F449178

General Info

Members Datasets Scaffolds Average Seq Length
463 264 926 174

Family's Representative Sequence

Representative Sequence 3300047444|Ga0495675_0175178|Ga0495675_0175178_227_847
Length 206
Sequence VVESPYEPQEDRMNHPPDPAASDEPEEAGLSGMSADEILDIVDEQDRVIGRAPRGEAYAKGLRHRCAFILARDAQDRIFVHRRTAAKLVFPSLYDMFVGGVVGAGETYDEAALREAEEELGVSGLPRPERLFTFLYEDGPRTWWSAVYQVRCELPVSPQESEVAWHAFLTEEELTARLTEWEWVPDGLEGYRRLLEWRAGRGADTP

Samples

Sample ID Description Type Environment
1 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
11 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
12 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
13 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
14 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
15 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
16 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
17 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
18 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
19 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
20 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
25 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
26 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
27 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
28 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
29 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
30 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
31 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
32 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
33 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
34 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
35 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
36 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
37 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
38 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
39 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
40 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
41 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
42 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
43 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
44 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
45 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
46 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
47 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
48 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
49 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
50 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
51 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
52 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
53 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
54 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
55 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
56 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
57 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
58 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
59 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
60 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
61 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
62 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
63 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
64 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
65 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
66 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
67 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
68 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
69 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
70 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
73 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
74 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
82 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
85 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
91 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
92 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
93 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
96 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
97 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
98 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
99 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
100 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
101 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
102 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
103 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
107 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
108 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
109 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
133 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
134 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
135 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
145 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
146 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
147 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
148 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
149 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
155 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
162 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
