F449154

General Info

Members Datasets Scaffolds Average Seq Length
463 173 463 107

Family's Representative Sequence

Representative Sequence 3300042005|Ga0439448_0081646|Ga0439448_0081646_619_966
Length 115
Sequence MRRNGKAAAMLAALSLTSAAMSLCPALAAEPRSHHTYTVVINKMRFGPLPSGLRVGDTIIWENRDLFRHTATARDGSFDIDLMPTKKGKLVLKQAGTFRFSCTYHPGMKGELVVR

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
75 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
171 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.98
Metatranscriptomes 3.02
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 1.3
Rhizosphere 97.84
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000117 3300001904 Bacteria 13577
2 JGI24741J21665_1000086 3300001915 Bacteria 23662
3 JGI24741J21665_1010128 3300001915 Bacteria 1702
4 JGI24740J21852_10001689 3300001979 Bacteria 10132
5 JGI24740J21852_10004032 3300001979 Bacteria 6358
6 JGI24740J21852_10071554 3300001979 Bacteria 928
7 JGI24740J21852_10121152 3300001979 Bacteria 655
8 JGI24737J22298_10045660 3300001990 Bacteria 1338
9 JGI24735J21928_10002477 3300002067 Bacteria 6411
10 JGI24735J21928_10036645 3300002067 Bacteria 1439
11 rootH2_10003120 3300003320 Bacteria 3255
12 Ga0055542_1038168 3300003762 Bacteria 578
13 Ga0058863_11863976 3300004799 Bacteria 999
14 Ga0070658_10000876 3300005327 Bacteria 25753
15 Ga0070658_10002895 3300005327 Bacteria 14246
16 Ga0070658_10004333 3300005327 Bacteria 11591
17 Ga0070658_10009991 3300005327 Bacteria 7623
18 Ga0070658_10045139 3300005327 Bacteria 3562
19 Ga0070658_10066209 3300005327 Bacteria 2951
20 Ga0070658_10125826 3300005327 Bacteria 2133
21 Ga0070658_10174463 3300005327 Bacteria 1807
22 Ga0070658_10210349 3300005327 Unclassified 1643
23 Ga0070658_10220889 3300005327 Bacteria 1602
24 Ga0070658_10418032 3300005327 Unclassified 1153
25 Ga0070658_10536811 3300005327 Unclassified 1012
26 Ga0070658_10688134 3300005327 Unclassified 887
27 Ga0070658_11133503 3300005327 Bacteria 680
28 Ga0070676_10104970 3300005328 Bacteria 1751
29 Ga0070683_100010109 3300005329 Bacteria 8096
30 Ga0070683_100029813 3300005329 Bacteria 4944
31 Ga0070683_100259377 3300005329 Bacteria 1653
32 Ga0070683_102087561 3300005329 Unclassified 544
33 Ga0070690_100396724 3300005330 Bacteria 1012
34 Ga0070690_100803362 3300005330 Bacteria 730
35 Ga0070670_100000350 3300005331 Bacteria 38698
36 Ga0070670_100087725 3300005331 Bacteria 2674
37 Ga0070670_101904824 3300005331 Unclassified 548
38 Ga0070677_10014798 3300005333 Bacteria 2753
39 Ga0070677_10024197 3300005333 Bacteria 2256
40 Ga0068869_100289087 3300005334 Bacteria 1320
41 Ga0070666_10048528 3300005335 Bacteria 2853
42 Ga0070666_10109560 3300005335 Bacteria 1909
43 Ga0070680_100081304 3300005336 Bacteria 2673
44 Ga0070680_100098394 3300005336 Bacteria 2426
45 Ga0070680_100509030 3300005336 Unclassified 1030
46 Ga0070682_101724676 3300005337 Bacteria 545
47 Ga0070660_100000487 3300005339 Bacteria 26540
48 Ga0070660_100001158 3300005339 Bacteria 17811
49 Ga0070660_100001347 3300005339 Bacteria 16688
50 Ga0070660_100002825 3300005339 Bacteria 11947
51 Ga0070660_100003460 3300005339 Bacteria 10868
52 Ga0070660_100020422 3300005339 Bacteria 4866
53 Ga0070660_100048825 3300005339 Unclassified 3251
54 Ga0070660_100086963 3300005339 Bacteria 2460
55 Ga0070660_100100856 3300005339 Bacteria 2287
56 Ga0070660_100124398 3300005339 Bacteria 2060
57 Ga0070660_100124609 3300005339 Bacteria 2058
58 Ga0070660_100837421 3300005339 Unclassified 774
59 Ga0070691_10003062 3300005341 Bacteria 7487
60 Ga0070661_100023216 3300005344 Bacteria 4445
61 Ga0070661_100034152 3300005344 Bacteria 3688
62 Ga0070661_100056574 3300005344 Bacteria 2874
63 Ga0070661_100102420 3300005344 Unclassified 2131
64 Ga0070661_100119074 3300005344 Bacteria 1976
65 Ga0070661_100221933 3300005344 Bacteria 1450
66 Ga0070661_100669722 3300005344 Bacteria 843
67 Ga0070661_101329724 3300005344 Bacteria 603
68 Ga0070692_10015183 3300005345 Bacteria 3637
69 Ga0070692_10020675 3300005345 Bacteria 3193
70 Ga0070692_10035727 3300005345 Bacteria 2517
71 Ga0070692_10125395 3300005345 Bacteria 1437
72 Ga0070669_100026397 3300005353 Bacteria 4179
73 Ga0070675_100001857 3300005354 Bacteria 15581
74 Ga0070671_100001032 3300005355 Bacteria 20490
75 Ga0070671_100024364 3300005355 Bacteria 4953
76 Ga0070671_100190451 3300005355 Bacteria 1738
77 Ga0070671_101721547 3300005355 Unclassified 556
78 Ga0070673_100003253 3300005364 Bacteria 10079
79 Ga0070673_100079938 3300005364 Bacteria 2648
80 Ga0070659_100001753 3300005366 Bacteria 15585
81 Ga0070659_100005514 3300005366 Bacteria 9088
82 Ga0070659_100016535 3300005366 Bacteria 5539
83 Ga0070659_100031769 3300005366 Bacteria 4091
84 Ga0070659_100066291 3300005366 Bacteria 2861
85 Ga0070659_100290272 3300005366 Bacteria 1362
86 Ga0070659_100786129 3300005366 Bacteria 827
87 Ga0070659_101109473 3300005366 Unclassified 697
88 Ga0070667_100098706 3300005367 Bacteria 2520
89 Ga0070667_100140880 3300005367 Bacteria 2112
90 Ga0070703_10304587 3300005406 Unclassified 665
91 Ga0070663_100007970 3300005455 Bacteria 6491
92 Ga0070663_100018655 3300005455 Bacteria 4553
93 Ga0070663_100073794 3300005455 Bacteria 2489
94 Ga0070663_100182382 3300005455 Bacteria 1629
95 Ga0070663_100227285 3300005455 Bacteria 1468
96 Ga0070663_101068355 3300005455 Unclassified 704
97 Ga0070678_100237869 3300005456 Bacteria 1521
98 Ga0070662_100008923 3300005457 Bacteria 6536
99 Ga0070662_100063945 3300005457 Bacteria 2693
100 Ga0070662_100159328 3300005457 Bacteria 1764
101 Ga0070662_101427450 3300005457 Unclassified 596
102 Ga0070681_10118510 3300005458 Bacteria 2584
103 Ga0070681_10171116 3300005458 Bacteria 2094
104 Ga0070681_10283650 3300005458 Bacteria 1567
105 Ga0068867_100650633 3300005459 Unclassified 925
106 Ga0070699_100768640 3300005518 Bacteria 881
107 Ga0070679_100134002 3300005530 Bacteria 2458
108 Ga0070679_100183733 3300005530 Bacteria 2062
109 Ga0070679_100243853 3300005530 Bacteria 1754
110 Ga0070679_100351869 3300005530 Unclassified 1421
111 Ga0070679_100377724 3300005530 Bacteria 1364
112 Ga0070684_100001830 3300005535 Bacteria 15561
113 Ga0070684_100068323 3300005535 Bacteria 3123
114 Ga0070684_100132628 3300005535 Bacteria 2248
115 Ga0068853_100004017 3300005539 Bacteria 11320
116 Ga0068853_100056982 3300005539 Bacteria 3371
117 Ga0068853_100407462 3300005539 Bacteria 1273
118 Ga0068853_101815079 3300005539 Unclassified 591
119 Ga0070672_100005889 3300005543 Bacteria 8177
120 Ga0070696_100141995 3300005546 Bacteria 1756
