F449199

General Info

Members Datasets Scaffolds Average Seq Length
463 243 926 148

Family's Representative Sequence

Representative Sequence 3300050496|nmdc:mga07m45_592221_c1|nmdc:mga07m45_592221_c1_21_548
Length 175
Sequence MMHVTPPALSSIIDRVSREPSCDDAEMRGLVQRVEQASVTVVGPEGGTVVGEIGPGLCVLVGVTHDDESATAVKLADKIWNLRVFDDDAGVMNRSLADTGGEVLIISQFTLYADTSAGRRPSYIKASRPEHAEPLIETVVAELQRRGATVATGRFRTEMKVSLVNDGPVTVMLEL

Samples

Sample ID Description Type Environment
1 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
108 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
165 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
166 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
169 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
170 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
174 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
188 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
227 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
239 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
240 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.64
Nodule 0
Rhizoplane 4.75
Rhizosphere 85.75
Stem 0
Stem Tuber 0
Unclassified 6.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga07m45_592221_c1 3300050496 Bacteria 640
2 Ga0070658_10024106 3300005327 Bacteria 4882
3 Ga0070683_100023480 3300005329 Bacteria 5517
4 Ga0070690_100022880 3300005330 Bacteria 3828
5 Ga0070690_100402166 3300005330 Bacteria 1006
6 Ga0070670_100001523 3300005331 Bacteria 18653
7 Ga0070670_100003776 3300005331 Bacteria 12608
8 Ga0070670_100064727 3300005331 Bacteria 3137
9 Ga0070670_100155172 3300005331 Unclassified 1982
10 Ga0070670_100791653 3300005331 Bacteria 856
11 Ga0070677_10116899 3300005333 Bacteria 1199
12 Ga0068869_100048681 3300005334 Bacteria 3066
13 Ga0068869_100850890 3300005334 Bacteria 787
14 Ga0070680_100142251 3300005336 Bacteria 2012
15 Ga0068868_100202143 3300005338 Bacteria 1657
16 Ga0070660_100002577 3300005339 Bacteria 12436
17 Ga0070689_100070184 3300005340 Bacteria 2735
18 Ga0070689_100106205 3300005340 Bacteria 2227
19 Ga0070689_100501101 3300005340 Bacteria 1040
20 Ga0070689_100610170 3300005340 Bacteria 946
21 Ga0070687_100358245 3300005343 Bacteria 943
22 Ga0070661_100000863 3300005344 Bacteria 21771
23 Ga0070661_101113658 3300005344 Bacteria 658
24 Ga0070668_100013395 3300005347 Bacteria 6119
25 Ga0070668_100105302 3300005347 Bacteria 2240
26 Ga0070669_100022274 3300005353 Bacteria 4531
27 Ga0070669_100028347 3300005353 Bacteria 4033
28 Ga0070669_100265623 3300005353 Bacteria 1371
29 Ga0070675_100019685 3300005354 Bacteria 5381
30 Ga0070675_100061712 3300005354 Unclassified 3096
31 Ga0070675_100070996 3300005354 Bacteria 2888
32 Ga0070671_100137059 3300005355 Bacteria 2063
33 Ga0070671_100198756 3300005355 Unclassified 1700
34 Ga0070671_100391432 3300005355 Bacteria 1188
35 Ga0070671_101023159 3300005355 Bacteria 724
36 Ga0070671_101182175 3300005355 Bacteria 673
37 Ga0070674_100029320 3300005356 Bacteria 3623
38 Ga0070674_100094473 3300005356 Unclassified 2166
39 Ga0070674_100151182 3300005356 Bacteria 1752
40 Ga0070674_101151907 3300005356 Bacteria 687
41 Ga0070673_100185296 3300005364 Unclassified 1784
42 Ga0070673_100624971 3300005364 Bacteria 984
43 Ga0070659_100013471 3300005366 Bacteria 6088
44 Ga0070667_100076543 3300005367 Bacteria 2857
45 Ga0070667_100167549 3300005367 Bacteria 1938
46 Ga0070714_100002440 3300005435 Bacteria 13710
47 Ga0070713_101197423 3300005436 Bacteria 735
48 Ga0070710_10154658 3300005437 Bacteria 1417
49 Ga0070701_10027898 3300005438 Bacteria 2771
50 Ga0070701_10517664 3300005438 Bacteria 777
51 Ga0070711_100024006 3300005439 Bacteria 3974
52 Ga0070700_100355110 3300005441 Unclassified 1088
53 Ga0070694_100055356 3300005444 Bacteria 2690
54 Ga0070694_100161975 3300005444 Bacteria 1642
55 Ga0070708_100036571 3300005445 Bacteria 4283
56 Ga0070678_100231599 3300005456 Bacteria 1540
57 Ga0070678_100416078 3300005456 Bacteria 1171
58 Ga0070678_100869904 3300005456 Bacteria 822
59 Ga0070662_100059296 3300005457 Bacteria 2788
60 Ga0070681_10140416 3300005458 Bacteria 2346
61 Ga0068867_100012604 3300005459 Bacteria 5979
62 Ga0068867_100100163 3300005459 Bacteria 2212
63 Ga0068867_100122660 3300005459 Bacteria 2010
64 Ga0068867_100503325 3300005459 Bacteria 1041
65 Ga0068867_100643927 3300005459 Unclassified 929
66 Ga0070685_10318453 3300005466 Bacteria 1053
67 Ga0070706_100030125 3300005467 Bacteria 4998
68 Ga0070706_100217200 3300005467 Bacteria 1785