187 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
188 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
189 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
190 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
191 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
192 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
193 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
194 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
195 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
196 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
197 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
198 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
199 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
200 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
201 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
202 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
203 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
204 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
205 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
206 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
208 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
209 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
210 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
211 2643221548 Streptomyces sp. Root55 Isolate Unclassified
212 2643221647 Streptomyces sp. Root369 Isolate Unclassified
213 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
214 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
215 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
216 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
217 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
218 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
219 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
220 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
221 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
222 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
223 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
224 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
225 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
226 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
227 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
228 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
229 2862574272 Streptomyces sp. AcE210 Isolate Nodule
230 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
231 2867428634 Streptomyces sp. RP5T Isolate Unclassified
232 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
233 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
234 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
235 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
236 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
237 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
238 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
239 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
240 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
241 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
242 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
243 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
244 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
245 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
246 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
247 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
248 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
249 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
250 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
251 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
252 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
253 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
254 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
255 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
256 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
257 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
258 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
259 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
260 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
261 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
262 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
263 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
264 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.26
Metatranscriptomes 0.43
Isolates 12.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.05
Nodule 0.86
Rhizoplane 1.51
Rhizosphere 77.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495675_0175178 3300047444 Bacteria 1316
2 JGI24739J22299_10039086 3300001989 Bacteria 1592
3 JGI24737J22298_10154727 3300001990 Bacteria 677
4 JGI25153J46596_10046077 3300003215 Bacteria 1295
5 rootH1_10027633 3300003316 Bacteria 7980
6 rootH1_10051549 3300003316 Bacteria 1650
7 rootH2_10020050 3300003320 Bacteria 7258
8 rootH2_10024457 3300003320 Bacteria 3301
9 rootH2_10065661 3300003320 Bacteria 3789
10 rootL2_10137364 3300003322 Bacteria 3434
11 rootL2_10261584 3300003322 Bacteria 1317
12 rootH1_10034134 3300003323 Bacteria 5608
13 rootH1_10051651 3300003323 Bacteria 4961
14 rootH1_10127743 3300003323 Bacteria 1758
15 Ga0006562J51391_1070418 3300003578 Bacteria 1210
16 Ga0006562J51391_1089879 3300003578 Bacteria 1550
