_10109149 3300026035 Bacteria 2358
306 Ga0207703_10208233 3300026035 Bacteria 1742
307 Ga0207639_10000001 3300026041 Bacteria 1431562
308 Ga0207678_10004287 3300026067 Bacteria 12794
309 Ga0207702_10308362 3300026078 Bacteria 1504
310 Ga0207641_10094140 3300026088 Bacteria 2627
311 Ga0207641_10213375 3300026088 Bacteria 1786
312 Ga0207648_10063345 3300026089 Bacteria 3223
313 Ga0207648_10359583 3300026089 Unclassified 1313
314 Ga0207648_10446563 3300026089 Bacteria 1177
315 Ga0207675_100197594 3300026118 Bacteria 1931
316 Ga0207683_10126141 3300026121 Bacteria 2300
317 Ga0207683_10140746 3300026121 Bacteria 2174
318 Ga0207683_10151588 3300026121 Bacteria 2092
319 Ga0209982_1006218 3300027552 Bacteria 1734
320 Ga0209971_1022954 3300027682 Bacteria 1487
321 Ga0268266_10016409 3300028379 Bacteria 6332
322 Ga0268266_10310341 3300028379 Bacteria 1474
323 Ga0268264_10027843 3300028381 Bacteria 4620
324 Ga0268264_10252200 3300028381 Bacteria 1640
325 Ga0373956_0109687 3300035119 Bacteria 1284
326 Ga0373943_0042676 3300035170 Bacteria 2199
327 Ga0373943_0077829 3300035170 Bacteria 1694
328 Ga0373943_0239705 3300035170 Bacteria 1016
329 Ga0373955_0055546 3300035172 Bacteria 2169
330 Ga0373955_0239190 3300035172 Bacteria 1087
331 Ga0373931_0041159 3300035691 Bacteria 2427
332 Ga0373931_0044817 3300035691 Bacteria 2334
333 Ga0373935_0037660 3300035692 Bacteria 3027
334 Ga0373935_0046686 3300035692 Bacteria 2736
335 Ga0373935_0182401 3300035692 Bacteria 1442
336 Ga0373927_0043446 3300035695 Bacteria 2909
337 Ga0373937_0001540 3300036401 Bacteria 19390
338 Ga0373937_0316345 3300036401 Bacteria 1477
339 Ga0373925_0043458 3300037068 Bacteria 3335
340 Ga0373925_0048264 3300037068 Bacteria 3172
341 Ga0373925_0256888 3300037068 Bacteria 1403
342 Ga0395899_0072007 3300037312 Bacteria 2529
343 Ga0395900_0042222 3300037418 Bacteria 4698
344 Ga0395900_0047728 3300037418 Bacteria 4411
345 Ga0395900_0138771 3300037418 Bacteria 2490
346 Ga0395900_0608328 3300037418 Bacteria 1033
347 Ga0395900_0639671 3300037418 Bacteria 1001
348 Ga0395898_0401375 3300037466 Bacteria 1307
349 Ga0395905_0235309 3300037471 Bacteria 1712
350 Ga0395901_0078729 3300038443 Bacteria 3442
351 Ga0395901_0079793 3300038443 Bacteria 3417
352 Ga0395901_0245581 3300038443 Bacteria 1866
353 Ga0436363_0874459 3300039450 Bacteria 1463
354 Ga0451845_0949939 3300041501 Bacteria 950
355 Ga0439455_0002178 3300042012 Bacteria 3503
356 Ga0466967_0046478 3300045976 Bacteria 3780
357 Ga0495592_0027986 3300046454 Bacteria 4269
358 Ga0495641_0020527 3300046461 Bacteria 3347
359 Ga0495651_0004539 3300046462 Bacteria 10616
360 Ga0495651_0214012 3300046462 Bacteria 1339
361 Ga0495653_0131773 3300046463 Bacteria 1769
362 Ga0495653_0362123 3300046463 Bacteria 930
363 Ga0495580_0188914 3300046472 Bacteria 1421
364 Ga0495582_0147673 3300046473 Bacteria 1334
365 Ga0495594_0116209 3300046499 Bacteria 1511
366 Ga0495618_0116081 3300046514 Bacteria 1714
367 Ga0495628_0025675 3300046516 Bacteria 4812
368 Ga0495628_0117236 3300046516 Bacteria 2044
369 Ga0495630_0029691 3300046517 Bacteria 4065