121 Ga0070696_100246173 3300005546 Bacteria 1350
122 Ga0070696_101244168 3300005546 Unclassified 630
123 Ga0070693_100834999 3300005547 Bacteria 686
124 Ga0070665_100412069 3300005548 Bacteria 1360
125 Ga0068855_100000079 3300005563 Bacteria 117264
126 Ga0068855_100015129 3300005563 Bacteria 9291
127 Ga0068855_100180150 3300005563 Bacteria 2389
128 Ga0068855_100182939 3300005563 Bacteria 2368
129 Ga0068855_100700158 3300005563 Bacteria 1084
130 Ga0068855_101903014 3300005563 Bacteria 602
131 Ga0070664_100003170 3300005564 Bacteria 13292
132 Ga0070664_100004435 3300005564 Bacteria 11273
133 Ga0070664_100038561 3300005564 Bacteria 4023
134 Ga0070664_100769631 3300005564 Bacteria 899
135 Ga0070664_101872809 3300005564 Bacteria 569
136 Ga0068857_100020042 3300005577 Bacteria 5879
137 Ga0068857_100022379 3300005577 Bacteria 5561
138 Ga0068857_100042493 3300005577 Bacteria 4033
139 Ga0068857_100089401 3300005577 Unclassified 2756
140 Ga0068857_100255816 3300005577 Bacteria 1606
141 Ga0068854_100001146 3300005578 Bacteria 15933
142 Ga0068854_100119141 3300005578 Bacteria 2001
143 Ga0068854_100120496 3300005578 Bacteria 1991
144 Ga0068854_100150411 3300005578 Unclassified 1794
145 Ga0068854_100299260 3300005578 Bacteria 1301
146 Ga0068854_100493444 3300005578 Bacteria 1030
147 Ga0068854_100860685 3300005578 Bacteria 794
148 Ga0068854_101054242 3300005578 Bacteria 722
149 Ga0068854_101311342 3300005578 Bacteria 652
150 Ga0068856_100022339 3300005614 Bacteria 6149
151 Ga0068856_100062965 3300005614 Bacteria 3664
152 Ga0068856_100185796 3300005614 Bacteria 2092
153 Ga0068856_100624681 3300005614 Bacteria 1098
154 Ga0068856_101070213 3300005614 Bacteria 824
155 Ga0068856_101494215 3300005614 Bacteria 689
156 Ga0070702_100844090 3300005615 Bacteria 712
157 Ga0068852_100019828 3300005616 Bacteria 5333
158 Ga0068852_100025625 3300005616 Bacteria 4781
159 Ga0068852_100036896 3300005616 Bacteria 4095
160 Ga0068852_101949679 3300005616 Bacteria 609
161 Ga0068852_102372585 3300005616 Unclassified 551
162 Ga0068852_102454332 3300005616 Unclassified 542
163 Ga0068864_100192337 3300005618 Bacteria 1871
164 Ga0068851_10066505 3300005834 Bacteria 1857
165 Ga0068851_10133379 3300005834 Bacteria 1345
166 Ga0068863_102240324 3300005841 Unclassified 556
167 Ga0068858_100489698 3300005842 Unclassified 1187
168 Ga0068860_102217685 3300005843 Archaea 570
169 Ga0068871_100621133 3300006358 Bacteria 984
170 Ga0105240_10006152 3300009093 Bacteria 17700
171 Ga0105240_10007155 3300009093 Bacteria 16257
172 Ga0105243_10157261 3300009148 Bacteria 1956
173 Ga0105241_10159554 3300009174 Bacteria 1852
174 Ga0105248_10008720 3300009177 Bacteria 11138
175 Ga0105248_10753662 3300009177 Bacteria 1099
176 Ga0105237_10022017 3300009545 Bacteria 6541
177 Ga0105237_10130338 3300009545 Bacteria 2509
178 Ga0105237_10385939 3300009545 Bacteria 1405
179 Ga0105237_10826026 3300009545 Bacteria 933
180 Ga0105238_10004239 3300009551 Bacteria 14247
181 Ga0105238_10026814 3300009551 Bacteria 5874
182 Ga0105239_10436892 3300010375 Bacteria 1484
183 Ga0157373_10003029 3300013100 Bacteria 12666
184 Ga0157373_10003770 3300013100 Bacteria 11467
185 Ga0157373_10010908 3300013100 Bacteria 6690
186 Ga0157373_10021117 3300013100 Bacteria 4726
187 Ga0157373_10048905 3300013100 Bacteria 3015
188 Ga0157373_10104794 3300013100 Bacteria 1989
189 Ga0157373_10247265 3300013100 Bacteria 1261
190 Ga0157371_10000261 3300013102 Bacteria 72525
191 Ga0157371_10010561 3300013102 Bacteria 7177
192 Ga0157371_10027348 3300013102 Bacteria 4138
193 Ga0157371_10031157 3300013102 Bacteria 3842
194 Ga0157371_10097465 3300013102 Bacteria 2084
195 Ga0157371_10132181 3300013102 Bacteria 1776
196 Ga0157371_10490143 3300013102 Bacteria 907
197 Ga0157371_10740748 3300013102 Bacteria 737
198 Ga0157370_10009252 3300013104 Bacteria 10558
199 Ga0157370_10015810 3300013104 Bacteria 7658
200 Ga0157370_10021618 3300013104 Bacteria 6410
201 Ga0157370_10434083 3300013104 Bacteria 1208
202 Ga0157370_10472216 3300013104 Bacteria 1153
203 Ga0157370_10607283 3300013104 Bacteria 1001
204 Ga0157370_11863806 3300013104 Unclassified 539
205 Ga0157369_10015792 3300013105 Bacteria 8506
206 Ga0157369_10066536 3300013105 Bacteria 3876
207 Ga0157369_10114879 3300013105 Bacteria 2859
208 Ga0157369_10217104 3300013105 Bacteria 2003
209 Ga0157369_10246392 3300013105 Unclassified 1866
210 Ga0157369_11944525 3300013105 Bacteria 597
211 Ga0157374_10047489 3300013296 Bacteria 3981
212 Ga0157374_11261620 3300013296 Unclassified 761
213 Ga0157378_10431625 3300013297 Bacteria 1304
214 Ga0157372_10026860 3300013307 Bacteria 6267
215 Ga0157372_10076275 3300013307 Bacteria 3785
216 Ga0157372_10113929 3300013307 Bacteria 3099
217 Ga0157372_10442948 3300013307 Bacteria 1514
218 Ga0157372_10768126 3300013307 Unclassified 1120
219 Ga0157372_11852901 3300013307 Bacteria 694
220 Ga0157375_10055112 3300013308 Bacteria 3919
221 Ga0163163_10273323 3300014325 Bacteria 1741
222 Ga0163163_12457713 3300014325 Bacteria 579
223 Ga0163161_10020224 3300017792 Bacteria 4669
224 Ga0206356_10267260 3300020070 Bacteria 1599
225 Ga0206356_10583009 3300020070 Bacteria 1425
226 Ga0206355_1185753 3300020076 Bacteria 1255
227 Ga0206355_1378246 3300020076 Bacteria 679
228 Ga0206351_10505324 3300020077 Bacteria 979
229 Ga0206351_10608247 3300020077 Bacteria 1200
230 Ga0206351_10797287 3300020077 Bacteria 1297
231 Ga0206352_10130232 3300020078 Bacteria 1000
232 Ga0206353_10241471 3300020082 Bacteria 1287
233 Ga0154015_1120478 3300020610 Bacteria 1789
234 Ga0154015_1206154 3300020610 Bacteria 1635
235 Ga0224712_10013540 3300022467 Bacteria 2600
236 Ga0224712_10119128 3300022467 Bacteria 1141
237 Ga0209148_1000146 3300025254 Bacteria 160734
238 Ga0209455_1018488 3300025272 Bacteria 1430
239 Ga0207656_10007269 3300025321 Bacteria 4024
240 Ga0207682_10017878 3300025893 Bacteria 2768
241 Ga0207688_10673827 3300025901 Bacteria 653
242 Ga0207680_10177765 3300025903 Bacteria 1437
243 Ga0207647_10002290 3300025904 Bacteria 14586
244 Ga0207647_10002620 3300025904 Bacteria 13601
245 Ga0207647_10020613 3300025904 Bacteria 4417
246 Ga0207647_10026471 3300025904 Bacteria 3794
247 Ga0207647_10083526 3300025904 Bacteria 1912
248 Ga0207647_10098768 3300025904 Bacteria 1734
249 Ga0207647_10200830 3300025904 Bacteria 1153
250 Ga0207647_10517903 3300025904 Bacteria 664
251 Ga0207645_10014332 3300025907 Bacteria 5308
252 Ga0207705_10000003 3300025909 Bacteria 709270
253 Ga0207705_10000125 3300025909 Bacteria 84812
254 Ga0207705_10000749 3300025909 Bacteria 26722
