F449144

General Info

Members Datasets Scaffolds Average Seq Length
463 290 926 120

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0591516|Ga0395898_0591516_102_536
Length 144
Sequence VARIPINELDQRSNSPKIDEVREAVVTVEDVRSLAMSLPRTTEALVRDRVKFRVGRIVYIAFSRDETVMGFAFPKEEREALVRSEPDKFMMPGASDLRYHWVEVRLEALDVLEMRELVLDAWRMVVPKSVAAAYDDRWVEVDGT

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
173 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
174 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
175 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
194 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
195 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
196 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
197 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
198 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
199 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
200 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
201 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
202 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
215 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
216 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
217 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
220 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
221 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
222 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
223 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
224 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
225 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
226 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
229 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
237 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
238 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
246 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
247 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
272 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
273 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
274 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
275 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
278 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
281 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
287 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 5.4
Rhizosphere 93.3
Stem 0
Stem Tuber 0
Unclassified 2.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0591516 3300037466 Bacteria 1052
2 JGI24738J21930_10011698 3300002075 Bacteria 1925
3 JGI24744J21845_10015823 3300002077 Bacteria 1504
4 JGI24033J26618_1027983 3300002155 Bacteria 748
5 JGI24742J22300_10001807 3300002244 Bacteria 3405
6 JGI24742J22300_10079034 3300002244 Bacteria 620
7 JGI25407J50210_10065688 3300003373 Bacteria 908
8 Ga0070683_101079304 3300005329 Bacteria 771
9 Ga0070690_100181232 3300005330 Bacteria 1456
10 Ga0070690_100941692 3300005330 Bacteria 678
11 Ga0070670_100964421 3300005331 Bacteria 775
12 Ga0070670_101154145 3300005331 Bacteria 707
13 Ga0070670_102135858 3300005331 Bacteria 516
14 Ga0068869_100059988 3300005334 Bacteria 2787