370 Ga0495630_0095376 3300046517 Bacteria 2249
371 Ga0495642_0020662 3300046528 Bacteria 2588
372 Ga0495652_0064343 3300046529 Bacteria 3084
373 Ga0495652_0108714 3300046529 Bacteria 2234
374 Ga0495652_0355077 3300046529 Bacteria 1049
375 Ga0495665_0206633 3300046531 Bacteria 1017
376 Ga0495586_0032649 3300046535 Bacteria 2791
377 Ga0495587_0098246 3300046536 Bacteria 1688
378 Ga0495645_0010305 3300046543 Bacteria 6552
379 Ga0495635_0134803 3300046663 Bacteria 1683
380 Ga0495659_0005725 3300046664 Bacteria 3918
381 Ga0495588_0105012 3300046674 Unclassified 1486
382 Ga0495599_0012049 3300046678 Bacteria 5321
383 Ga0495599_0157046 3300046678 Bacteria 1407
384 Ga0495646_0003991 3300046680 Bacteria 9239
385 Ga0495647_0036533 3300046681 Bacteria 1850
386 Ga0495658_0009228 3300046683 Bacteria 4905
387 Ga0495658_0075126 3300046683 Bacteria 1971
388 Ga0495669_0004086 3300046684 Bacteria 6000
389 Ga0495581_0029470 3300047315 Bacteria 3181
390 Ga0495604_0045847 3300047317 Bacteria 3410
391 Ga0495680_0185845 3300047322 Bacteria 1497
392 Ga0495680_0306981 3300047322 Bacteria 1113
393 Ga0495675_0004714 3300047444 Bacteria 8282
394 Ga0495675_0027915 3300047444 Bacteria 3597
395 Ga0495681_0057874 3300047470 Bacteria 1799
396 Ga0495684_0017120 3300047471 Bacteria 5582
397 Ga0495602_0138780 3300048088 Bacteria 1927
398 Ga0496100_0090175 3300048903 Bacteria 2090
399 Ga0496101_0001708 3300048904 Bacteria 13133
400 Ga0496101_0195758 3300048904 Bacteria 1561
401 Ga0496101_0217006 3300048904 Bacteria 1484
402 Ga0496101_0256917 3300048904 Bacteria 1362
403 Ga0496101_0461207 3300048904 Bacteria 1003
404 Ga0496102_0062542 3300048905 Bacteria 3408
405 Ga0496102_0091868 3300048905 Bacteria 2810
406 Ga0496102_0108054 3300048905 Bacteria 2591
407 Ga0496102_0123902 3300048905 Bacteria 2415
408 Ga0496102_0239683 3300048905 Bacteria 1710
409 Ga0496103_0006341 3300048906 Bacteria 7070
410 Ga0496103_0168540 3300048906 Bacteria 1406
411 Ga0496104_0008942 3300048907 Bacteria 8902
412 Ga0496104_0244111 3300048907 Bacteria 1708
413 Ga0496105_0019035 3300048908 Bacteria 5533
414 Ga0496105_0129523 3300048908 Bacteria 2081
415 Ga0496105_0300911 3300048908 Bacteria 1289
416 Ga0496106_0003012 3300048909 Bacteria 12548
417 Ga0496106_0030455 3300048909 Bacteria 4024
418 Ga0496107_0001726 3300048910 Bacteria 13718
419 Ga0496107_0213775 3300048910 Bacteria 1434
420 Ga0496108_0028411 3300048911 Bacteria 4627
421 Ga0496108_0151969 3300048911 Bacteria 1998
422 Ga0496109_0022412 3300048912 Bacteria 5594
423 Ga0496109_0091542 3300048912 Bacteria 2813
424 Ga0496109_0108673 3300048912 Bacteria 2578
425 Ga0496110_0014415 3300048913 Bacteria 6563
426 Ga0496110_0027035 3300048913 Bacteria 4916
427 Ga0496110_0067699 3300048913 Bacteria 3160
428 Ga0496110_0375324 3300048913 Bacteria 1296
429 Ga0496111_0231424 3300048914 Bacteria 1373
430 Ga0496111_0295488 3300048914 Bacteria 1201
431 Ga0496112_0005693 3300048915 Bacteria 10824
432 Ga0496112_0028559 3300048915 Bacteria 5386
433 Ga0496112_0118025 3300048915 Bacteria 2623
434 Ga0496112_0154232 3300048915 Bacteria 2264