255 Ga0207705_10002384 3300025909 Bacteria 14522
256 Ga0207705_10003398 3300025909 Bacteria 12103
257 Ga0207705_10004946 3300025909 Bacteria 10005
258 Ga0207705_10017120 3300025909 Bacteria 5192
259 Ga0207705_10052745 3300025909 Bacteria 2929
260 Ga0207705_10084534 3300025909 Bacteria 2317
261 Ga0207705_10179707 3300025909 Bacteria 1596
262 Ga0207705_10538292 3300025909 Unclassified 908
263 Ga0207705_10700402 3300025909 Bacteria 787
264 Ga0207654_10110228 3300025911 Bacteria 1711
265 Ga0207707_10124693 3300025912 Bacteria 2253
266 Ga0207707_10253949 3300025912 Bacteria 1527
267 Ga0207707_11016904 3300025912 Unclassified 679
268 Ga0207707_11658229 3300025912 Unclassified 502
269 Ga0207695_10004896 3300025913 Bacteria 18049
270 Ga0207695_10009694 3300025913 Bacteria 11858
271 Ga0207695_10014439 3300025913 Bacteria 9356
272 Ga0207671_10605160 3300025914 Bacteria 873
273 Ga0207660_10031084 3300025917 Bacteria 3674
274 Ga0207660_10068517 3300025917 Bacteria 2574
275 Ga0207660_10286268 3300025917 Bacteria 1309
276 Ga0207660_10716391 3300025917 Unclassified 816
277 Ga0207657_10000167 3300025919 Bacteria 67075
278 Ga0207657_10000431 3300025919 Bacteria 44557
279 Ga0207657_10002665 3300025919 Bacteria 19265
280 Ga0207657_10002957 3300025919 Bacteria 18228
281 Ga0207657_10003327 3300025919 Bacteria 17194
282 Ga0207657_10007729 3300025919 Bacteria 10978
283 Ga0207657_10017579 3300025919 Bacteria 6850
284 Ga0207657_10023542 3300025919 Bacteria 5732
285 Ga0207657_10027574 3300025919 Bacteria 5201
286 Ga0207657_10137998 3300025919 Bacteria 1994
287 Ga0207657_10191909 3300025919 Bacteria 1647
288 Ga0207649_10003373 3300025920 Bacteria 8740
289 Ga0207649_10007823 3300025920 Bacteria 5815
290 Ga0207649_10007890 3300025920 Bacteria 5792
291 Ga0207649_10169901 3300025920 Bacteria 1518
292 Ga0207652_10245060 3300025921 Unclassified 1616
293 Ga0207652_10352084 3300025921 Bacteria 1329
294 Ga0207652_10806986 3300025921 Bacteria 833
295 Ga0207652_11219849 3300025921 Bacteria 654
296 Ga0207681_10020618 3300025923 Bacteria 4180
297 Ga0207694_10073033 3300025924 Bacteria 2683
298 Ga0207694_10081653 3300025924 Bacteria 2540
299 Ga0207659_10002256 3300025926 Bacteria 11474
300 Ga0207664_10716238 3300025929 Bacteria 900
301 Ga0207644_10007270 3300025931 Bacteria 7207
302 Ga0207644_11068245 3300025931 Unclassified 678
303 Ga0207690_10002554 3300025932 Bacteria 11002
304 Ga0207690_10016955 3300025932 Bacteria 4442
305 Ga0207690_10029992 3300025932 Bacteria 3464
306 Ga0207690_10975601 3300025932 Bacteria 704
307 Ga0207690_11078515 3300025932 Bacteria 669
308 Ga0207690_11220598 3300025932 Bacteria 628
309 Ga0207706_10001609 3300025933 Bacteria 22407
310 Ga0207706_10018320 3300025933 Bacteria 6301
311 Ga0207706_10069641 3300025933 Bacteria 3094
312 Ga0207709_10219028 3300025935 Bacteria 1371
313 Ga0207691_10012970 3300025940 Bacteria 7981
314 Ga0207711_10029142 3300025941 Bacteria 4653
315 Ga0207661_10002656 3300025944 Bacteria 12300
316 Ga0207661_10055597 3300025944 Bacteria 3175
317 Ga0207661_10536241 3300025944 Bacteria 1071
318 Ga0207661_11138772 3300025944 Bacteria 718
319 Ga0207679_10004108 3300025945 Bacteria 9035
320 Ga0207679_10029566 3300025945 Bacteria 3816
321 Ga0207667_10003195 3300025949 Bacteria 20251
322 Ga0207667_10016249 3300025949 Bacteria 8410
323 Ga0207667_10022365 3300025949 Bacteria 6987
324 Ga0207667_10114757 3300025949 Bacteria 2776
325 Ga0207651_10002735 3300025960 Bacteria 8469
326 Ga0207651_10566753 3300025960 Unclassified 989
327 Ga0207668_11052015 3300025972 Unclassified 729
328 Ga0207640_10018303 3300025981 Bacteria 4115
329 Ga0207640_10018863 3300025981 Bacteria 4062
330 Ga0207640_10875930 3300025981 Bacteria 783
331 Ga0207640_11362824 3300025981 Bacteria 635
332 Ga0207658_10054700 3300025986 Bacteria 2954
333 Ga0207677_10372319 3300026023 Bacteria 1203
334 Ga0207639_10014469 3300026041 Bacteria 5550
335 Ga0207639_10048961 3300026041 Bacteria 3202
336 Ga0207639_11681811 3300026041 Unclassified 595
337 Ga0207678_10006856 3300026067 Bacteria 10100
338 Ga0207678_10015645 3300026067 Bacteria 6668
339 Ga0207678_10024785 3300026067 Bacteria 5237
340 Ga0207678_10028356 3300026067 Bacteria 4887
341 Ga0207678_10037300 3300026067 Bacteria 4227
342 Ga0207678_10072949 3300026067 Unclassified 2942
343 Ga0207678_10077225 3300026067 Bacteria 2853
344 Ga0207678_10102181 3300026067 Bacteria 2447
345 Ga0207702_10004728 3300026078 Bacteria 12029
346 Ga0207702_10015728 3300026078 Bacteria 6264
347 Ga0207702_10046986 3300026078 Bacteria 3636
348 Ga0207702_10063532 3300026078 Bacteria 3157
349 Ga0207702_10079131 3300026078 Bacteria 2848
350 Ga0207702_11410151 3300026078 Bacteria 690
351 Ga0207702_11443337 3300026078 Bacteria 682
352 Ga0207641_10674970 3300026088 Bacteria 1016
353 Ga0207648_10065272 3300026089 Bacteria 3173
354 Ga0207676_10164412 3300026095 Bacteria 1926
355 Ga0207674_10002263 3300026116 Bacteria 24396
356 Ga0207674_10015574 3300026116 Bacteria 8350
357 Ga0207674_10094403 3300026116 Unclassified 2978
358 Ga0207674_10134849 3300026116 Bacteria 2431
359 Ga0207674_10635375 3300026116 Bacteria 1031
360 Ga0207683_10274699 3300026121 Bacteria 1540
361 Ga0207698_10002762 3300026142 Bacteria 10472
362 Ga0207698_10005143 3300026142 Bacteria 8042
363 Ga0207698_10012876 3300026142 Bacteria 5494
364 Ga0209974_10017367 3300027876 Unclassified 2386
365 Ga0268266_10021435 3300028379 Bacteria 5504
366 Ga0268266_10534813 3300028379 Bacteria 1122
367 Ga0307408_100304612 3300031548 Bacteria 1336
368 Ga0307410_10030530 3300031852 Bacteria 3445
369 Ga0307410_10093859 3300031852 Bacteria 2136
370 Ga0307410_10633194 3300031852 Bacteria 895
371 Ga0307410_10854793 3300031852 Bacteria 777
372 Ga0307410_11548716 3300031852 Bacteria 585
373 Ga0307410_11967320 3300031852 Bacteria 521
374 Ga0307406_10076152 3300031901 Bacteria 2216
375 Ga0307407_10407837 3300031903 Bacteria 977
376 Ga0307407_10993416 3300031903 Bacteria 648
377 Ga0307412_10030936 3300031911 Bacteria 3376
378 Ga0307409_100229342 3300031995 Bacteria 1682
379 Ga0307409_100344178 3300031995 Bacteria 1404
380 Ga0307416_100047749 3300032002 Bacteria 3391
381 Ga0307416_100187560 3300032002 Bacteria 1946
382 Ga0307414_10246087 3300032004 Bacteria 1483
383 Ga0307414_10247490 3300032004 Bacteria 1480
384 Ga0307414_10598913 3300032004 Bacteria 988
385 Ga0307414_10729571 3300032004 Bacteria 899
386 Ga0307411_10057840 3300032005 Bacteria 2563
387 Ga0395899_0001008 3300037312 Bacteria 25798
388 Ga0395899_0011331 3300037312 Bacteria 6830
389 Ga0395899_0026185 3300037312 Bacteria 4401