15 Ga0070680_100173873 3300005336 Bacteria 1813
16 Ga0070682_100058924 3300005337 Bacteria 2423
17 Ga0068868_100487907 3300005338 Bacteria 1077
18 Ga0070660_100605555 3300005339 Bacteria 916
19 Ga0070689_100090925 3300005340 Bacteria 2406
20 Ga0070691_10356871 3300005341 Bacteria 813
21 Ga0070687_100105628 3300005343 Bacteria 1585
22 Ga0070687_100867660 3300005343 Bacteria 645
23 Ga0070692_10345238 3300005345 Bacteria 923
24 Ga0070668_100183945 3300005347 Bacteria 1708
25 Ga0070668_102045003 3300005347 Bacteria 528
26 Ga0070675_100074976 3300005354 Bacteria 2812
27 Ga0070671_100044728 3300005355 Bacteria 3680
28 Ga0070674_100091204 3300005356 Bacteria 2200
29 Ga0070674_101221406 3300005356 Bacteria 668
30 Ga0070673_100493970 3300005364 Bacteria 1106
31 Ga0070688_100051988 3300005365 Bacteria 2558
32 Ga0070688_100182448 3300005365 Bacteria 1457
33 Ga0070688_100227044 3300005365 Bacteria 1319
34 Ga0070659_101349222 3300005366 Bacteria 633
35 Ga0070659_101816185 3300005366 Bacteria 546
36 Ga0070709_10031755 3300005434 Bacteria 3180
37 Ga0070709_10184063 3300005434 Bacteria 1469
38 Ga0070713_100298096 3300005436 Bacteria 1484
39 Ga0070713_100608986 3300005436 Bacteria 1038
40 Ga0070701_10014939 3300005438 Bacteria 3572
41 Ga0070701_10207077 3300005438 Bacteria 1162
42 Ga0070711_100014398 3300005439 Bacteria 4984
43 Ga0070711_101614762 3300005439 Bacteria 567
44 Ga0070705_100048808 3300005440 Bacteria 2454
45 Ga0070700_100050371 3300005441 Bacteria 2589
46 Ga0070700_101496487 3300005441 Bacteria 574
47 Ga0070708_101031059 3300005445 Bacteria 771
48 Ga0070663_100056245 3300005455 Bacteria 2818
49 Ga0070663_100287842 3300005455 Bacteria 1311
50 Ga0070663_100438767 3300005455 Bacteria 1074
51 Ga0070678_100089151 3300005456 Bacteria 2360
52 Ga0070678_100889179 3300005456 Bacteria 814
53 Ga0070662_100120682 3300005457 Bacteria 2009
54 Ga0070662_100928594 3300005457 Bacteria 743
55 Ga0070681_11198641 3300005458 Bacteria 681
56 Ga0068867_100020871 3300005459 Bacteria 4672
57 Ga0068867_101046115 3300005459 Bacteria 743
58 Ga0070685_10166009 3300005466 Bacteria 1411
59 Ga0070706_101942478 3300005467 Bacteria 533
60 Ga0070707_100251185 3300005468 Bacteria 1721
61 Ga0070707_101630988 3300005468 Bacteria 612
62 Ga0070698_100023165 3300005471 Bacteria 6492
63 Ga0070698_100346879 3300005471 Bacteria 1416
64 Ga0070679_100881458 3300005530 Bacteria 838
65 Ga0070684_100211480 3300005535 Bacteria 1768
66 Ga0070684_100520046 3300005535 Bacteria 1103
67 Ga0070697_102141080 3300005536 Bacteria 501
68 Ga0068853_100289430 3300005539 Bacteria 1512
69 Ga0070672_100190814 3300005543 Bacteria 1711
70 Ga0070686_100294204 3300005544 Bacteria 1202
71 Ga0070686_100613427 3300005544 Bacteria 859
72 Ga0070686_101463324 3300005544 Bacteria 575
73 Ga0070695_100026193 3300005545 Bacteria 3606
74 Ga0070696_100032827 3300005546 Bacteria 3563
75 Ga0070693_100429290 3300005547 Bacteria 923
76 Ga0070693_100616984 3300005547 Bacteria 785
77 Ga0070665_100027133 3300005548 Bacteria 5768
78 Ga0070665_100117430 3300005548 Bacteria 2663
79 Ga0070665_100577530 3300005548 Bacteria 1137
80 Ga0070704_100016151 3300005549 Bacteria 4711
81 Ga0068855_100445925 3300005563 Unclassified 1413