69 Ga0070706_100227944 3300005467 Bacteria 1739
70 Ga0070707_100180065 3300005468 Bacteria 2060
71 Ga0070707_100324983 3300005468 Unclassified 1495
72 Ga0070707_100850975 3300005468 Bacteria 876
73 Ga0070698_100067627 3300005471 Bacteria 3592
74 Ga0070698_101084917 3300005471 Bacteria 749
75 Ga0070699_100008030 3300005518 Bacteria 9163
76 Ga0070679_100019757 3300005530 Bacteria 6558
77 Ga0070684_100184730 3300005535 Bacteria 1896
78 Ga0070697_100040501 3300005536 Bacteria 3770
79 Ga0070697_100051251 3300005536 Bacteria 3353
80 Ga0068853_100082742 3300005539 Bacteria 2812
81 Ga0070672_100008461 3300005543 Bacteria 7039
82 Ga0070672_100034197 3300005543 Bacteria 3856
83 Ga0070672_100072242 3300005543 Bacteria 2747
84 Ga0070672_100600821 3300005543 Bacteria 958
85 Ga0070686_100117123 3300005544 Bacteria 1824
86 Ga0070695_100162865 3300005545 Bacteria 1567
87 Ga0070695_100427209 3300005545 Bacteria 1010
88 Ga0070693_100010286 3300005547 Bacteria 4684
89 Ga0070665_100182106 3300005548 Unclassified 2102
90 Ga0070665_100243820 3300005548 Bacteria 1797
91 Ga0070704_100066845 3300005549 Bacteria 2594
92 Ga0070704_100133480 3300005549 Bacteria 1928
93 Ga0068855_100014353 3300005563 Bacteria 9538
94 Ga0070664_100003707 3300005564 Bacteria 12317
95 Ga0070664_100028133 3300005564 Bacteria 4675
96 Ga0070664_100188260 3300005564 Bacteria 1838
97 Ga0070664_100978477 3300005564 Bacteria 795
98 Ga0068857_100015772 3300005577 Bacteria 6611
99 Ga0068854_100011767 3300005578 Bacteria 5711
100 Ga0068854_100145967 3300005578 Bacteria 1820
101 Ga0068854_101758555 3300005578 Bacteria 568
102 Ga0068856_100048572 3300005614 Bacteria 4183
103 Ga0070702_100111951 3300005615 Bacteria 1694
104 Ga0068852_100023545 3300005616 Bacteria 4958
105 Ga0068852_100513543 3300005616 Bacteria 1195
106 Ga0068859_100116393 3300005617 Bacteria 2738
107 Ga0068859_100157403 3300005617 Bacteria 2350
108 Ga0068859_100722725 3300005617 Bacteria 1086
109 Ga0068859_100895444 3300005617 Bacteria 972
110 Ga0068859_101189250 3300005617 Bacteria 840
111 Ga0068864_100000849 3300005618 Bacteria 25790
112 Ga0068864_100117727 3300005618 Bacteria 2372
113 Ga0068864_100193685 3300005618 Unclassified 1864
114 Ga0068864_101043518 3300005618 Bacteria 812
115 Ga0068864_101984884 3300005618 Bacteria 588
116 Ga0068866_10053828 3300005718 Bacteria 2059
117 Ga0068866_10889977 3300005718 Unclassified 625
118 Ga0068861_100023363 3300005719 Bacteria 4458
119 Ga0068861_100244599 3300005719 Bacteria 1527
120 Ga0068861_101601681 3300005719 Bacteria 641
121 Ga0068851_10030860 3300005834 Bacteria 2660
122 Ga0068870_10018057 3300005840 Bacteria 3400
123 Ga0068870_10119343 3300005840 Bacteria 1517
124 Ga0068863_100004993 3300005841 Bacteria 13078
125 Ga0068863_100079776 3300005841 Bacteria 3100
126 Ga0068863_100123093 3300005841 Bacteria 2474
127 Ga0068863_100400006 3300005841 Bacteria 1343
128 Ga0068863_100986581 3300005841 Unclassified 845
129 Ga0068863_101117669 3300005841 Bacteria 793
130 Ga0068858_100154999 3300005842 Unclassified 2155
131 Ga0068860_100014070 3300005843 Bacteria 7850
132 Ga0068860_100026979 3300005843 Bacteria 5535
133 Ga0068860_100084630 3300005843 Bacteria 3017
134 Ga0068860_100105502 3300005843 Bacteria 2691
135 Ga0068860_100200275 3300005843 Unclassified 1935
136 Ga0068860_100527487 3300005843 Bacteria 1181
137 Ga0068862_100054254 3300005844 Bacteria 3431
138 Ga0068862_100071793 3300005844 Bacteria 2989
139 Ga0075365_10015076 3300006038 Bacteria 4666
140 Ga0075365_10015408 3300006038 Bacteria 4625
141 Ga0075365_10052950 3300006038 Bacteria 2686
142 Ga0075365_10117029 3300006038 Bacteria 1835
143 Ga0075365_10276807 3300006038 Bacteria 1180
144 Ga0075365_10435380 3300006038 Bacteria 926
145 Ga0075368_10013803 3300006042 Bacteria 2971
146 Ga0075368_10199372 3300006042 Bacteria 847
147 Ga0075363_100026101 3300006048 Bacteria 2986
148 Ga0075363_100156143 3300006048 Bacteria 1290
149 Ga0075364_10002638 3300006051 Bacteria 10071
150 Ga0075364_10011561 3300006051 Bacteria 5365
151 Ga0075364_10040502 3300006051 Bacteria 3021
152 Ga0075364_10043475 3300006051 Bacteria 2921
153 Ga0070712_100441665 3300006175 Bacteria 1082
154 Ga0075362_10545207 3300006177 Bacteria 596
155 Ga0075367_10365112 3300006178 Bacteria 912
156 Ga0075369_10187036 3300006186 Bacteria 954
157 Ga0097621_100054172 3300006237 Bacteria 3270
158 Ga0097621_100166848 3300006237 Bacteria 1896
159 Ga0075370_10111625 3300006353 Bacteria 1588
160 Ga0068871_100111897 3300006358 Bacteria 2297
161 Ga0068871_100121355 3300006358 Bacteria 2208