390 Ga0395899_0063427 3300037312 Bacteria 2718
391 Ga0395899_0064052 3300037312 Bacteria 2703
392 Ga0395899_0075828 3300037312 Bacteria 2455
393 Ga0395899_0285089 3300037312 Bacteria 1122
394 Ga0395900_0000547 3300037418 Bacteria 52367
395 Ga0395900_0021017 3300037418 Bacteria 6670
396 Ga0395900_0023164 3300037418 Bacteria 6356
397 Ga0395900_0038603 3300037418 Bacteria 4923
398 Ga0395900_0049937 3300037418 Bacteria 4309
399 Ga0395900_0281558 3300037418 Bacteria 1654
400 Ga0395900_0300204 3300037418 Bacteria 1592
401 Ga0395900_0410423 3300037418 Bacteria 1316
402 Ga0395900_0603268 3300037418 Bacteria 1038
403 Ga0395900_0800408 3300037418 Bacteria 870
404 Ga0395898_0033353 3300037466 Bacteria 5139
405 Ga0395898_0034888 3300037466 Bacteria 5006
406 Ga0395898_0076728 3300037466 Bacteria 3226
407 Ga0395898_0105132 3300037466 Bacteria 2707
408 Ga0395898_0166002 3300037466 Bacteria 2111
409 Ga0395898_0183688 3300037466 Bacteria 1998
410 Ga0395898_0706055 3300037466 Bacteria 950
411 Ga0395905_0036681 3300037471 Bacteria 4605
412 Ga0395905_0114179 3300037471 Bacteria 2538
413 Ga0395905_0170937 3300037471 Bacteria 2041
414 Ga0395905_0561610 3300037471 Bacteria 1042
415 Ga0395901_0000390 3300038443 Bacteria 52341
416 Ga0395901_0035043 3300038443 Bacteria 5186
417 Ga0395901_0036495 3300038443 Bacteria 5081
418 Ga0395901_0106245 3300038443 Bacteria 2947
419 Ga0395901_0129446 3300038443 Bacteria 2652
420 Ga0395901_0230120 3300038443 Bacteria 1935
421 Ga0395901_0298488 3300038443 Bacteria 1670
422 Ga0395901_0335195 3300038443 Bacteria 1563
423 Ga0395901_0492025 3300038443 Bacteria 1249
424 Ga0395901_1079948 3300038443 Bacteria 774
425 Ga0395901_1216205 3300038443 Bacteria 718
426 Ga0439448_0081646 3300042005 Bacteria 1086
427 Ga0439458_0076413 3300042157 Bacteria 850
428 Ga0466969_0002081 3300044656 Bacteria 10681
429 Ga0466972_0285335 3300044658 Bacteria 771
430 Ga0466965_0285829 3300044683 Bacteria 892
431 Ga0466966_0002468 3300044684 Bacteria 12107
432 Ga0466961_0100659 3300044693 Bacteria 1820
433 Ga0466963_0224301 3300044694 Bacteria 1316
434 Ga0466964_0194437 3300044706 Bacteria 970
435 Ga0466970_0107602 3300044765 Bacteria 1521
436 Ga0466957_0006888 3300044842 Bacteria 6422
437 Ga0466959_0675936 3300045049 Bacteria 692
438 Ga0466959_1127061 3300045049 Bacteria 521
439 Ga0466958_0002165 3300045836 Bacteria 9784
440 Ga0495669_0000602 3300046684 Bacteria 15746
441 Ga0495677_0042888 3300047445 Bacteria 1658
442 Ga0496101_1165174 3300048904 Unclassified 604
443 Ga0496107_0261320 3300048910 Bacteria 1288
444 Ga0496108_0243808 3300048911 Bacteria 1563
445 Ga0496109_0025686 3300048912 Bacteria 5250
446 Ga0496110_0001413 3300048913 Bacteria 17353
447 Ga0496111_0011130 3300048914 Bacteria 6055
448 Ga0501032_0009949 3300049569 Bacteria 6866
449 Ga0501032_0070379 3300049569 Bacteria 2333
450 Ga0501034_0059076 3300049571 Bacteria 3852
451 Ga0501037_0185165 3300049573 Bacteria 1476
452 Ga0501043_0017818 3300049579 Bacteria 5567
453 Ga0501046_0039450 3300049580 Bacteria 3781
454 Ga0501046_0093928 3300049580 Bacteria 2305
455 Ga0501047_0000560 3300049581 Bacteria 39989
456 Ga0501048_0171391 3300049582 Bacteria 1537
457 Ga0501068_1025366 3300049584 Unclassified 545
458 Ga0501070_0007352 3300049586 Bacteria 9353
459 Ga0501239_023830 3300049672 Bacteria 768
460 Ga0501234_092786 3300049707 Bacteria 543
461 Ga0501035_0025259 3300049822 Bacteria 5446
462 Ga0501035_0106500 3300049822 Bacteria 2458
463 Ga0501044_1411818 3300049823 Bacteria 562

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10125826 Ga0070658_101258264 84
2 3300005331 Ga0070670_100087725 Ga0070670_1000877254 84
3 3300005339 Ga0070660_100003460 Ga0070660_1000034608 84
4 3300005344 Ga0070661_100056574 Ga0070661_1000565743 84
5 3300005366 Ga0070659_100001753 Ga0070659_10000175310 84
6 3300005457 Ga0070662_100159328 Ga0070662_1001593284 84
7 3300005539 Ga0068853_100056982 Ga0068853_1000569825 84
8 3300005564 Ga0070664_100038561 Ga0070664_1000385615 84
9 3300005578 Ga0068854_100299260 Ga0068854_1002992602 84
10 3300005834 Ga0068851_10133379 Ga0068851_101333793 84
11 3300005843 Ga0068860_102217685 Ga0068860_1022176851 84
12 3300013100 Ga0157373_10104794 Ga0157373_101047944 84
13 3300005327 Ga0070658_10220889 Ga0070658_102208892 86
14 3300005344 Ga0070661_101329724 Ga0070661_1013297242 86
15 3300005366 Ga0070659_100786129 Ga0070659_1007861291 86
16 3300005578 Ga0068854_101311342 Ga0068854_1013113422 86
17 3300005616 Ga0068852_102454332 Ga0068852_1024543322 86
18 3300013105 Ga0157369_11944525 Ga0157369_119445252 86
19 3300005614 Ga0068856_100624681 Ga0068856_1006246812 88
20 3300026078 Ga0207702_11410151 Ga0207702_114101512 88
21 3300032004 Ga0307414_10598913 Ga0307414_105989132 88
22 3300031852 Ga0307410_10030530 Ga0307410_100305304 89
23 3300031852 Ga0307410_11967320 Ga0307410_119673201 89
24 3300031903 Ga0307407_10993416 Ga0307407_109934162 89
25 3300032002 Ga0307416_100187560 Ga0307416_1001875604 89
26 3300032004 Ga0307414_10246087 Ga0307414_102460873 89
27 3300032005 Ga0307411_10057840 Ga0307411_100578402 89
28 3300001915 JGI24741J21665_1000086 JGI24741J21665_10000863 91
29 3300005577 Ga0068857_100089401 Ga0068857_1000894013 91
30 3300026067 Ga0207678_10102181 Ga0207678_101021812 91
31 3300026116 Ga0207674_10094403 Ga0207674_100944033 91
32 3300005366 Ga0070659_100016535 Ga0070659_1000165355 92
33 3300025932 Ga0207690_10016955 Ga0207690_100169553 92
34 3300005327 Ga0070658_11133503 Ga0070658_111335032 93
35 3300005578 Ga0068854_100860685 Ga0068854_1008606852 93
36 3300025981 Ga0207640_11362824 Ga0207640_113628242 93
37 3300038443 Ga0395901_0106245 Ga0395901_0106245_763_1062 93
38 3300038443 Ga0395901_0335195 Ga0395901_0335195_575_868 93
39 3300049569 Ga0501032_0070379 Ga0501032_0070379_319_603 93
40 3300049573 Ga0501037_0185165 Ga0501037_0185165_577_861 93
41 3300049580 Ga0501046_0039450 Ga0501046_0039450_2777_3061 93
42 3300049586 Ga0501070_0007352 Ga0501070_0007352_2278_2562 93
43 3300049822 Ga0501035_0025259 Ga0501035_0025259_836_1120 93
44 3300009148 Ga0105243_10157261 Ga0105243_101572612 96
45 3300009545 Ga0105237_10130338 Ga0105237_101303384 96
46 3300013105 Ga0157369_10217104 Ga0157369_102171042 97
47 3300013307 Ga0157372_10768126 Ga0157372_107681262 97
48 3300026078 Ga0207702_10063532 Ga0207702_100635323 97
49 3300049571 Ga0501034_0059076 Ga0501034_0059076_1775_2077 97
50 3300025909 Ga0207705_10700402 Ga0207705_107004022 98
51 3300044683 Ga0466965_0285829 Ga0466965_0285829_15_353 98
52 3300003320 rootH2_10003120 rootH2_100031204 100