82 Ga0068855_100664676 3300005563 Bacteria 1118
83 Ga0070664_100280574 3300005564 Bacteria 1502
84 Ga0068857_100661572 3300005577 Bacteria 990
85 Ga0068857_101201848 3300005577 Bacteria 734
86 Ga0068854_101399855 3300005578 Unclassified 632
87 Ga0070702_100135198 3300005615 Bacteria 1563
88 Ga0070702_100845762 3300005615 Bacteria 712
89 Ga0068852_100526698 3300005616 Bacteria 1180
90 Ga0068852_101107253 3300005616 Bacteria 812
91 Ga0068859_100263133 3300005617 Bacteria 1816
92 Ga0068859_101137323 3300005617 Bacteria 859
93 Ga0068859_101626640 3300005617 Bacteria 713
94 Ga0068859_102005434 3300005617 Bacteria 639
95 Ga0068859_102302809 3300005617 Bacteria 594
96 Ga0068864_100008649 3300005618 Bacteria 8399
97 Ga0068864_100833463 3300005618 Bacteria 908
98 Ga0068864_101155759 3300005618 Unclassified 772
99 Ga0068866_10275151 3300005718 Bacteria 1041
100 Ga0068866_10316148 3300005718 Bacteria 980
101 Ga0068861_100089866 3300005719 Bacteria 2421
102 Ga0068861_100361736 3300005719 Bacteria 1276
103 Ga0068861_100616887 3300005719 Bacteria 998
104 Ga0068861_101266742 3300005719 Bacteria 716
105 Ga0068861_102410507 3300005719 Bacteria 529
106 Ga0068851_10193881 3300005834 Bacteria 1131
107 Ga0068851_11088677 3300005834 Bacteria 507
108 Ga0068870_10016350 3300005840 Bacteria 3543
109 Ga0068870_10104673 3300005840 Bacteria 1606
110 Ga0068870_10485580 3300005840 Bacteria 821
111 Ga0068863_101147408 3300005841 Bacteria 782
112 Ga0068858_100164693 3300005842 Bacteria 2089
113 Ga0068858_100611047 3300005842 Bacteria 1058
114 Ga0068858_100752528 3300005842 Bacteria 949
115 Ga0068858_101761279 3300005842 Bacteria 612
116 Ga0068860_100072099 3300005843 Bacteria 3282
117 Ga0068860_100338305 3300005843 Bacteria 1479
118 Ga0068860_100775870 3300005843 Bacteria 971
119 Ga0068862_100343810 3300005844 Bacteria 1382
120 Ga0068862_100353322 3300005844 Bacteria 1364
121 Ga0068862_101367604 3300005844 Bacteria 711
122 Ga0068862_101454004 3300005844 Bacteria 690
123 Ga0068862_102102358 3300005844 Bacteria 576
124 Ga0081455_10007797 3300005937 Bacteria 11213
125 Ga0081540_1000527 3300005983 Bacteria 37363
126 Ga0081540_1136326 3300005983 Bacteria 993
127 Ga0081540_1282858 3300005983 Bacteria 572
128 Ga0075364_10202832 3300006051 Bacteria 1344
129 Ga0070715_10344257 3300006163 Bacteria 812
130 Ga0070716_100004089 3300006173 Bacteria 6921
131 Ga0070712_100721724 3300006175 Bacteria 851
132 Ga0097621_100581963 3300006237 Bacteria 1022
133 Ga0068871_100593734 3300006358 Bacteria 1006
134 Ga0068871_101659343 3300006358 Bacteria 606
135 Ga0068871_102407686 3300006358 Bacteria 502
136 Ga0075428_100000612 3300006844 Bacteria 36453
137 Ga0075428_100034640 3300006844 Bacteria 5567
138 Ga0075428_100124582 3300006844 Bacteria 2805
139 Ga0075430_100049019 3300006846 Bacteria 3565
140 Ga0075430_100087297 3300006846 Bacteria 2610
141 Ga0075431_100028839 3300006847 Bacteria 5707
142 Ga0075431_100867337 3300006847 Bacteria 873
143 Ga0075431_100951807 3300006847 Bacteria 827
144 Ga0075433_10187260 3300006852 Bacteria 1841
145 Ga0075433_10802377 3300006852 Bacteria 822
146 Ga0075434_100027084 3300006871 Bacteria 5626
147 Ga0075434_100041369 3300006871 Bacteria 4567