162 Ga0068871_100239775 3300006358 Bacteria 1576
163 Ga0075428_100406403 3300006844 Bacteria 1459
164 Ga0075434_100065290 3300006871 Bacteria 3625
165 Ga0075434_100210850 3300006871 Bacteria 1963
166 Ga0075434_102251380 3300006871 Bacteria 548
167 Ga0068865_100092744 3300006881 Bacteria 2195
168 Ga0068865_100166777 3300006881 Bacteria 1685
169 Ga0068865_100819529 3300006881 Unclassified 804
170 Ga0068865_101646985 3300006881 Bacteria 578
171 Ga0097620_100116394 3300006931 Bacteria 2738
172 Ga0097620_100157404 3300006931 Bacteria 2350
173 Ga0097620_100722810 3300006931 Bacteria 1086
174 Ga0097620_100895331 3300006931 Bacteria 972
175 Ga0097620_101189142 3300006931 Bacteria 840
176 Ga0075435_100011315 3300007076 Bacteria 6558
177 Ga0075435_100714164 3300007076 Bacteria 871
178 Ga0105240_10002731 3300009093 Bacteria 27994
179 Ga0111539_10267426 3300009094 Bacteria 1990
180 Ga0105245_10079138 3300009098 Bacteria 3001
181 Ga0105245_10670425 3300009098 Bacteria 1068
182 Ga0105245_11147643 3300009098 Unclassified 824
183 Ga0114129_10488068 3300009147 Bacteria 1611
184 Ga0114129_11361567 3300009147 Bacteria 877
185 Ga0105243_10190428 3300009148 Bacteria 1791
186 Ga0105243_10387272 3300009148 Bacteria 1295
187 Ga0105243_11265979 3300009148 Bacteria 753
188 Ga0105241_10195011 3300009174 Bacteria 1688
189 Ga0105242_10014342 3300009176 Bacteria 6138
190 Ga0105242_10026103 3300009176 Bacteria 4628
191 Ga0105242_10028868 3300009176 Bacteria 4419
192 Ga0105248_10020090 3300009177 Bacteria 7399
193 Ga0105248_10532447 3300009177 Bacteria 1325
194 Ga0105237_10141370 3300009545 Bacteria 2401
195 Ga0105238_10000890 3300009551 Bacteria 30714
196 Ga0105249_10049005 3300009553 Bacteria 3852
197 Ga0105239_10008947 3300010375 Bacteria 11329
198 Ga0157371_11401854 3300013102 Bacteria 543
199 Ga0157370_10071490 3300013104 Bacteria 3273
200 Ga0157370_11442686 3300013104 Bacteria 619
201 Ga0157374_10278933 3300013296 Bacteria 1650
202 Ga0157374_11362311 3300013296 Bacteria 732
203 Ga0157378_10014636 3300013297 Bacteria 6868
204 Ga0163162_10114058 3300013306 Bacteria 2801
205 Ga0163162_10956348 3300013306 Bacteria 967
206 Ga0157372_10027498 3300013307 Bacteria 6196
207 Ga0157375_10050581 3300013308 Bacteria 4076
208 Ga0157375_10067661 3300013308 Bacteria 3570
209 Ga0157375_10224402 3300013308 Bacteria 2038
210 Ga0157375_10262089 3300013308 Bacteria 1890
211 Ga0157375_10438505 3300013308 Bacteria 1472
212 Ga0163163_10005079 3300014325 Bacteria 11340
213 Ga0163163_10044327 3300014325 Bacteria 4364
214 Ga0163163_10497544 3300014325 Bacteria 1281
215 Ga0157380_10010976 3300014326 Bacteria 6533
216 Ga0157380_10027070 3300014326 Bacteria 4357
217 Ga0182008_10114148 3300014497 Bacteria 1339
218 Ga0157379_10026788 3300014968 Bacteria 5131
219 Ga0157379_10045101 3300014968 Bacteria 3936
220 Ga0157379_10056029 3300014968 Bacteria 3523
221 Ga0157379_10210592 3300014968 Bacteria 1760
222 Ga0157379_10269194 3300014968 Bacteria 1549
223 Ga0157376_10014685 3300014969 Bacteria 5888
224 Ga0157376_10157148 3300014969 Bacteria 2057
225 Ga0157376_10492005 3300014969 Bacteria 1204
226 Ga0163161_10027732 3300017792 Bacteria 4018
227 Ga0163161_10101680 3300017792 Unclassified 2140
228 Ga0163161_10424264 3300017792 Bacteria 1071
229 Ga0213871_10021626 3300021441 Bacteria 1605
230 Ga0207666_1015427 3300025271 Bacteria 1088
231 Ga0207682_10244565 3300025893 Bacteria 834
232 Ga0207692_10089627 3300025898 Bacteria 1665
233 Ga0207642_10067624 3300025899 Bacteria 1687
234 Ga0207680_10427200 3300025903 Bacteria 939
235 Ga0207680_10476979 3300025903 Bacteria 887
236 Ga0207645_10092513 3300025907 Bacteria 1945
237 Ga0207643_10087872 3300025908 Bacteria 1808
238 Ga0207643_10129258 3300025908 Bacteria 1502
239 Ga0207643_10253259 3300025908 Bacteria 1085
240 Ga0207684_10010997 3300025910 Bacteria 7936
241 Ga0207684_10037051 3300025910 Bacteria 4140
242 Ga0207684_11302532 3300025910 Bacteria 598
243 Ga0207707_10043051 3300025912 Bacteria 3939
244 Ga0207671_10244064 3300025914 Bacteria 1411
245 Ga0207663_10019129 3300025916 Bacteria 3851
246 Ga0207660_10059355 3300025917 Bacteria 2746
247 Ga0207662_10158358 3300025918 Bacteria 1445
248 Ga0207657_10005307 3300025919 Bacteria 13507
249 Ga0207649_10539005 3300025920 Bacteria 892
250 Ga0207652_10042077 3300025921 Bacteria 3887
251 Ga0207646_10105369 3300025922 Bacteria 2529
252 Ga0207646_10105500 3300025922 Bacteria 2527
253 Ga0207681_10202523 3300025923 Bacteria 1525
254 Ga0207681_10281137 3300025923 Unclassified 1310