17 Ga0075368_10034842 3300006042 Bacteria 1963
18 Ga0105251_10034857 3300009011 Bacteria 2487
19 Ga0105244_10382402 3300009036 Bacteria 648
20 Ga0105243_10153206 3300009148 Bacteria 1980
21 Ga0105248_11167549 3300009177 Bacteria 870
22 Ga0105239_10522106 3300010375 Bacteria 1351
23 Ga0105239_12158134 3300010375 Bacteria 647
24 Ga0105246_10018855 3300011119 Bacteria 4400
25 Ga0182006_1127816 3300015261 Bacteria 877
26 Ga0182007_10000452 3300015262 Bacteria 24843
27 Ga0209758_1008332 3300025297 Bacteria 6753
28 Ga0207713_1029181 3300025735 Bacteria 2475
29 Ga0207647_10010840 3300025904 Bacteria 6416
30 Ga0207667_10931249 3300025949 Bacteria 859
31 Ga0207702_10060728 3300026078 Bacteria 3223
32 Ga0209282_1219011 3300027666 Bacteria 863
33 Ga0307517_10012816 3300028786 Bacteria 11459
34 Ga0307515_10035257 3300028794 Bacteria 8147
35 Ga0307515_10049629 3300028794 Bacteria 6305
36 Ga0307511_10000282 3300030521 Bacteria 53455
37 Ga0307511_10181102 3300030521 Bacteria 1135
38 Ga0307512_10002276 3300030522 Bacteria 24838
39 Ga0307512_10134126 3300030522 Bacteria 1541
40 Ga0307513_10019439 3300031456 Bacteria 8087
41 Ga0307513_10023734 3300031456 Bacteria 7158
42 Ga0307513_10183316 3300031456 Bacteria 1954
43 Ga0307513_10290905 3300031456 Bacteria 1405
44 Ga0307509_10017499 3300031507 Bacteria 8247
45 Ga0307509_10045221 3300031507 Bacteria 4750
46 Ga0307509_10058801 3300031507 Bacteria 4069
47 Ga0307509_10255990 3300031507 Bacteria 1530
48 Ga0307509_10424553 3300031507 Bacteria 1029
49 Ga0307508_10001243 3300031616 Bacteria 29109
50 Ga0307508_10014612 3300031616 Bacteria 7163
51 Ga0307508_10027257 3300031616 Bacteria 5173
52 Ga0307508_10237352 3300031616 Bacteria 1421
53 Ga0307514_10093615 3300031649 Bacteria 2181
54 Ga0307514_10203354 3300031649 Bacteria 1241
55 Ga0307514_10232789 3300031649 Bacteria 1114
56 Ga0307516_10003084 3300031730 Bacteria 21689
57 Ga0307516_10111593 3300031730 Bacteria 2536
58 Ga0307413_10136261 3300031824 Bacteria 1689
59 Ga0307518_10006487 3300031838 Bacteria 8391
60 Ga0307518_10048201 3300031838 Bacteria 3097
61 Ga0307518_10152783 3300031838 Bacteria 1595
62 Ga0307518_10179506 3300031838 Bacteria 1433
63 Ga0307518_10259519 3300031838 Bacteria 1096
64 Ga0307410_10150407 3300031852 Bacteria 1733
65 Ga0307410_10936817 3300031852 Bacteria 744
66 Ga0307406_10125792 3300031901 Bacteria 1791
67 Ga0307407_10355327 3300031903 Bacteria 1039
68 Ga0307409_100084722 3300031995 Bacteria 2575
69 Ga0307409_100306526 3300031995 Bacteria 1480
70 Ga0307507_10010824 3300033179 Bacteria 11664
71 Ga0307507_10052470 3300033179 Bacteria 3908
72 Ga0307510_10147403 3300033180 Bacteria 1982
73 Ga0395900_0101307 3300037418 Bacteria 2958
74 Ga0395900_0779404 3300037418 Bacteria 885
75 Ga0395898_0110034 3300037466 Bacteria 2641
76 Ga0395905_0214474 3300037471 Bacteria 1803
77 Ga0395901_1510627 3300038443 Bacteria 627
78 Ga0439436_0002008 3300041404 Bacteria 6044
79 Ga0439436_0057494 3300041404 Bacteria 1091
80 Ga0439439_0000550 3300041406 Bacteria 6539
81 Ga0439439_0019423 3300041406 Bacteria 1686
82 Ga0451800_0611566 3300041459 Bacteria 909
83 Ga0451833_1447417 3300041491 Bacteria 1071
84 Ga0451845_0026182 3300041501 Bacteria 612
85 Ga0451853_0181483 3300041512 Bacteria 3578
86 Ga0439433_0006964 3300041999 Bacteria 2439
87 Ga0439449_0064894 3300042007 Bacteria 1347
88 Ga0439449_0089179 3300042007 Bacteria 1138
89 Ga0439449_0193091 3300042007 Bacteria 762
90 Ga0439450_013428 3300042008 Bacteria 1646
91 Ga0439457_004759 3300042014 Bacteria 3500
92 Ga0439457_116526 3300042014 Bacteria 629
93 Ga0439462_0038343 3300042015 Bacteria 1277
94 Ga0450920_040153 3300042122 Bacteria 933
95 Ga0450894_000348 3300042131 Bacteria 8155
96 Ga0450896_005531 3300042133 Bacteria 1723
97 Ga0450898_006046 3300042134 Bacteria 1847
98 Ga0450899_000244 3300042135 Bacteria 5831
99 Ga0450903_000019 3300042138 Bacteria 31775
100 Ga0450906_003297 3300042145 Bacteria 3487
101 Ga0439458_0001449 3300042157 Bacteria 5974
102 Ga0450908_002611 3300042184 Bacteria 3534
103 Ga0466969_0008336 3300044656 Bacteria 5496
104 Ga0466972_0019677 3300044658 Bacteria 3375
105 Ga0466965_0002191 3300044683 Bacteria 8214
106 Ga0466965_0276838 3300044683 Bacteria 905
107 Ga0466966_0019977 3300044684 Bacteria 4406
108 Ga0466966_0041293 3300044684 Bacteria 2964
109 Ga0466961_0002492 3300044693 Bacteria 11419
110 Ga0466961_0009047 3300044693 Bacteria 6353
111 Ga0466963_0002580 3300044694 Bacteria 10163
112 Ga0466963_0135961 3300044694 Bacteria 1700
113 Ga0466964_0039662 3300044706 Bacteria 1899
114 Ga0466964_0063631 3300044706 Bacteria 1541
115 Ga0466971_0001320 3300044719 Bacteria 10367
116 Ga0466971_0138824 3300044719 Bacteria 1131
117 Ga0466971_0203870 3300044719 Bacteria 934
118 Ga0466968_0004907 3300044735 Bacteria 5005
119 Ga0466968_0091407 3300044735 Bacteria 1349
120 Ga0466968_0222200 3300044735 Bacteria 890
121 Ga0466970_0000814 3300044765 Bacteria 14993
122 Ga0466970_0004388 3300044765 Bacteria 6950
123 Ga0466970_0586756 3300044765 Bacteria 646
124 Ga0466957_0005315 3300044842 Bacteria 7220
125 Ga0466960_0016718 3300044901 Bacteria 3187
126 Ga0466960_0239581 3300044901 Bacteria 1004
127 Ga0466960_0714743 3300044901 Bacteria 602
128 Ga0466959_0005165 3300045049 Bacteria 8895
129 Ga0466958_0002687 3300045836 Bacteria 9012
130 Ga0466967_0014621 3300045976 Bacteria 6123
131 Ga0466967_0031983 3300045976 Bacteria 4438