435 Ga0496113_0005338 3300048916 Bacteria 8004
436 Ga0496113_0017938 3300048916 Bacteria 4922
437 Ga0496114_0013171 3300048917 Bacteria 6629
438 Ga0496115_0000424 3300048918 Bacteria 34503
439 Ga0496115_0004076 3300048918 Bacteria 10555
440 Ga0496115_0070116 3300048918 Bacteria 2841
441 Ga0496115_0082532 3300048918 Bacteria 2619
442 Ga0496115_0100458 3300048918 Bacteria 2371
443 Ga0501292_003955 3300049515 Bacteria 2004
444 Ga0501298_004608 3300049521 Bacteria 2180
445 Ga0501227_000154 3300049665 Bacteria 12912
446 Ga0501230_003734 3300049667 Bacteria 2046
447 Ga0501233_002131 3300049668 Bacteria 3461
448 Ga0501236_003859 3300049670 Bacteria 1760
449 Ga0501225_0009148 3300049705 Bacteria 2829
450 nmdc:mga05p37_62577_c1 3300050507 Bacteria 4579
451 nmdc:mga08y16_142619_c1 3300050511 Bacteria 2490
452 nmdc:mga08y16_290042_c1 3300050511 Bacteria 1687
453 nmdc:mga0n895_160948_c1 3300050512 Bacteria 2276
454 nmdc:mga0n895_164303_c1 3300050512 Bacteria 2251
455 nmdc:mga0n895_374063_c1 3300050512 Bacteria 1442
456 nmdc:mga0rr50_222742_c1 3300050513 Bacteria 1558
457 nmdc:mga0rr50_509228_c1 3300050513 Bacteria 1024
458 nmdc:mga08x19_161198_c1 3300050514 Bacteria 1523
459 nmdc:mga0a205_501437_c1 3300050515 Bacteria 1071
460 nmdc:mga0a205_88401_c1 3300050515 Bacteria 2994
461 Ga0495601_0051013 3300053077 Bacteria 2611
462 Ga0495655_0009135 3300053083 Bacteria 1911
463 Ga0495595_0121980 3300053084 Bacteria 1270
464 Ga0495619_0148340 3300053085 Bacteria 1618
465 JGI25405J52794_10003831
466 SwRhRL2b_contig_537134
467 JGI24035J26624_1001491
468 JGI24035J26624_1002886
469 JGI25406J46586_10000002
470 JGI25405J52794_10000742
471 JGI25405J52794_10024411
472 Ga0065704_10005841
473 Ga0065712_10005843
474 Ga0065712_10008781
475 Ga0065712_10013008
476 Ga0065712_10094757
477 Ga0065712_10110969
478 Ga0065715_10002858
479 Ga0065715_10007736
480 Ga0065715_10090678
481 Ga0065715_10096882
482 Ga0065707_10003406
483 Ga0065707_10109883
484 Ga0070676_10004299
485 Ga0070676_10029955
486 Ga0070676_10059228
487 Ga0070683_100077069
488 Ga0070683_100142838
489 Ga0070690_100128198
490 Ga0070670_100098952
491 Ga0070677_10064860
492 Ga0070666_10012249
493 Ga0070666_10049854
494 Ga0070666_10062821
495 Ga0070680_100125277
496 Ga0068868_100368921
497 Ga0070660_100205556
498 Ga0070660_100316377
499 Ga0070689_100008313
500 Ga0070687_100041849
501 Ga0070687_100059423
502 Ga0070661_100017032
503 Ga0070668_100002801
504 Ga0070668_100019221
505 Ga0070668_100262977
506 Ga0070669_100078390
507 Ga0070675_100002080
508 Ga0070675_100005525
509 Ga0070671_100015835
510 Ga0070671_100070794
511 Ga0070671_100327028
512 Ga0070674_100046932
513 Ga0070673_100166975
514 Ga0070673_100349969
515 Ga0070673_100359786
516 Ga0070688_100012161
517 Ga0070688_100037533
518 Ga0070688_100197390
519 Ga0070659_100003065
520 Ga0070667_100011964
521 Ga0070667_100016903
522 Ga0070667_100370912
523 Ga0070709_10014239
524 Ga0070714_100020315
525 Ga0070714_100340071
526 Ga0070710_10007997
527 Ga0070710_10051015
528 Ga0070710_10226041
529 Ga0070711_100012862