255 Ga0207681_10334496 3300025923 Bacteria 1208
256 Ga0207681_10949097 3300025923 Bacteria 721
257 Ga0207681_11002936 3300025923 Bacteria 700
258 Ga0207650_10002799 3300025925 Bacteria 12042
259 Ga0207650_10006933 3300025925 Bacteria 7724
260 Ga0207650_10019993 3300025925 Bacteria 4715
261 Ga0207659_10082416 3300025926 Bacteria 2381
262 Ga0207659_10190850 3300025926 Unclassified 1630
263 Ga0207687_10761348 3300025927 Bacteria 824
264 Ga0207700_10776938 3300025928 Bacteria 856
265 Ga0207664_10159397 3300025929 Bacteria 1923
266 Ga0207644_10312794 3300025931 Unclassified 1268
267 Ga0207644_10371434 3300025931 Bacteria 1165
268 Ga0207644_10695078 3300025931 Bacteria 848
269 Ga0207644_10904490 3300025931 Bacteria 740
270 Ga0207690_10455717 3300025932 Bacteria 1029
271 Ga0207686_10132343 3300025934 Bacteria 1712
272 Ga0207670_10169450 3300025936 Bacteria 1636
273 Ga0207670_11007154 3300025936 Bacteria 701
274 Ga0207669_10008037 3300025937 Bacteria 4931
275 Ga0207669_10013759 3300025937 Bacteria 4033
276 Ga0207669_10884886 3300025937 Bacteria 745
277 Ga0207704_10186828 3300025938 Bacteria 1503
278 Ga0207704_10213443 3300025938 Bacteria 1422
279 Ga0207665_10258953 3300025939 Bacteria 1288
280 Ga0207691_10001801 3300025940 Bacteria 21033
281 Ga0207691_10010034 3300025940 Bacteria 9086
282 Ga0207691_10090394 3300025940 Bacteria 2744
283 Ga0207691_10306096 3300025940 Bacteria 1364
284 Ga0207691_10322955 3300025940 Bacteria 1323
285 Ga0207689_10084980 3300025942 Bacteria 2601
286 Ga0207689_10478624 3300025942 Bacteria 1042
287 Ga0207661_10028704 3300025944 Bacteria 4264
288 Ga0207679_10022061 3300025945 Bacteria 4329
289 Ga0207679_10193712 3300025945 Bacteria 1692
290 Ga0207679_10276695 3300025945 Bacteria 1438
291 Ga0207667_10031766 3300025949 Bacteria 5696
292 Ga0207651_10075722 3300025960 Bacteria 2403
293 Ga0207651_10142156 3300025960 Unclassified 1855
294 Ga0207651_10251703 3300025960 Bacteria 1446
295 Ga0207651_10732602 3300025960 Bacteria 873
296 Ga0207651_11012830 3300025960 Bacteria 742
297 Ga0207712_10558841 3300025961 Bacteria 985
298 Ga0207668_10016974 3300025972 Bacteria 4555
299 Ga0207668_10188917 3300025972 Bacteria 1631
300 Ga0207668_11148645 3300025972 Bacteria 697
301 Ga0207668_11162973 3300025972 Bacteria 693
302 Ga0207668_11223412 3300025972 Bacteria 675
303 Ga0207668_11411837 3300025972 Unclassified 628
304 Ga0207640_11252701 3300025981 Bacteria 661
305 Ga0207658_10320453 3300025986 Bacteria 1342
306 Ga0207658_10928445 3300025986 Bacteria 793
307 Ga0207658_11375603 3300025986 Bacteria 646
308 Ga0207677_10270908 3300026023 Bacteria 1389
309 Ga0207677_11616303 3300026023 Bacteria 600
310 Ga0207703_10174784 3300026035 Unclassified 1892
311 Ga0207639_10063351 3300026041 Bacteria 2863
312 Ga0207708_10062871 3300026075 Bacteria 2836
313 Ga0207708_10281062 3300026075 Bacteria 1349
314 Ga0207702_10018475 3300026078 Bacteria 5768
315 Ga0207702_10258552 3300026078 Bacteria 1638
316 Ga0207641_10070155 3300026088 Bacteria 3011
317 Ga0207641_10082199 3300026088 Bacteria 2798
318 Ga0207641_10274813 3300026088 Bacteria 1582
319 Ga0207641_10552981 3300026088 Unclassified 1123
320 Ga0207641_11657168 3300026088 Bacteria 642
321 Ga0207648_10002884 3300026089 Bacteria 18209
322 Ga0207648_10013098 3300026089 Bacteria 7732
323 Ga0207648_10108614 3300026089 Unclassified 2435
324 Ga0207648_10155741 3300026089 Bacteria 2017
325 Ga0207648_10749015 3300026089 Bacteria 907
326 Ga0207676_10002733 3300026095 Bacteria 12556
327 Ga0207676_10173533 3300026095 Bacteria 1881
328 Ga0207676_10332287 3300026095 Bacteria 1399
329 Ga0207674_10000049 3300026116 Bacteria 118784
330 Ga0207675_100035165 3300026118 Bacteria 4673
331 Ga0207675_100069355 3300026118 Bacteria 3295
332 Ga0207675_100187049 3300026118 Bacteria 1985
333 Ga0207675_100257639 3300026118 Bacteria 1690
334 Ga0207675_100365340 3300026118 Bacteria 1417
335 Ga0207683_10070585 3300026121 Bacteria 3086
336 Ga0207683_10858293 3300026121 Bacteria 843
337 Ga0207698_10082740 3300026142 Bacteria 2596
338 Ga0207428_10140224 3300027907 Bacteria 1845
339 Ga0268266_10245810 3300028379 Bacteria 1653
340 Ga0268266_10410888 3300028379 Bacteria 1281
341 Ga0268265_10016272 3300028380 Bacteria 5106
342 Ga0268265_10100697 3300028380 Bacteria 2333
343 Ga0268265_10122630 3300028380 Bacteria 2144
344 Ga0268265_10276290 3300028380 Bacteria 1501
345 Ga0268265_10553993 3300028380 Bacteria 1092
346 Ga0268264_10019491 3300028381 Bacteria 5542
347 Ga0268264_10021052 3300028381 Bacteria 5330
348 Ga0268264_10460417 3300028381 Bacteria 1234