132 Ga0466967_0229069 3300045976 Bacteria 1769
133 Ga0495617_028503 3300046452 Bacteria 1876
134 Ga0495627_026621 3300046453 Bacteria 1863
135 Ga0495592_0005819 3300046454 Bacteria 9141
136 Ga0495592_0163518 3300046454 Bacteria 1529
137 Ga0495603_0000404 3300046455 Bacteria 23775
138 Ga0495603_0024714 3300046455 Bacteria 3634
139 Ga0495603_0031477 3300046455 Bacteria 3193
140 Ga0495603_0140266 3300046455 Bacteria 1406
141 Ga0495590_0073833 3300046457 Bacteria 1199
142 Ga0495629_0001920 3300046459 Bacteria 16203
143 Ga0495629_0015866 3300046459 Bacteria 5413
144 Ga0495629_0036741 3300046459 Bacteria 3456
145 Ga0495629_0037270 3300046459 Bacteria 3427
146 Ga0495629_0040688 3300046459 Bacteria 3270
147 Ga0495629_0076711 3300046459 Bacteria 2333
148 Ga0495629_0219009 3300046459 Bacteria 1313
149 Ga0495629_0240912 3300046459 Bacteria 1245
150 Ga0495629_0296565 3300046459 Bacteria 1107
151 Ga0495629_0761245 3300046459 Bacteria 640
152 Ga0495638_0289735 3300046460 Bacteria 886
153 Ga0495651_0022796 3300046462 Bacteria 4868
154 Ga0495651_0047005 3300046462 Bacteria 3339
155 Ga0495651_0209809 3300046462 Bacteria 1356
156 Ga0495653_0292083 3300046463 Bacteria 1066
157 Ga0495582_0257479 3300046473 Bacteria 1001
158 Ga0495605_0036561 3300046474 Bacteria 2475
159 Ga0495605_0104334 3300046474 Bacteria 1299
160 Ga0495639_0069140 3300046475 Bacteria 1628
161 Ga0495639_0081384 3300046475 Bacteria 1509
162 Ga0495662_0000555 3300046476 Bacteria 17128
163 Ga0495662_0017267 3300046476 Bacteria 3492
164 Ga0495662_0026693 3300046476 Bacteria 2788
165 Ga0495662_0047015 3300046476 Bacteria 2083
166 Ga0495662_0155560 3300046476 Bacteria 1126
167 Ga0495664_0006957 3300046477 Bacteria 6263
168 Ga0495584_0083543 3300046491 Bacteria 1608
169 Ga0495585_0005238 3300046492 Bacteria 8216
170 Ga0495585_0258304 3300046492 Bacteria 867
171 Ga0495594_0001105 3300046499 Bacteria 14070
172 Ga0495594_0033656 3300046499 Bacteria 2787
173 Ga0495594_0079709 3300046499 Bacteria 1828
174 Ga0495594_0145319 3300046499 Bacteria 1345
175 Ga0495594_0157826 3300046499 Bacteria 1289
176 Ga0495594_0635592 3300046499 Bacteria 604
177 Ga0495607_0096420 3300046501 Bacteria 1592
178 Ga0495583_0032874 3300046506 Bacteria 2500
179 Ga0495610_0047399 3300046512 Bacteria 2114
180 Ga0495610_0120298 3300046512 Bacteria 1151
181 Ga0495616_0005339 3300046513 Bacteria 7926
182 Ga0495618_0018398 3300046514 Bacteria 4289
183 Ga0495620_0011916 3300046515 Bacteria 4517
184 Ga0495620_0020477 3300046515 Bacteria 3229
185 Ga0495620_0060741 3300046515 Bacteria 1575
186 Ga0495628_0045722 3300046516 Bacteria 3479
187 Ga0495628_0204836 3300046516 Bacteria 1485
188 Ga0495630_0015359 3300046517 Bacteria 5591
189 Ga0495630_0181317 3300046517 Bacteria 1606
190 Ga0495631_0003284 3300046518 Bacteria 8892
191 Ga0495632_0077017 3300046519 Bacteria 1595
192 Ga0495643_0013477 3300046522 Bacteria 4888
193 Ga0495643_0014916 3300046522 Bacteria 4608
194 Ga0495644_0139183 3300046523 Bacteria 927
195 Ga0495648_0039468 3300046524 Bacteria 3004
196 Ga0495642_0318820 3300046528 Bacteria 682
197 Ga0495652_0031709 3300046529 Bacteria 4626
198 Ga0495652_0069324 3300046529 Bacteria 2952
199 Ga0495640_0008525 3300046533 Bacteria 8035
200 Ga0495640_0181580 3300046533 Bacteria 1340
201 Ga0495640_0209866 3300046533 Bacteria 1231
202 Ga0495586_0021119 3300046535 Bacteria 3469
203 Ga0495586_0522944 3300046535 Bacteria 685
204 Ga0495587_0012263 3300046536 Bacteria 5406
205 Ga0495587_0056194 3300046536 Bacteria 2316
206 Ga0495587_0189428 3300046536 Bacteria 1165
207 Ga0495597_0090513 3300046542 Bacteria 1299
208 Ga0495597_0257772 3300046542 Bacteria 684
209 Ga0495645_0438852 3300046543 Bacteria 825
210 Ga0495622_0027389 3300046557 Bacteria 2660
211 Ga0495622_0045337 3300046557 Bacteria 2043
212 Ga0495622_0126779 3300046557 Bacteria 1164
213 Ga0495622_0422856 3300046557 Bacteria 572
214 Ga0495633_0015676 3300046558 Bacteria 3928
215 Ga0495668_0009124 3300046616 Bacteria 6115
216 Ga0495668_0035308 3300046616 Bacteria 2803
217 Ga0495634_0007416 3300046642 Bacteria 8244
218 Ga0495634_0018483 3300046642 Bacteria 4963
219 Ga0495634_0079233 3300046642 Bacteria 2151
220 Ga0495611_0034088 3300046648 Bacteria 2249
221 Ga0495611_0071412 3300046648 Bacteria 1587
222 Ga0495611_0099461 3300046648 Bacteria 1350
223 Ga0495611_0187571 3300046648 Bacteria 965
224 Ga0495625_0010090 3300046660 Bacteria 7848
225 Ga0495625_0200769 3300046660 Bacteria 1316
226 Ga0495635_0004385 3300046663 Bacteria 9772
227 Ga0495635_0027716 3300046663 Bacteria 3940
228 Ga0495635_0142567 3300046663 Bacteria 1631
229 Ga0495588_0006961 3300046674 Bacteria 5127
230 Ga0495588_0013510 3300046674 Bacteria 3893
231 Ga0495588_0013597 3300046674 Bacteria 3881
232 Ga0495588_0096633 3300046674 Bacteria 1549
233 Ga0495657_0034031 3300046675 Bacteria 3542
234 Ga0495657_0054196 3300046675 Bacteria 2680
235 Ga0495657_0067034 3300046675 Bacteria 2357
236 Ga0495657_0567217 3300046675 Bacteria 658
237 Ga0495599_0067333 3300046678 Bacteria 2237
238 Ga0495599_0311038 3300046678 Bacteria 950
239 Ga0495646_0000319 3300046680 Bacteria 24783
240 Ga0495646_0041692 3300046680 Bacteria 2819
241 Ga0495658_0055419 3300046683 Bacteria 2258
242 Ga0495613_0001029 3300046689 Bacteria 21264
243 Ga0495613_0009827 3300046689 Bacteria 7116
244 Ga0495613_0018520 3300046689 Bacteria 5191
245 Ga0495613_0060169 3300046689 Bacteria 2783