53 3300013104 Ga0157370_10021618 Ga0157370_100216187 100
54 3300042157 Ga0439458_0076413 Ga0439458_0076413_366_686 100
55 3300002067 JGI24735J21928_10002477 JGI24735J21928_100024773 101
56 3300005614 Ga0068856_100062965 Ga0068856_1000629652 101
57 3300013105 Ga0157369_10066536 Ga0157369_100665365 101
58 3300013307 Ga0157372_11852901 Ga0157372_118529012 101
59 3300025904 Ga0207647_10020613 Ga0207647_100206134 101
60 3300025904 Ga0207647_10098768 Ga0207647_100987682 101
61 3300026078 Ga0207702_10046986 Ga0207702_100469862 101
62 3300037312 Ga0395899_0285089 Ga0395899_0285089_224_547 101
63 3300037418 Ga0395900_0300204 Ga0395900_0300204_203_526 101
64 3300038443 Ga0395901_0298488 Ga0395901_0298488_403_726 101
65 3300049823 Ga0501044_1411818 Ga0501044_1411818_34_357 101
66 3300001979 JGI24740J21852_10001689 JGI24740J21852_100016892 102
67 3300001979 JGI24740J21852_10071554 JGI24740J21852_100715541 102
68 3300002067 JGI24735J21928_10036645 JGI24735J21928_100366452 102
69 3300003762 Ga0055542_1038168 Ga0055542_10381682 102
70 3300005327 Ga0070658_10045139 Ga0070658_100451394 102
71 3300005327 Ga0070658_10066209 Ga0070658_100662092 102
72 3300005327 Ga0070658_10174463 Ga0070658_101744632 102
73 3300005327 Ga0070658_10418032 Ga0070658_104180322 102
74 3300005327 Ga0070658_10688134 Ga0070658_106881341 102
75 3300005328 Ga0070676_10104970 Ga0070676_101049703 102
76 3300005329 Ga0070683_100029813 Ga0070683_1000298133 102
77 3300005330 Ga0070690_100396724 Ga0070690_1003967242 102
78 3300005330 Ga0070690_100803362 Ga0070690_1008033622 102
79 3300005331 Ga0070670_100000350 Ga0070670_10000035024 102
80 3300005331 Ga0070670_101904824 Ga0070670_1019048242 102
81 3300005333 Ga0070677_10014798 Ga0070677_100147984 102
82 3300005334 Ga0068869_100289087 Ga0068869_1002890872 102
83 3300005335 Ga0070666_10048528 Ga0070666_100485283 102
84 3300005335 Ga0070666_10109560 Ga0070666_101095603 102
85 3300005336 Ga0070680_100098394 Ga0070680_1000983942 102
86 3300005336 Ga0070680_100509030 Ga0070680_1005090302 102
87 3300005337 Ga0070682_101724676 Ga0070682_1017246762 102
88 3300005339 Ga0070660_100020422 Ga0070660_1000204224 102
89 3300005339 Ga0070660_100048825 Ga0070660_1000488251 102
90 3300005339 Ga0070660_100100856 Ga0070660_1001008563 102
91 3300005339 Ga0070660_100124609 Ga0070660_1001246091 102
92 3300005339 Ga0070660_100837421 Ga0070660_1008374211 102
93 3300005341 Ga0070691_10003062 Ga0070691_100030629 102
94 3300005344 Ga0070661_100034152 Ga0070661_1000341524 102
95 3300005344 Ga0070661_100221933 Ga0070661_1002219333 102
96 3300005344 Ga0070661_100669722 Ga0070661_1006697222 102
97 3300005345 Ga0070692_10125395 Ga0070692_101253951 102
98 3300005353 Ga0070669_100026397 Ga0070669_1000263975 102
99 3300005354 Ga0070675_100001857 Ga0070675_10000185711 102
100 3300005355 Ga0070671_100001032 Ga0070671_10000103211 102
101 3300005355 Ga0070671_101721547 Ga0070671_1017215471 102
102 3300005364 Ga0070673_100003253 Ga0070673_10000325312 102
103 3300005364 Ga0070673_100079938 Ga0070673_1000799382 102
104 3300005366 Ga0070659_100031769 Ga0070659_1000317694 102
105 3300005366 Ga0070659_100066291 Ga0070659_1000662912 102
106 3300005366 Ga0070659_101109473 Ga0070659_1011094732 102
107 3300005367 Ga0070667_100098706 Ga0070667_1000987063 102
108 3300005367 Ga0070667_100140880 Ga0070667_1001408802 102
109 3300005455 Ga0070663_100073794 Ga0070663_1000737944 102
110 3300005455 Ga0070663_101068355 Ga0070663_1010683552 102
111 3300005456 Ga0070678_100237869 Ga0070678_1002378692 102
112 3300005457 Ga0070662_100008923 Ga0070662_1000089232 102
113 3300005457 Ga0070662_100063945 Ga0070662_1000639452 102
114 3300005457 Ga0070662_101427450 Ga0070662_1014274501 102
115 3300005458 Ga0070681_10118510 Ga0070681_101185104 102
116 3300005458 Ga0070681_10283650 Ga0070681_102836502 102
117 3300005459 Ga0068867_100650633 Ga0068867_1006506331 102
118 3300005530 Ga0070679_100134002 Ga0070679_1001340022 102
119 3300005530 Ga0070679_100183733 Ga0070679_1001837333 102
120 3300005530 Ga0070679_100351869 Ga0070679_1003518692 102
121 3300005535 Ga0070684_100001830 Ga0070684_1000018308 102
122 3300005539 Ga0068853_100004017 Ga0068853_10000401712 102
123 3300005539 Ga0068853_101815079 Ga0068853_1018150791 102
124 3300005543 Ga0070672_100005889 Ga0070672_1000058893 102
125 3300005546 Ga0070696_100141995 Ga0070696_1001419953 102
126 3300005547 Ga0070693_100834999 Ga0070693_1008349991 102
127 3300005548 Ga0070665_100412069 Ga0070665_1004120692 102
128 3300005563 Ga0068855_100180150 Ga0068855_1001801502 102
129 3300005563 Ga0068855_100182939 Ga0068855_1001829391 102
130 3300005564 Ga0070664_100003170 Ga0070664_1000031709 102
131 3300005564 Ga0070664_100004435 Ga0070664_1000044359 102
132 3300005577 Ga0068857_100022379 Ga0068857_1000223796 102
133 3300005577 Ga0068857_100042493 Ga0068857_1000424935 102
134 3300005578 Ga0068854_100001146 Ga0068854_10000114613 102
135 3300005578 Ga0068854_100120496 Ga0068854_1001204963 102
136 3300005614 Ga0068856_100185796 Ga0068856_1001857962 102
137 3300005616 Ga0068852_100036896 Ga0068852_1000368962 102
138 3300005616 Ga0068852_102372585 Ga0068852_1023725851 102
139 3300005618 Ga0068864_100192337 Ga0068864_1001923372 102
140 3300005834 Ga0068851_10066505 Ga0068851_100665052 102
141 3300005841 Ga0068863_102240324 Ga0068863_1022403242 102
142 3300005842 Ga0068858_100489698 Ga0068858_1004896982 102
143 3300006358 Ga0068871_100621133 Ga0068871_1006211331 102
144 3300009093 Ga0105240_10006152 Ga0105240_1000615212 102
145 3300009177 Ga0105248_10008720 Ga0105248_1000872016 102
146 3300009177 Ga0105248_10753662 Ga0105248_107536622 102
147 3300009545 Ga0105237_10022017 Ga0105237_100220178 102
148 3300009545 Ga0105237_10826026 Ga0105237_108260261 102
149 3300009551 Ga0105238_10004239 Ga0105238_1000423913 102
150 3300013100 Ga0157373_10010908 Ga0157373_100109083 102
151 3300013100 Ga0157373_10247265 Ga0157373_102472653 102
152 3300013102 Ga0157371_10097465 Ga0157371_100974652 102
153 3300013102 Ga0157371_10132181 Ga0157371_101321814 102
154 3300013104 Ga0157370_10009252 Ga0157370_1000925210 102
155 3300013105 Ga0157369_10114879 Ga0157369_101148792 102
156 3300013296 Ga0157374_11261620 Ga0157374_112616202 102
157 3300013297 Ga0157378_10431625 Ga0157378_104316252 102
158 3300013307 Ga0157372_10026860 Ga0157372_100268602 102
159 3300013307 Ga0157372_10442948 Ga0157372_104429483 102
160 3300013308 Ga0157375_10055112 Ga0157375_100551123 102
161 3300014325 Ga0163163_10273323 Ga0163163_102733233 102
162 3300017792 Ga0163161_10020224 Ga0163161_100202242 102