349 Ga0268264_10642705 3300028381 Bacteria 1049
350 Ga0265330_10056072 3300031235 Bacteria 1720
351 Ga0265332_10004152 3300031238 Bacteria 6864
352 Ga0265328_10269214 3300031239 Unclassified 654
353 Ga0265325_10024199 3300031241 Bacteria 3305
354 Ga0265329_10001176 3300031242 Bacteria 12869
355 Ga0265331_10000310 3300031250 Bacteria 53265
356 Ga0265327_10075970 3300031251 Bacteria 1670
357 Ga0307513_10269533 3300031456 Bacteria 1487
358 Ga0307408_101345434 3300031548 Bacteria 671
359 Ga0265342_10035246 3300031712 Bacteria 3065
360 Ga0316576_10017666 3300031727 Bacteria 4852
361 Ga0316576_10079101 3300031727 Bacteria 2437
362 Ga0307410_10116426 3300031852 Bacteria 1942
363 Ga0307410_10550754 3300031852 Unclassified 956
364 Ga0307407_10633375 3300031903 Bacteria 799
365 Ga0307412_10197965 3300031911 Bacteria 1524
366 Ga0307412_10594910 3300031911 Bacteria 936
367 Ga0307409_100126598 3300031995 Bacteria 2174
368 Ga0307409_101260836 3300031995 Bacteria 763
369 Ga0307416_100667543 3300032002 Bacteria 1126
370 Ga0307411_10228040 3300032005 Bacteria 1450
371 Ga0307415_100885725 3300032126 Unclassified 822
372 Ga0373926_0435148 3300035083 Bacteria 520
373 Ga0373927_0083990 3300035695 Bacteria 2065
374 Ga0373927_0090477 3300035695 Bacteria 1987
375 Ga0373937_0584558 3300036401 Bacteria 1060
376 Ga0373925_0570721 3300037068 Bacteria 931
377 Ga0436363_0046258 3300039450 Bacteria 759
378 Ga0451802_0140640 3300041460 Bacteria 1337
379 Ga0451807_1778058 3300041486 Bacteria 1653
380 Ga0451853_2168318 3300041512 Bacteria 1520
381 Ga0451853_3869732 3300041512 Bacteria 612
382 Ga0450918_096878 3300042531 Bacteria 575
383 Ga0451577_0000563 3300042876 Bacteria 60331
384 Ga0453683_0560585 3300044673 Bacteria 744
385 Ga0453684_0005765 3300044712 Bacteria 24184
386 Ga0495629_1033908 3300046459 Bacteria 533
387 Ga0495580_0511777 3300046472 Bacteria 800
388 Ga0495580_0582053 3300046472 Bacteria 741
389 Ga0495621_0168255 3300046539 Bacteria 870
390 Ga0495634_0181349 3300046642 Bacteria 1318
391 Ga0495600_0595984 3300046809 Bacteria 672
392 Ga0496101_0041205 3300048904 Bacteria 3292
393 Ga0496102_0110598 3300048905 Bacteria 2561
394 Ga0496102_0500838 3300048905 Bacteria 1137
395 Ga0496103_0023801 3300048906 Bacteria 3694
396 Ga0496104_0021181 3300048907 Bacteria 5966
397 Ga0496105_0077178 3300048908 Bacteria 2751
398 Ga0496106_0022856 3300048909 Bacteria 4645
399 Ga0496109_0502235 3300048912 Bacteria 1145
400 Ga0496109_0718134 3300048912 Bacteria 937
401 Ga0496109_1373381 3300048912 Bacteria 642
402 Ga0496110_0010427 3300048913 Bacteria 7557
403 Ga0496110_0785970 3300048913 Bacteria 856
404 Ga0496111_0066137 3300048914 Bacteria 2624
405 Ga0496112_0501466 3300048915 Bacteria 1149
406 Ga0496112_1351789 3300048915 Bacteria 627
407 Ga0496113_0268606 3300048916 Bacteria 1363
408 Ga0496113_0403161 3300048916 Unclassified 1098
409 Ga0496114_0003504 3300048917 Bacteria 12045
410 Ga0496114_0219959 3300048917 Bacteria 1667
411 Ga0496114_0543057 3300048917 Bacteria 1027
412 Ga0501031_0169451 3300049568 Bacteria 1427
413 Ga0501034_0032402 3300049571 Bacteria 5307
414 Ga0501036_0481363 3300049572 Bacteria 1033
415 Ga0501038_0489428 3300049574 Bacteria 942
416 Ga0501039_0323320 3300049575 Bacteria 1212
417 Ga0501039_0584490 3300049575 Bacteria 876
418 Ga0501040_0150838 3300049576 Bacteria 1640
419 Ga0501040_0356786 3300049576 Bacteria 1048
420 Ga0501048_0274407 3300049582 Bacteria 1199
421 Ga0501069_0066485 3300049585 Bacteria 2016
422 Ga0501072_0401163 3300049588 Bacteria 1088
423 Ga0501074_0327397 3300049590 Bacteria 1088
424 Ga0501075_0138396 3300049591 Bacteria 1855
425 Ga0501075_0411245 3300049591 Bacteria 1031
426 Ga0501076_0053944 3300049592 Bacteria 3186
427 Ga0501079_0066396 3300049741 Bacteria 2784
428 Ga0501081_0710651 3300049743 Bacteria 755
429 Ga0501045_0407148 3300049824 Bacteria 1012
430 nmdc:mga03683_125355_c1 3300050489 Bacteria 1145
431 nmdc:mga03683_60468_c1 3300050489 Bacteria 1600
432 nmdc:mga03n38_114309_c1 3300050490 Bacteria 1319
433 nmdc:mga03n38_615851_c1 3300050490 Bacteria 619
434 nmdc:mga03n38_978289_c1 3300050490 Bacteria 501
435 nmdc:mga00v17_1185_c1 3300050491 Bacteria 6926
436 nmdc:mga00v17_2849_c1 3300050491 Bacteria 7961
437 nmdc:mga00v17_508460_c1 3300050491 Bacteria 780
438 nmdc:mga00v17_73397_c1 3300050491 Bacteria 2125
439 nmdc:mga0yw44_110144_c1 3300050492 Bacteria 1763
440 nmdc:mga0yw44_117623_c1 3300050492 Bacteria 1709
441 nmdc:mga0yw44_1179492_c1 3300050492 Bacteria 517