530 Ga0070705_100041309
531 Ga0070694_100107311
532 Ga0070694_100157408
533 Ga0070708_100002835
534 Ga0070708_100161158
535 Ga0070708_100251415
536 Ga0070663_100040379
537 Ga0070678_100040441
538 Ga0070678_100040748
539 Ga0070678_100163930
540 Ga0070678_100206188
541 Ga0070662_100033708
542 Ga0070662_100042636
543 Ga0070662_100119734
544 Ga0070662_100212783
545 Ga0070662_100385820
546 Ga0068867_100442007
547 Ga0070706_100000072
548 Ga0070706_100013428
549 Ga0070706_100028652
550 Ga0070706_100036970
551 Ga0070706_100143293
552 Ga0070706_100202837
553 Ga0070706_100234429
554 Ga0070707_100000109
555 Ga0070707_100010305
556 Ga0070707_100012075
557 Ga0070707_100020967
558 Ga0070707_100021256
559 Ga0070698_100002781
560 Ga0070698_100004236
561 Ga0070698_100113023
562 Ga0070698_100331975
563 Ga0070698_100391779
564 Ga0070679_100182331
565 Ga0070684_100000339
566 Ga0070684_100082081
567 Ga0070697_100000972
568 Ga0070697_100003517
569 Ga0070697_100012199
570 Ga0070697_100018079
571 Ga0068853_100000007
572 Ga0070672_100007881
573 Ga0070696_100060876
574 Ga0070696_100122154
575 Ga0070665_100013354
576 Ga0070665_100096203
577 Ga0070665_100171812
578 Ga0070665_100177692
579 Ga0070704_100000846
580 Ga0068855_100002704
581 Ga0070664_100026287
582 Ga0068856_100045169
583 Ga0068856_100049749
584 Ga0068859_100022585
585 Ga0068859_100251893
586 Ga0068864_100177440
587 Ga0068866_10005310
588 Ga0068863_100110509
589 Ga0068858_100009463
590 Ga0068858_100018642
591 Ga0068858_100127417
592 Ga0068860_100012835
593 Ga0068860_100027033
594 Ga0068860_100266871
595 Ga0081455_10001013
596 Ga0081455_10001533
597 Ga0081455_10001733
598 Ga0081455_10029326
599 Ga0081455_10077655
600 Ga0081455_10080867
601 Ga0081540_1000219
602 Ga0081540_1094052
603 Ga0081539_10000061
604 Ga0081539_10005093
605 Ga0081539_10010581
606 Ga0081539_10018032
607 Ga0081539_10107076
608 Ga0070717_10003198
609 Ga0070717_10004539
610 Ga0070717_10008718
611 Ga0070717_10067641
612 Ga0070715_10028249
613 Ga0070715_10055624
614 Ga0070715_10068365
615 Ga0070715_10124313
616 Ga0070712_100006123
617 Ga0070712_100065544
618 Ga0070712_100103233
619 Ga0070712_100156691
620 Ga0070712_100194135
621 Ga0070712_100203305
622 Ga0097621_100021086
623 Ga0097621_100021649
624 Ga0068871_100011771
625 Ga0068871_100151422
626 Ga0068871_100303938
627 Ga0075433_10540293
628 Ga0075434_100297967
629 Ga0068865_100324756
630 Ga0075436_100011238
631 Ga0075436_100070078
632 Ga0075436_100073362
633 Ga0075436_100325822
634 Ga0097620_100022585
635 Ga0097620_100251898
636 Ga0075435_100159383
637 Ga0075435_100307579
638 Ga0099795_10023645
639 Ga0111539_10649207
640 Ga0105245_10443096
641 Ga0114129_10008097
642 Ga0105243_10514972
643 Ga0105242_10248700
644 Ga0105237_10289162
645 Ga0105249_10013434
646 Ga0105249_10184649
647 Ga0099796_10002794
648 Ga0105239_10107058
649 Ga0105239_10147839
650 Ga0105239_10150245
651 Ga0105239_10828057
652 Ga0157373_10046734
653 Ga0157371_10088918
654 Ga0157370_10170535
655 Ga0157374_10079197
656 Ga0157374_10318793
657 Ga0157378_10068027
658 Ga0157378_10117043
659 Ga0157378_10127231