246 Ga0495613_0069075 3300046689 Bacteria 2576
247 Ga0495613_0185449 3300046689 Bacteria 1472
248 Ga0495613_0233611 3300046689 Bacteria 1287
249 Ga0495613_0253813 3300046689 Bacteria 1227
250 Ga0495624_0067064 3300046690 Bacteria 2239
251 Ga0495624_0186284 3300046690 Bacteria 1263
252 Ga0495670_0008564 3300046691 Bacteria 5036
253 Ga0495670_0060711 3300046691 Bacteria 1900
254 Ga0495670_0174017 3300046691 Bacteria 1134
255 Ga0495671_0008401 3300046692 Bacteria 5813
256 Ga0495671_0234894 3300046692 Bacteria 886
257 Ga0495649_0026827 3300046694 Bacteria 3199
258 Ga0495649_0038587 3300046694 Bacteria 2620
259 Ga0495649_0038663 3300046694 Bacteria 2617
260 Ga0495589_0006425 3300046794 Bacteria 6202
261 Ga0495589_0006476 3300046794 Bacteria 6173
262 Ga0495589_0011815 3300046794 Bacteria 4532
263 Ga0495589_0017859 3300046794 Bacteria 3639
264 Ga0495600_0057006 3300046809 Bacteria 2552
265 Ga0495600_0075473 3300046809 Bacteria 2201
266 Ga0495600_0104068 3300046809 Bacteria 1850
267 Ga0495600_0117454 3300046809 Bacteria 1731
268 Ga0495660_0061830 3300046810 Bacteria 2008
269 Ga0495660_0109980 3300046810 Bacteria 1407
270 Ga0495581_0002352 3300047315 Bacteria 10665
271 Ga0495581_0069903 3300047315 Bacteria 2030
272 Ga0495581_0250090 3300047315 Bacteria 1037
273 Ga0495581_0315293 3300047315 Bacteria 914
274 Ga0495604_0000932 3300047317 Bacteria 24349
275 Ga0495604_0056143 3300047317 Bacteria 3033
276 Ga0495604_0111666 3300047317 Bacteria 1992
277 Ga0495636_0002168 3300047318 Bacteria 7530
278 Ga0495636_0005842 3300047318 Bacteria 4826
279 Ga0495636_0019832 3300047318 Bacteria 2705
280 Ga0495636_0050903 3300047318 Bacteria 1735
281 Ga0495636_0082770 3300047318 Bacteria 1384
282 Ga0495636_0121621 3300047318 Bacteria 1155
283 Ga0495672_0046476 3300047320 Bacteria 2589
284 Ga0495676_0011777 3300047321 Bacteria 7887
285 Ga0495676_0014770 3300047321 Bacteria 6973
286 Ga0495676_0015054 3300047321 Bacteria 6904
287 Ga0495676_0029969 3300047321 Bacteria 4625
288 Ga0495680_0021069 3300047322 Bacteria 5462
289 Ga0495680_0149667 3300047322 Bacteria 1703
290 Ga0495683_0212536 3300047323 Bacteria 866
291 Ga0495687_000423 3300047443 Bacteria 52313
292 Ga0495687_006335 3300047443 Bacteria 7285
293 Ga0495687_020387 3300047443 Bacteria 3230
294 Ga0495687_040146 3300047443 Bacteria 2064
295 Ga0495687_055921 3300047443 Bacteria 1647
296 Ga0495687_069048 3300047443 Bacteria 1424
297 Ga0495675_0062264 3300047444 Bacteria 2362
298 Ga0495675_0118446 3300047444 Bacteria 1650
299 Ga0495675_0371898 3300047444 Bacteria 837
300 Ga0495677_0023827 3300047445 Bacteria 2221
301 Ga0495679_068579 3300047446 Bacteria 1026
302 Ga0495679_150364 3300047446 Bacteria 625
303 Ga0495685_000241 3300047447 Bacteria 18884
304 Ga0495685_005911 3300047447 Bacteria 3996
305 Ga0495685_006475 3300047447 Bacteria 3834
306 Ga0495685_029456 3300047447 Bacteria 1887
307 Ga0495685_053906 3300047447 Bacteria 1361
308 Ga0495681_0005538 3300047470 Bacteria 8439
309 Ga0495681_0007577 3300047470 Bacteria 6905
310 Ga0495684_0180721 3300047471 Bacteria 1563
311 Ga0495686_0014801 3300047472 Bacteria 5359
312 Ga0495686_0056879 3300047472 Bacteria 2442
313 Ga0495686_0465252 3300047472 Bacteria 670
314 Ga0495593_0000694 3300047673 Bacteria 19439
315 Ga0495593_0007482 3300047673 Bacteria 6386
316 Ga0495593_0098555 3300047673 Bacteria 1501
317 Ga0495602_0114218 3300048088 Bacteria 2187
318 Ga0495614_0003180 3300048089 Bacteria 7336
319 Ga0495614_0006378 3300048089 Bacteria 5295
320 Ga0495614_0011112 3300048089 Bacteria 3961
321 Ga0495614_0020022 3300048089 Bacteria 2894
322 Ga0495626_0012263 3300048091 Bacteria 4500
323 Ga0496104_0311666 3300048907 Bacteria 1487
324 Ga0496105_0758977 3300048908 Bacteria 740
325 Ga0496108_0024620 3300048911 Bacteria 4957
326 Ga0496109_0044065 3300048912 Bacteria 4047
327 Ga0496114_0987606 3300048917 Bacteria 725
328 Ga0495678_023520 3300049459 Bacteria 2676
329 Ga0495682_0097076 3300049460 Bacteria 1058
330 Ga0501031_0003767 3300049568 Bacteria 9753
331 Ga0501031_0012020 3300049568 Bacteria 5646
332 Ga0501032_0020352 3300049569 Bacteria 4622
333 Ga0501032_0686522 3300049569 Bacteria 649
334 Ga0501032_0708408 3300049569 Bacteria 638
335 Ga0501033_0000179 3300049570 Bacteria 60544
336 Ga0501033_0006488 3300049570 Bacteria 9153
337 Ga0501033_0094373 3300049570 Bacteria 2188
338 Ga0501033_0197832 3300049570 Bacteria 1436
339 Ga0501034_0003135 3300049571 Bacteria 19033
340 Ga0501034_0061838 3300049571 Bacteria 3760
341 Ga0501034_0500115 3300049571 Bacteria 1129
342 Ga0501036_0000451 3300049572 Bacteria 29280
343 Ga0501036_0007290 3300049572 Bacteria 9007
344 Ga0501036_0267262 3300049572 Bacteria 1432
345 Ga0501037_0030963 3300049573 Bacteria 3952
346 Ga0501038_0037478 3300049574 Bacteria 4251
347 Ga0501039_0000844 3300049575 Bacteria 22131
348 Ga0501039_0248983 3300049575 Bacteria 1397
349 Ga0501039_0360459 3300049575 Bacteria 1142
350 Ga0501042_0132612 3300049578 Bacteria 1796
351 Ga0501043_0003866 3300049579 Bacteria 12304
352 Ga0501043_0024261 3300049579 Bacteria 4759
353 Ga0501043_0179772 3300049579 Bacteria 1648
354 Ga0501046_0092536 3300049580 Bacteria 2324
355 Ga0501046_0602903 3300049580 Bacteria 779
356 Ga0501047_0004163 3300049581 Bacteria 13614
357 Ga0501047_0023053 3300049581 Bacteria 5976
358 Ga0501047_0137947 3300049581 Bacteria 2318
359 Ga0501047_0147504 3300049581 Bacteria 2229
360 Ga0501047_0158942 3300049581 Bacteria 2132