442 nmdc:mga0yw44_31828_c1 3300050492 Bacteria 3070
443 nmdc:mga0yw44_45600_c1 3300050492 Bacteria 2629
444 nmdc:mga0yw44_826_c1 3300050492 Bacteria 11574
445 nmdc:mga0k408_345506_c1 3300050493 Bacteria 887
446 nmdc:mga06z11_292288_c1 3300050494 Bacteria 967
447 nmdc:mga07m45_106211_c1 3300050496 Bacteria 1615
448 nmdc:mga05p37_1231460_c1 3300050507 Bacteria 770
449 nmdc:mga05p37_420233_c1 3300050507 Bacteria 1556
450 nmdc:mga08y16_1698026_c1 3300050511 Bacteria 587
451 nmdc:mga08y16_40222_c1 3300050511 Bacteria 2016
452 nmdc:mga0n895_85500_c1 3300050512 Bacteria 3149
453 nmdc:mga0rr50_139192_c1 3300050513 Bacteria 1951
454 nmdc:mga0rr50_653422_c1 3300050513 Bacteria 897
455 Ga0495595_0152436 3300053084 Bacteria 1138
456 Ga0495619_0397227 3300053085 Bacteria 952
457 Ga0500646_0187846 3300053090 Bacteria 703
458 Ga0500568_0042040 3300053139 Bacteria 1833
459 Ga0500616_0000434 3300053153 Bacteria 55298
460 Ga0501084_0276872 3300054114 Bacteria 1417
461 Ga0501082_0495005 3300060353 Bacteria 1068
462 Ga0530510_0064751 3300061734 Bacteria 2648
463 Ga0530510_0136166 3300061734 Bacteria 1808
464 nmdc:mga07m45_592221_c1
465 Ga0070658_10024106
466 Ga0070683_100023480
467 Ga0070690_100022880
468 Ga0070690_100402166
469 Ga0070670_100001523
470 Ga0070670_100003776
471 Ga0070670_100064727
472 Ga0070670_100155172
473 Ga0070670_100791653
474 Ga0070677_10116899
475 Ga0068869_100048681
476 Ga0068869_100850890
477 Ga0070680_100142251
478 Ga0068868_100202143
479 Ga0070660_100002577
480 Ga0070689_100070184
481 Ga0070689_100106205
482 Ga0070689_100501101
483 Ga0070689_100610170
484 Ga0070687_100358245
485 Ga0070661_100000863
486 Ga0070661_101113658
487 Ga0070668_100013395
488 Ga0070668_100105302
489 Ga0070669_100022274
490 Ga0070669_100028347
491 Ga0070669_100265623
492 Ga0070675_100019685
493 Ga0070675_100061712
494 Ga0070675_100070996
495 Ga0070671_100137059
496 Ga0070671_100198756
497 Ga0070671_100391432
498 Ga0070671_101023159
499 Ga0070671_101182175
500 Ga0070674_100029320
501 Ga0070674_100094473
502 Ga0070674_100151182
503 Ga0070674_101151907
504 Ga0070673_100185296
505 Ga0070673_100624971
506 Ga0070659_100013471
507 Ga0070667_100076543
508 Ga0070667_100167549
509 Ga0070714_100002440
510 Ga0070713_101197423
511 Ga0070710_10154658
512 Ga0070701_10027898
513 Ga0070701_10517664
514 Ga0070711_100024006
515 Ga0070700_100355110
516 Ga0070694_100055356
517 Ga0070694_100161975
518 Ga0070708_100036571
519 Ga0070678_100231599
520 Ga0070678_100416078
521 Ga0070678_100869904
522 Ga0070662_100059296
523 Ga0070681_10140416
524 Ga0068867_100012604
525 Ga0068867_100100163
526 Ga0068867_100122660
527 Ga0068867_100503325
528 Ga0068867_100643927
529 Ga0070685_10318453
530 Ga0070706_100030125
531 Ga0070706_100217200
532 Ga0070706_100227944
533 Ga0070707_100180065
534 Ga0070707_100324983
535 Ga0070707_100850975
536 Ga0070698_100067627
537 Ga0070698_101084917
538 Ga0070699_100008030
539 Ga0070679_100019757
540 Ga0070684_100184730
541 Ga0070697_100040501
542 Ga0070697_100051251
543 Ga0068853_100082742
544 Ga0070672_100008461
545 Ga0070672_100034197
546 Ga0070672_100072242
547 Ga0070672_100600821
548 Ga0070686_100117123
549 Ga0070695_100162865
550 Ga0070695_100427209
551 Ga0070693_100010286
552 Ga0070665_100182106
553 Ga0070665_100243820
554 Ga0070704_100066845
555 Ga0070704_100133480
556 Ga0068855_100014353
557 Ga0070664_100003707
558 Ga0070664_100028133
559 Ga0070664_100188260
560 Ga0070664_100978477
561 Ga0068857_100015772
562 Ga0068854_100011767
563 Ga0068854_100145967
564 Ga0068854_101758555
565 Ga0068856_100048572
566 Ga0070702_100111951
567 Ga0068852_100023545
568 Ga0068852_100513543
569 Ga0068859_100116393
570 Ga0068859_100157403
571 Ga0068859_100722725
572 Ga0068859_100895444
573 Ga0068859_101189250
574 Ga0068864_100000849
575 Ga0068864_100117727
576 Ga0068864_100193685
577 Ga0068864_101043518
578 Ga0068864_101984884
579 Ga0068866_10053828
580 Ga0068866_10889977
581 Ga0068861_100023363
582 Ga0068861_100244599
583 Ga0068861_101601681
584 Ga0068851_10030860
585 Ga0068870_10018057
586 Ga0068870_10119343
587 Ga0068863_100004993
588 Ga0068863_100079776
589 Ga0068863_100123093
590 Ga0068863_100400006
591 Ga0068863_100986581
592 Ga0068863_101117669
593 Ga0068858_100154999
594 Ga0068860_100014070
595 Ga0068860_100026979
596 Ga0068860_100084630
597 Ga0068860_100105502
598 Ga0068860_100200275
599 Ga0068860_100527487
600 Ga0068862_100054254
601 Ga0068862_100071793
602 Ga0075365_10015076
603 Ga0075365_10015408
604 Ga0075365_10052950
605 Ga0075365_10117029
606 Ga0075365_10276807