163 3300020070 Ga0206356_10583009 Ga0206356_105830094 102
164 3300022467 Ga0224712_10119128 Ga0224712_101191282 102
165 3300025254 Ga0209148_1000146 Ga0209148_1000146105 102
166 3300025272 Ga0209455_1018488 Ga0209455_10184882 102
167 3300025321 Ga0207656_10007269 Ga0207656_100072694 102
168 3300025893 Ga0207682_10017878 Ga0207682_100178782 102
169 3300025901 Ga0207688_10673827 Ga0207688_106738272 102
170 3300025903 Ga0207680_10177765 Ga0207680_101777653 102
171 3300025904 Ga0207647_10002290 Ga0207647_100022906 102
172 3300025904 Ga0207647_10083526 Ga0207647_100835263 102
173 3300025907 Ga0207645_10014332 Ga0207645_100143323 102
174 3300025909 Ga0207705_10003398 Ga0207705_100033985 102
175 3300025909 Ga0207705_10017120 Ga0207705_100171204 102
176 3300025909 Ga0207705_10179707 Ga0207705_101797072 102
177 3300025909 Ga0207705_10538292 Ga0207705_105382922 102
178 3300025911 Ga0207654_10110228 Ga0207654_101102283 102
179 3300025912 Ga0207707_10124693 Ga0207707_101246934 102
180 3300025912 Ga0207707_11016904 Ga0207707_110169042 102
181 3300025913 Ga0207695_10014439 Ga0207695_100144393 102
182 3300025917 Ga0207660_10068517 Ga0207660_100685172 102
183 3300025917 Ga0207660_10286268 Ga0207660_102862681 102
184 3300025917 Ga0207660_10716391 Ga0207660_107163911 102
185 3300025919 Ga0207657_10003327 Ga0207657_100033272 102
186 3300025919 Ga0207657_10007729 Ga0207657_100077295 102
187 3300025919 Ga0207657_10023542 Ga0207657_100235423 102
188 3300025919 Ga0207657_10027574 Ga0207657_100275745 102
189 3300025919 Ga0207657_10191909 Ga0207657_101919093 102
190 3300025920 Ga0207649_10003373 Ga0207649_100033734 102
191 3300025920 Ga0207649_10007890 Ga0207649_100078908 102
192 3300025921 Ga0207652_10806986 Ga0207652_108069862 102
193 3300025923 Ga0207681_10020618 Ga0207681_100206185 102
194 3300025924 Ga0207694_10073033 Ga0207694_100730334 102
195 3300025926 Ga0207659_10002256 Ga0207659_100022568 102
196 3300025931 Ga0207644_10007270 Ga0207644_100072704 102
197 3300025931 Ga0207644_11068245 Ga0207644_110682452 102
198 3300025932 Ga0207690_10002554 Ga0207690_100025546 102
199 3300025932 Ga0207690_11078515 Ga0207690_110785152 102
200 3300025932 Ga0207690_11220598 Ga0207690_112205982 102
201 3300025933 Ga0207706_10018320 Ga0207706_100183203 102
202 3300025933 Ga0207706_10069641 Ga0207706_100696412 102
203 3300025940 Ga0207691_10012970 Ga0207691_100129703 102
204 3300025941 Ga0207711_10029142 Ga0207711_100291423 102
205 3300025944 Ga0207661_10002656 Ga0207661_100026567 102
206 3300025944 Ga0207661_10536241 Ga0207661_105362412 102
207 3300025945 Ga0207679_10004108 Ga0207679_100041089 102
208 3300025945 Ga0207679_10029566 Ga0207679_100295666 102
209 3300025949 Ga0207667_10114757 Ga0207667_101147573 102
210 3300025960 Ga0207651_10002735 Ga0207651_100027355 102
211 3300025960 Ga0207651_10566753 Ga0207651_105667532 102
212 3300025972 Ga0207668_11052015 Ga0207668_110520152 102
213 3300025981 Ga0207640_10018863 Ga0207640_100188632 102
214 3300025986 Ga0207658_10054700 Ga0207658_100547003 102
215 3300026023 Ga0207677_10372319 Ga0207677_103723192 102
216 3300026041 Ga0207639_10014469 Ga0207639_100144692 102
217 3300026041 Ga0207639_11681811 Ga0207639_116818111 102
218 3300026067 Ga0207678_10024785 Ga0207678_100247853 102
219 3300026067 Ga0207678_10028356 Ga0207678_100283567 102
220 3300026067 Ga0207678_10072949 Ga0207678_100729492 102
221 3300026067 Ga0207678_10077225 Ga0207678_100772252 102
222 3300026078 Ga0207702_10004728 Ga0207702_100047286 102
223 3300026088 Ga0207641_10674970 Ga0207641_106749702 102
224 3300026089 Ga0207648_10065272 Ga0207648_100652723 102
225 3300026095 Ga0207676_10164412 Ga0207676_101644123 102
226 3300026116 Ga0207674_10002263 Ga0207674_1000226335 102
227 3300026116 Ga0207674_10134849 Ga0207674_101348493 102
228 3300026121 Ga0207683_10274699 Ga0207683_102746993 102
229 3300026142 Ga0207698_10002762 Ga0207698_100027629 102
230 3300028379 Ga0268266_10021435 Ga0268266_100214357 102
231 3300028379 Ga0268266_10534813 Ga0268266_105348132 102
232 3300031548 Ga0307408_100304612 Ga0307408_1003046122 102
233 3300031852 Ga0307410_10633194 Ga0307410_106331942 102
234 3300031852 Ga0307410_10854793 Ga0307410_108547932 102
235 3300031995 Ga0307409_100344178 Ga0307409_1003441782 102
236 3300032004 Ga0307414_10247490 Ga0307414_102474903 102
237 3300037312 Ga0395899_0026185 Ga0395899_0026185_578_916 102
238 3300037418 Ga0395900_0021017 Ga0395900_0021017_2281_2613 102
239 3300037418 Ga0395900_0023164 Ga0395900_0023164_5527_5865 102
240 3300037418 Ga0395900_0603268 Ga0395900_0603268_351_668 102
241 3300037466 Ga0395898_0166002 Ga0395898_0166002_1602_1940 102
242 3300037466 Ga0395898_0706055 Ga0395898_0706055_433_750 102
243 3300037471 Ga0395905_0036681 Ga0395905_0036681_3296_3634 102
244 3300038443 Ga0395901_0492025 Ga0395901_0492025_759_1097 102
245 3300044658 Ga0466972_0285335 Ga0466972_0285335_116_454 102
246 3300046684 Ga0495669_0000602 Ga0495669_0000602_9610_9936 102
247 3300047445 Ga0495677_0042888 Ga0495677_0042888_552_878 102
248 3300048904 Ga0496101_1165174 Ga0496101_1165174_162_488 102
249 3300048910 Ga0496107_0261320 Ga0496107_0261320_860_1180 102
250 3300048911 Ga0496108_0243808 Ga0496108_0243808_650_976 102
251 3300048912 Ga0496109_0025686 Ga0496109_0025686_2669_2995 102
252 3300048913 Ga0496110_0001413 Ga0496110_0001413_8518_8844 102
253 3300048914 Ga0496111_0011130 Ga0496111_0011130_3425_3751 102
254 3300049822 Ga0501035_0106500 Ga0501035_0106500_64_390 102
255 3300001979 JGI24740J21852_10121152 JGI24740J21852_101211522 103
256 3300005327 Ga0070658_10210349 Ga0070658_102103493 103
257 3300005530 Ga0070679_100243853 Ga0070679_1002438532 103
258 3300005578 Ga0068854_100493444 Ga0068854_1004934442 103
259 3300025909 Ga0207705_10084534 Ga0207705_100845343 103
260 3300025921 Ga0207652_10245060 Ga0207652_102450603 103
261 3300027876 Ga0209974_10017367 Ga0209974_100173673 103
262 3300031852 Ga0307410_10093859 Ga0307410_100938592 103
263 3300031901 Ga0307406_10076152 Ga0307406_100761522 103
264 3300031903 Ga0307407_10407837 Ga0307407_104078372 103
265 3300031911 Ga0307412_10030936 Ga0307412_100309365 103
266 3300031995 Ga0307409_100229342 Ga0307409_1002293423 103
267 3300032002 Ga0307416_100047749 Ga0307416_1000477493 103
268 3300032004 Ga0307414_10729571 Ga0307414_107295712 103
269 3300049569 Ga0501032_0009949 Ga0501032_0009949_4211_4552 103
270 3300049579 Ga0501043_0017818 Ga0501043_0017818_4584_4925 103
271 3300049580 Ga0501046_0093928 Ga0501046_0093928_583_924 103
272 3300049581 Ga0501047_0000560 Ga0501047_0000560_16744_17085 103