148 Ga0075434_100090292 3300006871 Bacteria 3065
149 Ga0075434_100964574 3300006871 Bacteria 867
150 Ga0075429_100084167 3300006880 Bacteria 2772
151 Ga0075429_100532678 3300006880 Bacteria 1029
152 Ga0075429_101059003 3300006880 Bacteria 709
153 Ga0068865_100572195 3300006881 Bacteria 951
154 Ga0075436_100310018 3300006914 Bacteria 1132
155 Ga0075436_100768936 3300006914 Bacteria 716
156 Ga0097620_100263107 3300006931 Bacteria 1816
157 Ga0097620_100899666 3300006931 Bacteria 970
158 Ga0097620_101137327 3300006931 Bacteria 859
159 Ga0097620_101626688 3300006931 Bacteria 713
160 Ga0097620_102006089 3300006931 Bacteria 639
161 Ga0097620_102302529 3300006931 Bacteria 594
162 Ga0075435_100041565 3300007076 Bacteria 3676
163 Ga0111539_10021223 3300009094 Bacteria 7997
164 Ga0111539_10097887 3300009094 Unclassified 3446
165 Ga0111539_10423312 3300009094 Bacteria 1551
166 Ga0111539_10963104 3300009094 Bacteria 992
167 Ga0111539_12723503 3300009094 Unclassified 573
168 Ga0105245_10776617 3300009098 Bacteria 995
169 Ga0105245_11735476 3300009098 Bacteria 677
170 Ga0105247_10606018 3300009101 Bacteria 813
171 Ga0114129_10000091 3300009147 Bacteria 86444
172 Ga0114129_10033589 3300009147 Bacteria 7249
173 Ga0114129_10402700 3300009147 Bacteria 1803
174 Ga0114129_10854825 3300009147 Bacteria 1156
175 Ga0114129_11063331 3300009147 Bacteria 1015
176 Ga0105243_10270024 3300009148 Bacteria 1527
177 Ga0105243_10728996 3300009148 Bacteria 969
178 Ga0105241_11225254 3300009174 Bacteria 712
179 Ga0105242_10552074 3300009176 Bacteria 1105
180 Ga0105242_12000776 3300009176 Unclassified 622
181 Ga0105242_12040581 3300009176 Bacteria 616
182 Ga0105248_10079258 3300009177 Bacteria 3691
183 Ga0105237_10879513 3300009545 Bacteria 903
184 Ga0105238_11145533 3300009551 Bacteria 801
185 Ga0105249_10114254 3300009553 Bacteria 2556
186 Ga0105249_10202641 3300009553 Bacteria 1942
187 Ga0105239_10375809 3300010375 Bacteria 1606
188 Ga0105239_12650622 3300010375 Bacteria 585
189 Ga0105246_10500483 3300011119 Bacteria 1032
190 Ga0157369_10361492 3300013105 Bacteria 1507
191 Ga0157369_10764395 3300013105 Bacteria 994
192 Ga0157374_11130885 3300013296 Bacteria 804
193 Ga0157374_11176387 3300013296 Bacteria 788
194 Ga0157378_11160325 3300013297 Bacteria 811
195 Ga0163162_10824447 3300013306 Bacteria 1044
196 Ga0163162_11301247 3300013306 Bacteria 826
197 Ga0163162_12464607 3300013306 Bacteria 598
198 Ga0157372_10754326 3300013307 Bacteria 1131
199 Ga0157372_11607079 3300013307 Bacteria 748
200 Ga0157375_10180505 3300013308 Bacteria 2262
201 Ga0157375_10923556 3300013308 Bacteria 1016
202 Ga0157375_11223145 3300013308 Bacteria 882
203 Ga0157375_11642762 3300013308 Bacteria 760
204 Ga0163163_10002849 3300014325 Bacteria 14612
205 Ga0163163_10027996 3300014325 Bacteria 5407
206 Ga0163163_12044067 3300014325 Bacteria 633
207 Ga0157380_10020557 3300014326 Bacteria 4936
208 Ga0157380_12132846 3300014326 Bacteria 624
209 Ga0157380_12865596 3300014326 Bacteria 549
210 Ga0157377_10206848 3300014745 Bacteria 1249
211 Ga0157377_11009303 3300014745 Bacteria 631
212 Ga0157379_10018092 3300014968 Bacteria 6210