607 Ga0075365_10435380
608 Ga0075368_10013803
609 Ga0075368_10199372
610 Ga0075363_100026101
611 Ga0075363_100156143
612 Ga0075364_10002638
613 Ga0075364_10011561
614 Ga0075364_10040502
615 Ga0075364_10043475
616 Ga0070712_100441665
617 Ga0075362_10545207
618 Ga0075367_10365112
619 Ga0075369_10187036
620 Ga0097621_100054172
621 Ga0097621_100166848
622 Ga0075370_10111625
623 Ga0068871_100111897
624 Ga0068871_100121355
625 Ga0068871_100239775
626 Ga0075428_100406403
627 Ga0075434_100065290
628 Ga0075434_100210850
629 Ga0075434_102251380
630 Ga0068865_100092744
631 Ga0068865_100166777
632 Ga0068865_100819529
633 Ga0068865_101646985
634 Ga0097620_100116394
635 Ga0097620_100157404
636 Ga0097620_100722810
637 Ga0097620_100895331
638 Ga0097620_101189142
639 Ga0075435_100011315
640 Ga0075435_100714164
641 Ga0105240_10002731
642 Ga0111539_10267426
643 Ga0105245_10079138
644 Ga0105245_10670425
645 Ga0105245_11147643
646 Ga0114129_10488068
647 Ga0114129_11361567
648 Ga0105243_10190428
649 Ga0105243_10387272
650 Ga0105243_11265979
651 Ga0105241_10195011
652 Ga0105242_10014342
653 Ga0105242_10026103
654 Ga0105242_10028868
655 Ga0105248_10020090
656 Ga0105248_10532447
657 Ga0105237_10141370
658 Ga0105238_10000890
659 Ga0105249_10049005
660 Ga0105239_10008947
661 Ga0157371_11401854
662 Ga0157370_10071490
663 Ga0157370_11442686
664 Ga0157374_10278933
665 Ga0157374_11362311
666 Ga0157378_10014636
667 Ga0163162_10114058
668 Ga0163162_10956348
669 Ga0157372_10027498
670 Ga0157375_10050581
671 Ga0157375_10067661
672 Ga0157375_10224402
673 Ga0157375_10262089
674 Ga0157375_10438505
675 Ga0163163_10005079
676 Ga0163163_10044327
677 Ga0163163_10497544
678 Ga0157380_10010976
679 Ga0157380_10027070
680 Ga0182008_10114148
681 Ga0157379_10026788
682 Ga0157379_10045101
683 Ga0157379_10056029
684 Ga0157379_10210592
685 Ga0157379_10269194
686 Ga0157376_10014685
687 Ga0157376_10157148
688 Ga0157376_10492005
689 Ga0163161_10027732
690 Ga0163161_10101680
691 Ga0163161_10424264
692 Ga0213871_10021626
693 Ga0207666_1015427
694 Ga0207682_10244565
695 Ga0207692_10089627
696 Ga0207642_10067624
697 Ga0207680_10427200
698 Ga0207680_10476979
699 Ga0207645_10092513
700 Ga0207643_10087872
701 Ga0207643_10129258
702 Ga0207643_10253259
703 Ga0207684_10010997
704 Ga0207684_10037051
705 Ga0207684_11302532
706 Ga0207707_10043051
707 Ga0207671_10244064
708 Ga0207663_10019129
709 Ga0207660_10059355
710 Ga0207662_10158358
711 Ga0207657_10005307
712 Ga0207649_10539005
713 Ga0207652_10042077
714 Ga0207646_10105369
715 Ga0207646_10105500
716 Ga0207681_10202523
717 Ga0207681_10281137
718 Ga0207681_10334496
719 Ga0207681_10949097
720 Ga0207681_11002936
721 Ga0207650_10002799
722 Ga0207650_10006933
723 Ga0207650_10019993
724 Ga0207659_10082416
725 Ga0207659_10190850
726 Ga0207687_10761348
727 Ga0207700_10776938
728 Ga0207664_10159397
729 Ga0207644_10312794
730 Ga0207644_10371434
731 Ga0207644_10695078
732 Ga0207644_10904490
733 Ga0207690_10455717
734 Ga0207686_10132343
735 Ga0207670_10169450
736 Ga0207670_11007154
737 Ga0207669_10008037
738 Ga0207669_10013759
739 Ga0207669_10884886
740 Ga0207704_10186828
741 Ga0207704_10213443
742 Ga0207665_10258953
743 Ga0207691_10001801
744 Ga0207691_10010034
745 Ga0207691_10090394
746 Ga0207691_10306096
747 Ga0207691_10322955
748 Ga0207689_10084980
749 Ga0207689_10478624
750 Ga0207661_10028704
751 Ga0207679_10022061
752 Ga0207679_10193712
753 Ga0207679_10276695
754 Ga0207667_10031766
755 Ga0207651_10075722
756 Ga0207651_10142156
757 Ga0207651_10251703
758 Ga0207651_10732602
759 Ga0207651_11012830
760 Ga0207712_10558841
761 Ga0207668_10016974
762 Ga0207668_10188917
763 Ga0207668_11148645
764 Ga0207668_11162973
765 Ga0207668_11223412
766 Ga0207668_11411837
767 Ga0207640_11252701
768 Ga0207658_10320453
769 Ga0207658_10928445
770 Ga0207658_11375603
771 Ga0207677_10270908
772 Ga0207677_11616303
773 Ga0207703_10174784
774 Ga0207639_10063351
775 Ga0207708_10062871
776 Ga0207708_10281062
777 Ga0207702_10018475
778 Ga0207702_10258552
779 Ga0207641_10070155
780 Ga0207641_10082199
781 Ga0207641_10274813
782 Ga0207641_10552981
783 Ga0207641_11657168
784 Ga0207648_10002884
785 Ga0207648_10013098
786 Ga0207648_10108614
787 Ga0207648_10155741
788 Ga0207648_10749015
789 Ga0207676_10002733
790 Ga0207676_10173533
791 Ga0207676_10332287
792 Ga0207674_10000049
793 Ga0207675_100035165
794 Ga0207675_100069355
795 Ga0207675_100187049
796 Ga0207675_100257639
797 Ga0207675_100365340
798 Ga0207683_10070585
799 Ga0207683_10858293
800 Ga0207698_10082740