273 3300049582 Ga0501048_0171391 Ga0501048_0171391_742_1083 103
274 3300049672 Ga0501239_023830 Ga0501239_023830_381_701 103
275 3300049707 Ga0501234_092786 Ga0501234_092786_134_454 103
276 3300004799 Ga0058863_11863976 Ga0058863_118639761 104
277 3300005327 Ga0070658_10000876 Ga0070658_1000087622 104
278 3300005327 Ga0070658_10002895 Ga0070658_1000289514 104
279 3300005327 Ga0070658_10536811 Ga0070658_105368112 104
280 3300005329 Ga0070683_100010109 Ga0070683_1000101099 104
281 3300005329 Ga0070683_102087561 Ga0070683_1020875611 104
282 3300005333 Ga0070677_10024197 Ga0070677_100241973 104
283 3300005336 Ga0070680_100081304 Ga0070680_1000813045 104
284 3300005339 Ga0070660_100000487 Ga0070660_1000004873 104
285 3300005339 Ga0070660_100001158 Ga0070660_1000011584 104
286 3300005339 Ga0070660_100086963 Ga0070660_1000869633 104
287 3300005339 Ga0070660_100124398 Ga0070660_1001243983 104
288 3300005344 Ga0070661_100102420 Ga0070661_1001024204 104
289 3300005345 Ga0070692_10015183 Ga0070692_100151836 104
290 3300005345 Ga0070692_10020675 Ga0070692_100206751 104
291 3300005345 Ga0070692_10035727 Ga0070692_100357273 104
292 3300005355 Ga0070671_100024364 Ga0070671_1000243644 104
293 3300005355 Ga0070671_100190451 Ga0070671_1001904512 104
294 3300005366 Ga0070659_100290272 Ga0070659_1002902722 104
295 3300005455 Ga0070663_100007970 Ga0070663_1000079704 104
296 3300005455 Ga0070663_100227285 Ga0070663_1002272852 104
297 3300005458 Ga0070681_10171116 Ga0070681_101711163 104
298 3300005530 Ga0070679_100377724 Ga0070679_1003777242 104
299 3300005535 Ga0070684_100068323 Ga0070684_1000683236 104
300 3300005546 Ga0070696_100246173 Ga0070696_1002461732 104
301 3300005563 Ga0068855_100000079 Ga0068855_10000007943 104
302 3300005563 Ga0068855_100700158 Ga0068855_1007001582 104
303 3300005564 Ga0070664_101872809 Ga0070664_1018728091 104
304 3300005577 Ga0068857_100255816 Ga0068857_1002558162 104
305 3300005578 Ga0068854_101054242 Ga0068854_1010542422 104
306 3300005614 Ga0068856_101070213 Ga0068856_1010702131 104
307 3300005615 Ga0070702_100844090 Ga0070702_1008440902 104
308 3300013100 Ga0157373_10003029 Ga0157373_1000302910 104
309 3300013100 Ga0157373_10048905 Ga0157373_100489053 104
310 3300013102 Ga0157371_10000261 Ga0157371_1000026143 104
311 3300013102 Ga0157371_10031157 Ga0157371_100311573 104
312 3300013104 Ga0157370_10015810 Ga0157370_100158107 104
313 3300013104 Ga0157370_10472216 Ga0157370_104722162 104
314 3300013104 Ga0157370_11863806 Ga0157370_118638062 104
315 3300014325 Ga0163163_12457713 Ga0163163_124577132 104
316 3300020076 Ga0206355_1378246 Ga0206355_13782462 104
317 3300020077 Ga0206351_10608247 Ga0206351_106082472 104
318 3300020077 Ga0206351_10797287 Ga0206351_107972872 104
319 3300020082 Ga0206353_10241471 Ga0206353_102414712 104
320 3300020610 Ga0154015_1206154 Ga0154015_12061542 104
321 3300025904 Ga0207647_10026471 Ga0207647_100264712 104
322 3300025904 Ga0207647_10200830 Ga0207647_102008302 104
323 3300025904 Ga0207647_10517903 Ga0207647_105179032 104
324 3300025909 Ga0207705_10000125 Ga0207705_1000012523 104
325 3300025909 Ga0207705_10000749 Ga0207705_1000074927 104
326 3300025909 Ga0207705_10002384 Ga0207705_100023848 104
327 3300025909 Ga0207705_10004946 Ga0207705_100049465 104
328 3300025912 Ga0207707_10253949 Ga0207707_102539492 104
329 3300025912 Ga0207707_11658229 Ga0207707_116582292 104
330 3300025917 Ga0207660_10031084 Ga0207660_100310844 104
331 3300025919 Ga0207657_10000167 Ga0207657_1000016742 104
332 3300025919 Ga0207657_10000431 Ga0207657_1000043110 104
333 3300025919 Ga0207657_10017579 Ga0207657_100175793 104
334 3300025919 Ga0207657_10137998 Ga0207657_101379983 104
335 3300025920 Ga0207649_10169901 Ga0207649_101699012 104
336 3300025921 Ga0207652_10352084 Ga0207652_103520842 104
337 3300025921 Ga0207652_11219849 Ga0207652_112198492 104
338 3300025932 Ga0207690_10975601 Ga0207690_109756012 104
339 3300025933 Ga0207706_10001609 Ga0207706_100016097 104
340 3300025944 Ga0207661_10055597 Ga0207661_100555974 104
341 3300025949 Ga0207667_10003195 Ga0207667_1000319519 104
342 3300025981 Ga0207640_10875930 Ga0207640_108759302 104
343 3300026067 Ga0207678_10006856 Ga0207678_100068564 104
344 3300026067 Ga0207678_10037300 Ga0207678_100373004 104
345 3300026078 Ga0207702_11443337 Ga0207702_114433371 104
346 3300026116 Ga0207674_10635375 Ga0207674_106353752 104
347 3300037312 Ga0395899_0001008 Ga0395899_0001008_17835_18164 104
348 3300037312 Ga0395899_0075828 Ga0395899_0075828_2022_2348 104
349 3300037418 Ga0395900_0000547 Ga0395900_0000547_24340_24669 104
350 3300037418 Ga0395900_0410423 Ga0395900_0410423_374_700 104
351 3300037466 Ga0395898_0076728 Ga0395898_0076728_1886_2212 104
352 3300037466 Ga0395898_0183688 Ga0395898_0183688_1032_1358 104
353 3300037471 Ga0395905_0170937 Ga0395905_0170937_1515_1841 104
354 3300037471 Ga0395905_0561610 Ga0395905_0561610_223_549 104
355 3300038443 Ga0395901_0000390 Ga0395901_0000390_27673_28002 104
356 3300038443 Ga0395901_0036495 Ga0395901_0036495_3741_4067 104
357 3300038443 Ga0395901_0129446 Ga0395901_0129446_622_948 104
358 3300038443 Ga0395901_1216205 Ga0395901_1216205_178_504 104
359 3300042005 Ga0439448_0081646 Ga0439448_0081646_619_966 105
360 3300001904 JGI24736J21556_1000117 JGI24736J21556_10001172 106
361 3300001915 JGI24741J21665_1010128 JGI24741J21665_10101283 106
362 3300001979 JGI24740J21852_10004032 JGI24740J21852_100040323 106
363 3300001990 JGI24737J22298_10045660 JGI24737J22298_100456602 106
364 3300005327 Ga0070658_10004333 Ga0070658_1000433311 106
365 3300005327 Ga0070658_10009991 Ga0070658_1000999112 106
366 3300005329 Ga0070683_100259377 Ga0070683_1002593773 106
367 3300005339 Ga0070660_100001347 Ga0070660_1000013476 106
368 3300005339 Ga0070660_100002825 Ga0070660_10000282511 106
369 3300005344 Ga0070661_100023216 Ga0070661_1000232169 106
370 3300005344 Ga0070661_100119074 Ga0070661_1001190743 106
371 3300005366 Ga0070659_100005514 Ga0070659_1000055146 106
372 3300005406 Ga0070703_10304587 Ga0070703_103045872 106
373 3300005455 Ga0070663_100018655 Ga0070663_1000186552 106
374 3300005455 Ga0070663_100182382 Ga0070663_1001823823 106
375 3300005518 Ga0070699_100768640 Ga0070699_1007686402 106
376 3300005535 Ga0070684_100132628 Ga0070684_1001326282 106
377 3300005539 Ga0068853_100407462 Ga0068853_1004074622 106
378 3300005546 Ga0070696_101244168 Ga0070696_1012441681 106
379 3300005563 Ga0068855_100015129 Ga0068855_1000151296 106
380 3300005563 Ga0068855_101903014 Ga0068855_1019030142 106