361 Ga0501048_0021284 3300049582 Bacteria 4748
362 Ga0501068_0104323 3300049584 Bacteria 1759
363 Ga0501070_0001476 3300049586 Bacteria 21038
364 Ga0501070_0233817 3300049586 Bacteria 1506
365 Ga0501070_0248053 3300049586 Bacteria 1457
366 Ga0501073_0112561 3300049589 Bacteria 1888
367 Ga0501074_0017110 3300049590 Bacteria 5259
368 Ga0501035_0001045 3300049822 Bacteria 28960
369 Ga0501035_0040559 3300049822 Bacteria 4205
370 Ga0501035_0077571 3300049822 Bacteria 2936
371 Ga0501035_0231733 3300049822 Bacteria 1573
372 Ga0501044_0001242 3300049823 Bacteria 30258
373 Ga0501044_0019104 3300049823 Bacteria 7337
374 Ga0501044_0085052 3300049823 Bacteria 3196
375 Ga0501044_0170514 3300049823 Bacteria 2148
376 Ga0501044_0361941 3300049823 Bacteria 1368
377 Ga0501044_0517977 3300049823 Bacteria 1092
378 nmdc:mga03n38_219179_c1 3300050490 Bacteria 992
379 nmdc:mga06z11_138118_c1 3300050494 Bacteria 1375
380 nmdc:mga04h51_103030_c1 3300050495 Bacteria 1042
381 Ga0495655_0043168 3300053083 Bacteria 1161
382 Ga0495619_0068364 3300053085 Bacteria 2373
383 Ga0500578_0231064 3300053086 Bacteria 1121
384 Ga0500583_0073034 3300053092 Bacteria 1644
385 Ga0500566_0251170 3300053094 Bacteria 860
386 Ga0500640_055085 3300053095 Bacteria 1733
387 Ga0500654_092872 3300053099 Bacteria 1333
388 Ga0500660_010773 3300053100 Bacteria 4929
389 Ga0500553_058269 3300053101 Bacteria 1823
390 Ga0500558_111403 3300053106 Bacteria 1073
391 Ga0500560_001537 3300053107 Bacteria 4057
392 Ga0500569_003405 3300053109 Bacteria 3250
393 Ga0500614_006646 3300053123 Bacteria 2431
394 Ga0500628_002566 3300053129 Bacteria 2995
395 Ga0500561_0004385 3300053137 Bacteria 2540
396 Ga0500573_0068282 3300053140 Bacteria 2030
397 Ga0500573_0179819 3300053140 Bacteria 1138
398 Ga0500579_115057 3300053143 Bacteria 1333
399 Ga0500600_0328844 3300053149 Bacteria 640
400 Ga0500616_0026320 3300053153 Bacteria 3220
401 Ga0500633_0020273 3300053160 Bacteria 2003
402 Ga0500634_0070401 3300053161 Bacteria 1831
403 Ga0500634_0165106 3300053161 Bacteria 1016
404 Ga0500587_005241 3300053739 Bacteria 1755
405 Ga0466962_0000329 3300061719 Bacteria 20345
406 Ga0466962_0013507 3300061719 Bacteria 3931
407 2585296808 2582581312 Bacteria 7308206
408 2585303797 2582581313 Bacteria 10042643
409 2616695866 2616644814 Bacteria 11555299
410 2643759982 2643221548 Bacteria 8053412
411 2644268265 2643221647 Bacteria 10741251
412 2644406053 2643221673 Bacteria 9196637
413 2644460322 2643221682 Bacteria 6743283
414 2784586932 2784132148 Bacteria 8627943
415 2785345511 2784746763 Bacteria 9783172
416 2785367373 2784746768 Bacteria 10036182
417 2786668423 2786546132 Bacteria 10419719
418 2808847882 2808606359 Bacteria 9866990
419 2808918630 2808606375 Bacteria 9466072
420 2812360107 2811994879 Bacteria 9313447
421 2812482166 2811994917 Bacteria 7761064
422 2819696605 2818991463 Bacteria 7948711
423 2852637917 2852635781 Bacteria 8251373
424 2862180479 2862178590 Bacteria 8583590
425 2862289413 2862281513 Bacteria 9621493
426 2862392260 2862382967 Bacteria 10317375
427 2862514167 2862507626 Bacteria 9425308
428 2862583477 2862574272 Bacteria 10567477
429 2863406768 2863404153 Bacteria 9672205
430 2867432088 2867428634 Bacteria 9590268
431 2873157484 2873151551 Bacteria 8625867
432 2877683175 2877676314 Bacteria 9512378
433 2912722183 2912715099 Bacteria 9460473
434 2912725904 2912723979 Bacteria 8557534
435 2918502714 2918501144 Bacteria 8668083
436 2919473685 2919468124 Bacteria 9133025
437 2935395849 2935390628 Bacteria 7043367
438 2946065779 2946064051 Bacteria 8957905
439 2946074127 2946072368 Bacteria 8999607
440 2947231615 2947224130 Bacteria 9938529
441 2954388390 2954380949 Bacteria 10050426
442 2954674699 2954673503 Bacteria 9685905
443 2954689434 2954682443 Bacteria 9862841
444 2954699205 2954691527 Bacteria 10720516
445 2954703013 2954701450 Bacteria 10834262
446 2954718160 2954711539 Bacteria 10867210
447 2954728129 2954721474 Bacteria 10456478
448 2954733678 2954731030 Bacteria 10243860
449 2954747025 2954740390 Bacteria 10229294
450 2954752562 2954749733 Bacteria 10366972
451 2954766139 2954759201 Bacteria 9358192
452 2990062706 2990059506 Bacteria 9321252
453 3006394948 3006393351 Bacteria 6615579
454 3006495240 3006493962 Bacteria 8825450
455 8008561541 8008558824 Bacteria 10610750
456 8008580550 8008574985 Bacteria 7815457
457 8047900079 8047893842 Bacteria 11723082
458 8048131136 8048127548 Bacteria 11053136
459 8048358849 8048356638 Bacteria 11044339
460 8048377026 8048369669 Bacteria 11666822
461 8048386081 8048379754 Bacteria 11877923
462 8048412111 8048406513 Bacteria 8936924
463 8056835494 8056829672 Bacteria 9045328
464 Ga0495675_0175178
465 JGI24739J22299_10039086
466 JGI24737J22298_10154727
467 JGI25153J46596_10046077
468 rootH1_10027633
469 rootH1_10051549
470 rootH2_10020050
471 rootH2_10024457
472 rootH2_10065661
473 rootL2_10137364
474 rootL2_10261584
475 rootH1_10034134
476 rootH1_10051651
477 rootH1_10127743
478 Ga0006562J51391_1070418
479 Ga0006562J51391_1089879
480 Ga0075368_10034842
481 Ga0105251_10034857
482 Ga0105244_10382402
483 Ga0105243_10153206
484 Ga0105248_11167549
485 Ga0105239_10522106
486 Ga0105239_12158134
487 Ga0105246_10018855
488 Ga0182006_1127816
489 Ga0182007_10000452
490 Ga0209758_1008332
491 Ga0207713_1029181
492 Ga0207647_10010840
493 Ga0207667_10931249
494 Ga0207702_10060728