660 Ga0157378_10264587
661 Ga0157378_10332368
662 Ga0163162_10010219
663 Ga0163162_10016985
664 Ga0163162_10042461
665 Ga0157372_10554990
666 Ga0157375_10001835
667 Ga0157375_10011590
668 Ga0157375_10236786
669 Ga0163163_10110091
670 Ga0163163_10193484
671 Ga0157377_10016923
672 Ga0157379_10001744
673 Ga0157379_10106350
674 Ga0157379_10290093
675 Ga0157376_10037779
676 Ga0157376_10051574
677 Ga0157376_10089593
678 Ga0157376_10158105
679 Ga0163161_10002616
680 Ga0207666_1000414
681 Ga0207697_10000151
682 Ga0207697_10001147
683 Ga0207697_10001619
684 Ga0207697_10006063
685 Ga0207697_10007583
686 Ga0207692_10119341
687 Ga0207692_10146508
688 Ga0207642_10002958
689 Ga0207688_10002615
690 Ga0207680_10107613
691 Ga0207647_10002927
692 Ga0207647_10212369
693 Ga0207685_10003126
694 Ga0207685_10012525
695 Ga0207699_10022441
696 Ga0207699_10056131
697 Ga0207699_10189371
698 Ga0207645_10004666
699 Ga0207645_10021471
700 Ga0207645_10073357
701 Ga0207684_10000043
702 Ga0207684_10004711
703 Ga0207684_10049496
704 Ga0207684_10202684
705 Ga0207693_10004670
706 Ga0207693_10008051
707 Ga0207693_10044579
708 Ga0207693_10056859
709 Ga0207693_10091099
710 Ga0207693_10091583
711 Ga0207693_10133141
712 Ga0207693_10152847
713 Ga0207693_10253230
714 Ga0207663_10003000
715 Ga0207663_10038939
716 Ga0207662_10039853
717 Ga0207657_10052053
718 Ga0207657_10400775
719 Ga0207652_10095546
720 Ga0207646_10000720
721 Ga0207646_10006659
722 Ga0207646_10012717
723 Ga0207646_10013541
724 Ga0207646_10100283
725 Ga0207681_10194730
726 Ga0207659_10004109
727 Ga0207659_10267214
728 Ga0207700_10037761
729 Ga0207700_10040607
730 Ga0207664_10014014
731 Ga0207664_10148555
732 Ga0207664_10413071
733 Ga0207644_10006288
734 Ga0207644_10006455
735 Ga0207644_10013326
736 Ga0207644_10075368
737 Ga0207644_10230957
738 Ga0207690_10007503
739 Ga0207690_10043944
740 Ga0207690_10134312
741 Ga0207706_10005196
742 Ga0207706_10008416
743 Ga0207706_10051915
744 Ga0207706_10069962
745 Ga0207706_10073961
746 Ga0207706_10137266
747 Ga0207670_10083799
748 Ga0207670_10184490
749 Ga0207669_10015647
750 Ga0207669_10057846
751 Ga0207669_10099664
752 Ga0207704_10254538
753 Ga0207665_10032516
754 Ga0207665_10043004
755 Ga0207691_10022686
756 Ga0207661_10090674
757 Ga0207661_10205002
758 Ga0207661_10254101
759 Ga0207679_10355267
760 Ga0207667_10008384
761 Ga0207651_10045294
762 Ga0207668_10009226
763 Ga0207668_10148663
764 Ga0207658_10017489
765 Ga0207658_10257545
766 Ga0207677_10357125
767 Ga0207703_10011360
768 Ga0207703_10011539
769 Ga0207703_10109149
770 Ga0207703_10208233
771 Ga0207639_10000001
772 Ga0207678_10004287
773 Ga0207702_10308362
774 Ga0207641_10094140
775 Ga0207641_10213375
776 Ga0207648_10063345
777 Ga0207648_10359583
778 Ga0207648_10446563
779 Ga0207675_100197594
780 Ga0207683_10126141
781 Ga0207683_10140746
782 Ga0207683_10151588
783 Ga0209982_1006218
784 Ga0209971_1022954
785 Ga0268266_10016409
786 Ga0268266_10310341
787 Ga0268264_10027843
788 Ga0268264_10252200
789 Ga0373956_0109687
790 Ga0373943_0042676
791 Ga0373943_0077829
792 Ga0373943_0239705