801 Ga0207428_10140224
802 Ga0268266_10245810
803 Ga0268266_10410888
804 Ga0268265_10016272
805 Ga0268265_10100697
806 Ga0268265_10122630
807 Ga0268265_10276290
808 Ga0268265_10553993
809 Ga0268264_10019491
810 Ga0268264_10021052
811 Ga0268264_10460417
812 Ga0268264_10642705
813 Ga0265330_10056072
814 Ga0265332_10004152
815 Ga0265328_10269214
816 Ga0265325_10024199
817 Ga0265329_10001176
818 Ga0265331_10000310
819 Ga0265327_10075970
820 Ga0307513_10269533
821 Ga0307408_101345434
822 Ga0265342_10035246
823 Ga0316576_10017666
824 Ga0316576_10079101
825 Ga0307410_10116426
826 Ga0307410_10550754
827 Ga0307407_10633375
828 Ga0307412_10197965
829 Ga0307412_10594910
830 Ga0307409_100126598
831 Ga0307409_101260836
832 Ga0307416_100667543
833 Ga0307411_10228040
834 Ga0307415_100885725
835 Ga0373926_0435148
836 Ga0373927_0083990
837 Ga0373927_0090477
838 Ga0373937_0584558
839 Ga0373925_0570721
840 Ga0436363_0046258
841 Ga0451802_0140640
842 Ga0451807_1778058
843 Ga0451853_2168318
844 Ga0451853_3869732
845 Ga0450918_096878
846 Ga0451577_0000563
847 Ga0453683_0560585
848 Ga0453684_0005765
849 Ga0495629_1033908
850 Ga0495580_0511777
851 Ga0495580_0582053
852 Ga0495621_0168255
853 Ga0495634_0181349
854 Ga0495600_0595984
855 Ga0496101_0041205
856 Ga0496102_0110598
857 Ga0496102_0500838
858 Ga0496103_0023801
859 Ga0496104_0021181
860 Ga0496105_0077178
861 Ga0496106_0022856
862 Ga0496109_0502235
863 Ga0496109_0718134
864 Ga0496109_1373381
865 Ga0496110_0010427
866 Ga0496110_0785970
867 Ga0496111_0066137
868 Ga0496112_0501466
869 Ga0496112_1351789
870 Ga0496113_0268606
871 Ga0496113_0403161
872 Ga0496114_0003504
873 Ga0496114_0219959
874 Ga0496114_0543057
875 Ga0501031_0169451
876 Ga0501034_0032402
877 Ga0501036_0481363
878 Ga0501038_0489428
879 Ga0501039_0323320
880 Ga0501039_0584490
881 Ga0501040_0150838
882 Ga0501040_0356786
883 Ga0501048_0274407
884 Ga0501069_0066485
885 Ga0501072_0401163
886 Ga0501074_0327397
887 Ga0501075_0138396
888 Ga0501075_0411245
889 Ga0501076_0053944
890 Ga0501079_0066396
891 Ga0501081_0710651
892 Ga0501045_0407148
893 nmdc:mga03683_125355_c1
894 nmdc:mga03683_60468_c1
895 nmdc:mga03n38_114309_c1
896 nmdc:mga03n38_615851_c1
897 nmdc:mga03n38_978289_c1
898 nmdc:mga00v17_1185_c1
899 nmdc:mga00v17_2849_c1
900 nmdc:mga00v17_508460_c1
901 nmdc:mga00v17_73397_c1
902 nmdc:mga0yw44_110144_c1
903 nmdc:mga0yw44_117623_c1
904 nmdc:mga0yw44_1179492_c1
905 nmdc:mga0yw44_31828_c1
906 nmdc:mga0yw44_45600_c1
907 nmdc:mga0yw44_826_c1
908 nmdc:mga0k408_345506_c1
909 nmdc:mga06z11_292288_c1
910 nmdc:mga07m45_106211_c1
911 nmdc:mga05p37_1231460_c1
912 nmdc:mga05p37_420233_c1
913 nmdc:mga08y16_1698026_c1
914 nmdc:mga08y16_40222_c1
915 nmdc:mga0n895_85500_c1
916 nmdc:mga0rr50_139192_c1
917 nmdc:mga0rr50_653422_c1
918 Ga0495595_0152436
919 Ga0495619_0397227
920 Ga0500646_0187846
921 Ga0500568_0042040
922 Ga0500616_0000434
923 Ga0501084_0276872
924 Ga0501082_0495005
925 Ga0530510_0064751
926 Ga0530510_0136166

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

28

174

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dbo-assembly1.cif.gz_A-2 crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus 0.9651 2 143
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9597 2 140
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9576 2 141
3lmv-assembly2.cif.gz_C d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes 0.954 2 144
3knf-assembly2.cif.gz_D crystal structure of d-tyr-trna(tyr) deacylase from plasmodium falciparum 0.9528 2 143
ID Description Score Start End Superfamily
af_O14274_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9683 2 144 3.50.80.10
af_Q07648_1_150_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9675 2 144 3.50.80.10
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9651 2 143 3.50.80.10
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9576 2 141 3.50.80.10
4nbiA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9495 2 143 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A7Y3ENM8-F1-model_v4 D-tyrosyl-tRNA(Tyr) deacylase 0.9914 2 74 GO:0005737
GO:0051500
AF-A0A7Y3BWC1-F1-model_v4 D-tyrosyl-tRNA(Tyr) deacylase 0.9911 2 75 GO:0005737
GO:0016020
GO:0051500
AF-A0A562MVL7-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9888 2 145 GO:0000049
GO:0005737
GO:0016020
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A1H3FR06-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9884 2 141 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A6A5L4H2-F1-model_v4 deleted 0.9882 2 146

Map