495 Ga0209282_1219011
496 Ga0307517_10012816
497 Ga0307515_10035257
498 Ga0307515_10049629
499 Ga0307511_10000282
500 Ga0307511_10181102
501 Ga0307512_10002276
502 Ga0307512_10134126
503 Ga0307513_10019439
504 Ga0307513_10023734
505 Ga0307513_10183316
506 Ga0307513_10290905
507 Ga0307509_10017499
508 Ga0307509_10045221
509 Ga0307509_10058801
510 Ga0307509_10255990
511 Ga0307509_10424553
512 Ga0307508_10001243
513 Ga0307508_10014612
514 Ga0307508_10027257
515 Ga0307508_10237352
516 Ga0307514_10093615
517 Ga0307514_10203354
518 Ga0307514_10232789
519 Ga0307516_10003084
520 Ga0307516_10111593
521 Ga0307413_10136261
522 Ga0307518_10006487
523 Ga0307518_10048201
524 Ga0307518_10152783
525 Ga0307518_10179506
526 Ga0307518_10259519
527 Ga0307410_10150407
528 Ga0307410_10936817
529 Ga0307406_10125792
530 Ga0307407_10355327
531 Ga0307409_100084722
532 Ga0307409_100306526
533 Ga0307507_10010824
534 Ga0307507_10052470
535 Ga0307510_10147403
536 Ga0395900_0101307
537 Ga0395900_0779404
538 Ga0395898_0110034
539 Ga0395905_0214474
540 Ga0395901_1510627
541 Ga0439436_0002008
542 Ga0439436_0057494
543 Ga0439439_0000550
544 Ga0439439_0019423
545 Ga0451800_0611566
546 Ga0451833_1447417
547 Ga0451845_0026182
548 Ga0451853_0181483
549 Ga0439433_0006964
550 Ga0439449_0064894
551 Ga0439449_0089179
552 Ga0439449_0193091
553 Ga0439450_013428
554 Ga0439457_004759
555 Ga0439457_116526
556 Ga0439462_0038343
557 Ga0450920_040153
558 Ga0450894_000348
559 Ga0450896_005531
560 Ga0450898_006046
561 Ga0450899_000244
562 Ga0450903_000019
563 Ga0450906_003297
564 Ga0439458_0001449
565 Ga0450908_002611
566 Ga0466969_0008336
567 Ga0466972_0019677
568 Ga0466965_0002191
569 Ga0466965_0276838
570 Ga0466966_0019977
571 Ga0466966_0041293
572 Ga0466961_0002492
573 Ga0466961_0009047
574 Ga0466963_0002580
575 Ga0466963_0135961
576 Ga0466964_0039662
577 Ga0466964_0063631
578 Ga0466971_0001320
579 Ga0466971_0138824
580 Ga0466971_0203870
581 Ga0466968_0004907
582 Ga0466968_0091407
583 Ga0466968_0222200
584 Ga0466970_0000814
585 Ga0466970_0004388
586 Ga0466970_0586756
587 Ga0466957_0005315
588 Ga0466960_0016718
589 Ga0466960_0239581
590 Ga0466960_0714743
591 Ga0466959_0005165
592 Ga0466958_0002687
593 Ga0466967_0014621
594 Ga0466967_0031983
595 Ga0466967_0229069
596 Ga0495617_028503
597 Ga0495627_026621
598 Ga0495592_0005819
599 Ga0495592_0163518
600 Ga0495603_0000404
601 Ga0495603_0024714
602 Ga0495603_0031477
603 Ga0495603_0140266
604 Ga0495590_0073833
605 Ga0495629_0001920
606 Ga0495629_0015866
607 Ga0495629_0036741
608 Ga0495629_0037270
609 Ga0495629_0040688
610 Ga0495629_0076711
611 Ga0495629_0219009
612 Ga0495629_0240912
613 Ga0495629_0296565
614 Ga0495629_0761245
615 Ga0495638_0289735
616 Ga0495651_0022796
617 Ga0495651_0047005
618 Ga0495651_0209809
619 Ga0495653_0292083
620 Ga0495582_0257479
621 Ga0495605_0036561
622 Ga0495605_0104334
623 Ga0495639_0069140
624 Ga0495639_0081384
625 Ga0495662_0000555
626 Ga0495662_0017267
627 Ga0495662_0026693
628 Ga0495662_0047015
629 Ga0495662_0155560
630 Ga0495664_0006957
631 Ga0495584_0083543
632 Ga0495585_0005238
633 Ga0495585_0258304
634 Ga0495594_0001105
635 Ga0495594_0033656
636 Ga0495594_0079709
637 Ga0495594_0145319
638 Ga0495594_0157826
639 Ga0495594_0635592
640 Ga0495607_0096420
641 Ga0495583_0032874
642 Ga0495610_0047399
643 Ga0495610_0120298
644 Ga0495616_0005339
645 Ga0495618_0018398
646 Ga0495620_0011916
647 Ga0495620_0020477
648 Ga0495620_0060741
649 Ga0495628_0045722
650 Ga0495628_0204836
651 Ga0495630_0015359
652 Ga0495630_0181317
653 Ga0495631_0003284
654 Ga0495632_0077017
655 Ga0495643_0013477
656 Ga0495643_0014916
657 Ga0495644_0139183
658 Ga0495648_0039468
659 Ga0495642_0318820
660 Ga0495652_0031709
661 Ga0495652_0069324
662 Ga0495640_0008525
663 Ga0495640_0181580
664 Ga0495640_0209866
665 Ga0495586_0021119
666 Ga0495586_0522944
667 Ga0495587_0012263
668 Ga0495587_0056194
669 Ga0495587_0189428
670 Ga0495597_0090513
671 Ga0495597_0257772
672 Ga0495645_0438852
673 Ga0495622_0027389
674 Ga0495622_0045337
675 Ga0495622_0126779
676 Ga0495622_0422856
677 Ga0495633_0015676
678 Ga0495668_0009124
679 Ga0495668_0035308
680 Ga0495634_0007416
681 Ga0495634_0018483
682 Ga0495634_0079233
683 Ga0495611_0034088
684 Ga0495611_0071412
685 Ga0495611_0099461
686 Ga0495611_0187571
687 Ga0495625_0010090
688 Ga0495625_0200769
689 Ga0495635_0004385
690 Ga0495635_0027716
691 Ga0495635_0142567
692 Ga0495588_0006961
693 Ga0495588_0013510
694 Ga0495588_0013597
695 Ga0495588_0096633
696 Ga0495657_0034031
697 Ga0495657_0054196
698 Ga0495657_0067034
699 Ga0495657_0567217
700 Ga0495599_0067333
701 Ga0495599_0311038
702 Ga0495646_0000319
703 Ga0495646_0041692
704 Ga0495658_0055419
705 Ga0495613_0001029
706 Ga0495613_0009827
707 Ga0495613_0018520
708 Ga0495613_0060169
709 Ga0495613_0069075
710 Ga0495613_0185449
711 Ga0495613_0233611
712 Ga0495613_0253813
713 Ga0495624_0067064
714 Ga0495624_0186284
715 Ga0495670_0008564
716 Ga0495670_0060711
717 Ga0495670_0174017
718 Ga0495671_0008401
719 Ga0495671_0234894
720 Ga0495649_0026827
721 Ga0495649_0038587
722 Ga0495649_0038663
723 Ga0495589_0006425
724 Ga0495589_0006476
725 Ga0495589_0011815
726 Ga0495589_0017859
727 Ga0495600_0057006
728 Ga0495600_0075473
729 Ga0495600_0104068
730 Ga0495600_0117454
731 Ga0495660_0061830
732 Ga0495660_0109980
733 Ga0495581_0002352
734 Ga0495581_0069903
735 Ga0495581_0250090
736 Ga0495581_0315293
737 Ga0495604_0000932