381 3300005564 Ga0070664_100769631 Ga0070664_1007696312 106
382 3300005577 Ga0068857_100020042 Ga0068857_1000200423 106
383 3300005578 Ga0068854_100119141 Ga0068854_1001191414 106
384 3300005578 Ga0068854_100150411 Ga0068854_1001504115 106
385 3300005614 Ga0068856_100022339 Ga0068856_1000223395 106
386 3300005614 Ga0068856_101494215 Ga0068856_1014942151 106
387 3300005616 Ga0068852_100019828 Ga0068852_1000198281 106
388 3300005616 Ga0068852_100025625 Ga0068852_10002562510 106
389 3300005616 Ga0068852_101949679 Ga0068852_1019496792 106
390 3300009093 Ga0105240_10007155 Ga0105240_100071556 106
391 3300009174 Ga0105241_10159554 Ga0105241_101595543 106
392 3300009545 Ga0105237_10385939 Ga0105237_103859392 106
393 3300009551 Ga0105238_10026814 Ga0105238_100268143 106
394 3300010375 Ga0105239_10436892 Ga0105239_104368922 106
395 3300013100 Ga0157373_10003770 Ga0157373_1000377018 106
396 3300013100 Ga0157373_10021117 Ga0157373_100211175 106
397 3300013102 Ga0157371_10010561 Ga0157371_100105619 106
398 3300013102 Ga0157371_10027348 Ga0157371_100273489 106
399 3300013102 Ga0157371_10490143 Ga0157371_104901432 106
400 3300013102 Ga0157371_10740748 Ga0157371_107407482 106
401 3300013104 Ga0157370_10434083 Ga0157370_104340832 106
402 3300013104 Ga0157370_10607283 Ga0157370_106072832 106
403 3300013105 Ga0157369_10015792 Ga0157369_100157926 106
404 3300013105 Ga0157369_10246392 Ga0157369_102463924 106
405 3300013296 Ga0157374_10047489 Ga0157374_100474893 106
406 3300013307 Ga0157372_10076275 Ga0157372_100762756 106
407 3300013307 Ga0157372_10113929 Ga0157372_101139293 106
408 3300020070 Ga0206356_10267260 Ga0206356_102672602 106
409 3300020076 Ga0206355_1185753 Ga0206355_11857532 106
410 3300020077 Ga0206351_10505324 Ga0206351_105053242 106
411 3300020078 Ga0206352_10130232 Ga0206352_101302322 106
412 3300020610 Ga0154015_1120478 Ga0154015_11204782 106
413 3300022467 Ga0224712_10013540 Ga0224712_100135402 106
414 3300025904 Ga0207647_10002620 Ga0207647_100026203 106
415 3300025909 Ga0207705_10000003 Ga0207705_10000003185 106
416 3300025909 Ga0207705_10052745 Ga0207705_100527454 106
417 3300025913 Ga0207695_10004896 Ga0207695_1000489617 106
418 3300025913 Ga0207695_10009694 Ga0207695_1000969419 106
419 3300025914 Ga0207671_10605160 Ga0207671_106051602 106
420 3300025919 Ga0207657_10002665 Ga0207657_100026656 106
421 3300025919 Ga0207657_10002957 Ga0207657_100029577 106
422 3300025920 Ga0207649_10007823 Ga0207649_100078239 106
423 3300025924 Ga0207694_10081653 Ga0207694_100816533 106
424 3300025929 Ga0207664_10716238 Ga0207664_107162382 106
425 3300025932 Ga0207690_10029992 Ga0207690_100299923 106
426 3300025935 Ga0207709_10219028 Ga0207709_102190282 106
427 3300025944 Ga0207661_11138772 Ga0207661_111387721 106
428 3300025949 Ga0207667_10016249 Ga0207667_100162496 106
429 3300025949 Ga0207667_10022365 Ga0207667_1002236510 106
430 3300025981 Ga0207640_10018303 Ga0207640_100183037 106
431 3300026041 Ga0207639_10048961 Ga0207639_100489612 106
432 3300026067 Ga0207678_10015645 Ga0207678_100156456 106
433 3300026078 Ga0207702_10015728 Ga0207702_100157286 106
434 3300026078 Ga0207702_10079131 Ga0207702_100791315 106
435 3300026116 Ga0207674_10015574 Ga0207674_1001557410 106
436 3300026142 Ga0207698_10005143 Ga0207698_100051436 106
437 3300026142 Ga0207698_10012876 Ga0207698_100128769 106
438 3300031852 Ga0307410_11548716 Ga0307410_115487161 106
439 3300037312 Ga0395899_0011331 Ga0395899_0011331_4222_4542 106
440 3300037312 Ga0395899_0063427 Ga0395899_0063427_352_675 106
441 3300037312 Ga0395899_0064052 Ga0395899_0064052_352_672 106
442 3300037418 Ga0395900_0038603 Ga0395900_0038603_1522_1842 106
443 3300037418 Ga0395900_0049937 Ga0395900_0049937_2386_2706 106
444 3300037418 Ga0395900_0281558 Ga0395900_0281558_33_353 106
445 3300037418 Ga0395900_0800408 Ga0395900_0800408_536_856 106
446 3300037466 Ga0395898_0033353 Ga0395898_0033353_2414_2734 106
447 3300037466 Ga0395898_0034888 Ga0395898_0034888_59_379 106
448 3300037466 Ga0395898_0105132 Ga0395898_0105132_873_1193 106
449 3300037471 Ga0395905_0114179 Ga0395905_0114179_225_545 106
450 3300038443 Ga0395901_0035043 Ga0395901_0035043_151_471 106
451 3300038443 Ga0395901_0230120 Ga0395901_0230120_96_416 106
452 3300038443 Ga0395901_1079948 Ga0395901_1079948_285_605 106
453 3300044656 Ga0466969_0002081 Ga0466969_0002081_8170_8493 106
454 3300044684 Ga0466966_0002468 Ga0466966_0002468_9479_9802 106
455 3300044693 Ga0466961_0100659 Ga0466961_0100659_1233_1556 106
456 3300044694 Ga0466963_0224301 Ga0466963_0224301_686_1006 106
457 3300044706 Ga0466964_0194437 Ga0466964_0194437_616_939 106
458 3300044765 Ga0466970_0107602 Ga0466970_0107602_105_428 106
459 3300044842 Ga0466957_0006888 Ga0466957_0006888_86_409 106
460 3300045049 Ga0466959_0675936 Ga0466959_0675936_12_335 106
461 3300045049 Ga0466959_1127061 Ga0466959_1127061_187_510 106
462 3300045836 Ga0466958_0002165 Ga0466958_0002165_8655_8978 106
463 3300049584 Ga0501068_1025366 Ga0501068_1025366_90_416 106

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13473

Cupredoxin_1

Cupredoxin-like domain

7

114

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hbe-assembly1.cif.gz_B cu-containing nitrite reductase (nirk) from thermus scotoductus sa-01 0.8793 27 106
1id2-assembly3.cif.gz_C crystal structure of amicyanin from paracoccus versutus (thiobacillus versutus) 0.8546 27 105
2uxg-assembly1.cif.gz_A pseudoazurin with engineered amicyanin ligand loop, reduced form, ph 5.5 0.8396 27 105
5fc9-assembly1.cif.gz_D novel purple cupredoxin from nitrosopumilus maritimus 0.8393 28 105
5yw3-assembly3.cif.gz_C x-ray crystal structure of pseudoazurin thr36lys variant 0.8342 27 105
ID Description Score Start End Superfamily
2bzcA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8305 29 105 2.60.40.420
5fc9B00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8285 28 105 2.60.40.420
4hcfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8059 26 105 2.60.40.420
af_P22698_19_105_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8029 24 105 2.60.40.420
1jxdA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8 27 105 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A7W5LKI2-F1-model_v4 Plastocyanin 0.9543 23 106
AF-A0A502Y172-F1-model_v4 Amicyanin 0.9533 21 106
AF-A0A436BJB7-F1-model_v4 Amicyanin 0.9527 22 106
AF-A0A503XHC7-F1-model_v4 Amicyanin 0.9516 22 106
AF-A0A531KTJ7-F1-model_v4 deleted 0.9513 26 106

Feature Viewer

pLDDT pTM Quality
89.27 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map