793 Ga0373955_0055546
794 Ga0373955_0239190
795 Ga0373931_0041159
796 Ga0373931_0044817
797 Ga0373935_0037660
798 Ga0373935_0046686
799 Ga0373935_0182401
800 Ga0373927_0043446
801 Ga0373937_0001540
802 Ga0373937_0316345
803 Ga0373925_0043458
804 Ga0373925_0048264
805 Ga0373925_0256888
806 Ga0395899_0072007
807 Ga0395900_0042222
808 Ga0395900_0047728
809 Ga0395900_0138771
810 Ga0395900_0608328
811 Ga0395900_0639671
812 Ga0395898_0401375
813 Ga0395905_0235309
814 Ga0395901_0078729
815 Ga0395901_0079793
816 Ga0395901_0245581
817 Ga0436363_0874459
818 Ga0451845_0949939
819 Ga0439455_0002178
820 Ga0466967_0046478
821 Ga0495592_0027986
822 Ga0495641_0020527
823 Ga0495651_0004539
824 Ga0495651_0214012
825 Ga0495653_0131773
826 Ga0495653_0362123
827 Ga0495580_0188914
828 Ga0495582_0147673
829 Ga0495594_0116209
830 Ga0495618_0116081
831 Ga0495628_0025675
832 Ga0495628_0117236
833 Ga0495630_0029691
834 Ga0495630_0095376
835 Ga0495642_0020662
836 Ga0495652_0064343
837 Ga0495652_0108714
838 Ga0495652_0355077
839 Ga0495665_0206633
840 Ga0495586_0032649
841 Ga0495587_0098246
842 Ga0495645_0010305
843 Ga0495635_0134803
844 Ga0495659_0005725
845 Ga0495588_0105012
846 Ga0495599_0012049
847 Ga0495599_0157046
848 Ga0495646_0003991
849 Ga0495647_0036533
850 Ga0495658_0009228
851 Ga0495658_0075126
852 Ga0495669_0004086
853 Ga0495581_0029470
854 Ga0495604_0045847
855 Ga0495680_0185845
856 Ga0495680_0306981
857 Ga0495675_0004714
858 Ga0495675_0027915
859 Ga0495681_0057874
860 Ga0495684_0017120
861 Ga0495602_0138780
862 Ga0496100_0090175
863 Ga0496101_0001708
864 Ga0496101_0195758
865 Ga0496101_0217006
866 Ga0496101_0256917
867 Ga0496101_0461207
868 Ga0496102_0062542
869 Ga0496102_0091868
870 Ga0496102_0108054
871 Ga0496102_0123902
872 Ga0496102_0239683
873 Ga0496103_0006341
874 Ga0496103_0168540
875 Ga0496104_0008942
876 Ga0496104_0244111
877 Ga0496105_0019035
878 Ga0496105_0129523
879 Ga0496105_0300911
880 Ga0496106_0003012
881 Ga0496106_0030455
882 Ga0496107_0001726
883 Ga0496107_0213775
884 Ga0496108_0028411
885 Ga0496108_0151969
886 Ga0496109_0022412
887 Ga0496109_0091542
888 Ga0496109_0108673
889 Ga0496110_0014415
890 Ga0496110_0027035
891 Ga0496110_0067699
892 Ga0496110_0375324
893 Ga0496111_0231424
894 Ga0496111_0295488
895 Ga0496112_0005693
896 Ga0496112_0028559
897 Ga0496112_0118025
898 Ga0496112_0154232
899 Ga0496113_0005338
900 Ga0496113_0017938
901 Ga0496114_0013171
902 Ga0496115_0000424
903 Ga0496115_0004076
904 Ga0496115_0070116
905 Ga0496115_0082532
906 Ga0496115_0100458
907 Ga0501292_003955
908 Ga0501298_004608
909 Ga0501227_000154
910 Ga0501230_003734
911 Ga0501233_002131
912 Ga0501236_003859
913 Ga0501225_0009148
914 nmdc:mga05p37_62577_c1
915 nmdc:mga08y16_142619_c1
916 nmdc:mga08y16_290042_c1
917 nmdc:mga0n895_160948_c1
918 nmdc:mga0n895_164303_c1
919 nmdc:mga0n895_374063_c1
920 nmdc:mga0rr50_222742_c1
921 nmdc:mga0rr50_509228_c1
922 nmdc:mga08x19_161198_c1
923 nmdc:mga0a205_501437_c1
924 nmdc:mga0a205_88401_c1
925 Ga0495601_0051013
926 Ga0495655_0009135
927 Ga0495595_0121980
928 Ga0495619_0148340