738 Ga0495604_0056143
739 Ga0495604_0111666
740 Ga0495636_0002168
741 Ga0495636_0005842
742 Ga0495636_0019832
743 Ga0495636_0050903
744 Ga0495636_0082770
745 Ga0495636_0121621
746 Ga0495672_0046476
747 Ga0495676_0011777
748 Ga0495676_0014770
749 Ga0495676_0015054
750 Ga0495676_0029969
751 Ga0495680_0021069
752 Ga0495680_0149667
753 Ga0495683_0212536
754 Ga0495687_000423
755 Ga0495687_006335
756 Ga0495687_020387
757 Ga0495687_040146
758 Ga0495687_055921
759 Ga0495687_069048
760 Ga0495675_0062264
761 Ga0495675_0118446
762 Ga0495675_0371898
763 Ga0495677_0023827
764 Ga0495679_068579
765 Ga0495679_150364
766 Ga0495685_000241
767 Ga0495685_005911
768 Ga0495685_006475
769 Ga0495685_029456
770 Ga0495685_053906
771 Ga0495681_0005538
772 Ga0495681_0007577
773 Ga0495684_0180721
774 Ga0495686_0014801
775 Ga0495686_0056879
776 Ga0495686_0465252
777 Ga0495593_0000694
778 Ga0495593_0007482
779 Ga0495593_0098555
780 Ga0495602_0114218
781 Ga0495614_0003180
782 Ga0495614_0006378
783 Ga0495614_0011112
784 Ga0495614_0020022
785 Ga0495626_0012263
786 Ga0496104_0311666
787 Ga0496105_0758977
788 Ga0496108_0024620
789 Ga0496109_0044065
790 Ga0496114_0987606
791 Ga0495678_023520
792 Ga0495682_0097076
793 Ga0501031_0003767
794 Ga0501031_0012020
795 Ga0501032_0020352
796 Ga0501032_0686522
797 Ga0501032_0708408
798 Ga0501033_0000179
799 Ga0501033_0006488
800 Ga0501033_0094373
801 Ga0501033_0197832
802 Ga0501034_0003135
803 Ga0501034_0061838
804 Ga0501034_0500115
805 Ga0501036_0000451
806 Ga0501036_0007290
807 Ga0501036_0267262
808 Ga0501037_0030963
809 Ga0501038_0037478
810 Ga0501039_0000844
811 Ga0501039_0248983
812 Ga0501039_0360459
813 Ga0501042_0132612
814 Ga0501043_0003866
815 Ga0501043_0024261
816 Ga0501043_0179772
817 Ga0501046_0092536
818 Ga0501046_0602903
819 Ga0501047_0004163
820 Ga0501047_0023053
821 Ga0501047_0137947
822 Ga0501047_0147504
823 Ga0501047_0158942
824 Ga0501048_0021284
825 Ga0501068_0104323
826 Ga0501070_0001476
827 Ga0501070_0233817
828 Ga0501070_0248053
829 Ga0501073_0112561
830 Ga0501074_0017110
831 Ga0501035_0001045
832 Ga0501035_0040559
833 Ga0501035_0077571
834 Ga0501035_0231733
835 Ga0501044_0001242
836 Ga0501044_0019104
837 Ga0501044_0085052
838 Ga0501044_0170514
839 Ga0501044_0361941
840 Ga0501044_0517977
841 nmdc:mga03n38_219179_c1
842 nmdc:mga06z11_138118_c1
843 nmdc:mga04h51_103030_c1
844 Ga0495655_0043168
845 Ga0495619_0068364
846 Ga0500578_0231064
847 Ga0500583_0073034
848 Ga0500566_0251170
849 Ga0500640_055085
850 Ga0500654_092872
851 Ga0500660_010773
852 Ga0500553_058269
853 Ga0500558_111403
854 Ga0500560_001537
855 Ga0500569_003405
856 Ga0500614_006646
857 Ga0500628_002566
858 Ga0500561_0004385
859 Ga0500573_0068282
860 Ga0500573_0179819
861 Ga0500579_115057
862 Ga0500600_0328844
863 Ga0500616_0026320
864 Ga0500633_0020273
865 Ga0500634_0070401
866 Ga0500634_0165106
867 Ga0500587_005241
868 Ga0466962_0000329
869 Ga0466962_0013507
870 2585296808
871 2585303797
872 2616695866
873 2643759982
874 2644268265
875 2644406053
876 2644460322
877 2784586932
878 2785345511
879 2785367373
880 2786668423
881 2808847882
882 2808918630
883 2812360107
884 2812482166
885 2819696605
886 2852637917
887 2862180479
888 2862289413
889 2862392260
890 2862514167
891 2862583477
892 2863406768
893 2867432088
894 2873157484
895 2877683175
896 2912722183
897 2912725904
898 2918502714
899 2919473685
900 2935395849
901 2946065779
902 2946074127
903 2947231615
904 2954388390
905 2954674699
906 2954689434
907 2954699205
908 2954703013
909 2954718160
910 2954728129
911 2954733678
912 2954747025
913 2954752562
914 2954766139
915 2990062706
916 3006394948
917 3006495240
918 8008561541
919 8008580550
920 8047900079
921 8048131136
922 8048358849
923 8048377026
924 8048386081
925 8048412111
926 8056835494

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

62

190

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fkb-assembly2.cif.gz_B crystal structure of a putative enzyme (possible nudix hydrolase) from escherichia coli k12 0.911 7 168
2fkb-assembly2.cif.gz_B crystal structure of a putative enzyme (possible nudix hydrolase) from escherichia coli k12 0.8899 7 168
5hzx-assembly2.cif.gz_B crystal structure of zebrafish mth1 in complex with th588 0.8466 36 143
2icj-assembly1.cif.gz_A the crystal structure of human isopentenyl diphophate isomerase 0.8338 5 169
4nfw-assembly14.cif.gz_L structure and atypical hydrolysis mechanism of the nudix hydrolase orf153 (ymfb) from escherichia coli 0.8338 33 145
ID Description Score Start End Superfamily
2fkbC00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8945 5 166 3.90.79.10
af_Q8IDK8_11_194_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8846 3 167 3.90.79.10
af_P9WKK5_11_180_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8757 7 166 3.90.79.10
af_Q55D56_1_193_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8596 7 156 3.90.79.10
af_Q9VDC2_18_256_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8564 4 163 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A6I5EK01-F1-model_v4 NUDIX domain-containing protein 0.9979 1 170 GO:0016817
GO:0046872
AF-A0A2N0IP18-F1-model_v4 deleted 0.9966 3 170
AF-A0A6G3Q4X8-F1-model_v4 NUDIX domain-containing protein 0.9965 3 169 GO:0016817
GO:0046872
AF-Q828P3-F1-model_v4 NTP pyrophosphohydrolase 0.9953 1 170 GO:0016817
GO:0046872
AF-A0A5J6FTH6-F1-model_v4 deleted 0.9949 3 170

Map