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07478

Dala_Dala_lig_C

D-ala D-ala ligase C-terminus

103

303

0.93

PF01820

Dala_Dala_lig_N

D-ala D-ala ligase N-terminus

51

92

0.92

PF02655

ATP-grasp_3

ATP-grasp domain

100

276

0.82

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

102

309

0.8

PF08443

RimK

RimK-like ATP-grasp domain

103

293

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zqi-assembly2.cif.gz_C crystal structure of apo d-alanine-d-alanine ligase(ddl) from yersinia pestis 0.8491 5 277
5c1p-assembly1.cif.gz_B crystal structure of adp and d-alanyl-d-alanine complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis 0.8341 5 277
5c1p-assembly2.cif.gz_D crystal structure of adp and d-alanyl-d-alanine complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis 0.8326 6 277
5bph-assembly1.cif.gz_D crystal structure of amp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis 0.8291 5 277
5bpf-assembly1.cif.gz_B crystal structure of adp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis 0.8291 5 277
ID Description Score Start End Superfamily
1c3oA03 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.8517 110 172 3.30.1490.20
2pvpB03 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.8478 114 171 3.30.1490.20
3se7B03 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.8474 114 167 3.30.1490.20
4egjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8446 7 85 3.40.50.20
2zdqA03 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.8444 114 167 3.30.1490.20
ID Description Score Start End GO Terms
AF-A0A4Q2Z9Z3-F1-model_v4 D-alanine--D-alanine ligase 0.9306 6 112 GO:0008716
AF-A0A059X3G1-F1-model_v4 D-ala D-ala ligase N-terminus 0.9222 1 122 GO:0008716
AF-A0A059X3G1-F1-model_v4 D-ala D-ala ligase N-terminus 0.915 1 122 GO:0008716
AF-A0A351XK27-F1-model_v4 D-alanine--D-alanine ligase 0.8943 57 199 GO:0005524
GO:0005737
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555
AF-A0A2A2RH21-F1-model_v4 D-alanine--D-alanine ligase (EC 6.3.2.4) (D-Ala-D-Ala ligase) (D-alanylalanine synthetase) 0.8932 5 284 GO:0005524
GO:0005737
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555

Map