213 Ga0157379_11217859 3300014968 Bacteria 725
214 Ga0157379_11628530 3300014968 Bacteria 631
215 Ga0157379_11786893 3300014968 Bacteria 604
216 Ga0157376_10185039 3300014969 Bacteria 1907
217 Ga0157376_10866706 3300014969 Bacteria 919
218 Ga0163161_10034101 3300017792 Bacteria 3639
219 Ga0224572_1000948 3300024225 Bacteria 3973
220 Ga0207656_10145119 3300025321 Bacteria 1121
221 Ga0207688_10004459 3300025901 Bacteria 7623
222 Ga0207688_10279278 3300025901 Bacteria 1017
223 Ga0207680_10153709 3300025903 Bacteria 1536
224 Ga0207680_10603017 3300025903 Bacteria 785
225 Ga0207680_10870708 3300025903 Bacteria 646
226 Ga0207647_10038914 3300025904 Bacteria 3004
227 Ga0207699_10019740 3300025906 Bacteria 3600
228 Ga0207699_10254184 3300025906 Bacteria 1212
229 Ga0207699_11192796 3300025906 Bacteria 564
230 Ga0207645_10061030 3300025907 Bacteria 2408
231 Ga0207643_10234779 3300025908 Bacteria 1126
232 Ga0207643_10638462 3300025908 Bacteria 687
233 Ga0207643_11133801 3300025908 Bacteria 504
234 Ga0207654_10016336 3300025911 Bacteria 3864
235 Ga0207654_10400450 3300025911 Bacteria 954
236 Ga0207707_11048104 3300025912 Bacteria 667
237 Ga0207707_11107702 3300025912 Bacteria 645
238 Ga0207695_11367606 3300025913 Bacteria 588
239 Ga0207671_10790642 3300025914 Bacteria 753
240 Ga0207662_10064940 3300025918 Bacteria 2197
241 Ga0207662_10071877 3300025918 Bacteria 2096
242 Ga0207652_10096335 3300025921 Bacteria 2607
243 Ga0207646_10000013 3300025922 Bacteria 364371
244 Ga0207646_10043438 3300025922 Bacteria 4036
245 Ga0207646_10139906 3300025922 Bacteria 2180
246 Ga0207646_10390187 3300025922 Bacteria 1258
247 Ga0207646_10771887 3300025922 Bacteria 857
248 Ga0207681_10195745 3300025923 Bacteria 1549
249 Ga0207659_10010437 3300025926 Bacteria 5839
250 Ga0207659_10834657 3300025926 Bacteria 792
251 Ga0207687_10105537 3300025927 Bacteria 2082
252 Ga0207687_10155578 3300025927 Bacteria 1749
253 Ga0207687_10522313 3300025927 Bacteria 993
254 Ga0207690_10957071 3300025932 Bacteria 711
255 Ga0207706_10052081 3300025933 Bacteria 3614
256 Ga0207686_10498089 3300025934 Bacteria 945
257 Ga0207709_10038903 3300025935 Bacteria 2837
258 Ga0207709_10304229 3300025935 Bacteria 1187
259 Ga0207670_10435691 3300025936 Bacteria 1054
260 Ga0207669_10013923 3300025937 Bacteria 4015
261 Ga0207665_10022096 3300025939 Unclassified 4183
262 Ga0207665_10025277 3300025939 Bacteria 3917
263 Ga0207691_10073301 3300025940 Bacteria 3088
264 Ga0207691_10314959 3300025940 Bacteria 1342
265 Ga0207691_10752648 3300025940 Bacteria 820
266 Ga0207711_10106585 3300025941 Bacteria 2487
267 Ga0207689_10037220 3300025942 Bacteria 4037
268 Ga0207661_11203257 3300025944 Bacteria 697
269 Ga0207679_10649562 3300025945 Bacteria 954
270 Ga0207651_10597470 3300025960 Bacteria 964
271 Ga0207712_10490396 3300025961 Bacteria 1049
272 Ga0207668_10565105 3300025972 Bacteria 987
273 Ga0207640_10429709 3300025981 Bacteria 1083
274 Ga0207677_10759451 3300026023 Bacteria 865
275 Ga0207677_11138461 3300026023 Bacteria 712
276 Ga0207677_11663354 3300026023 Bacteria 591
277 Ga0207703_10201555 3300026035 Bacteria 1769
278 Ga0207703_10321785 3300026035 Bacteria 1416
279 Ga0207703_11133912 3300026035 Bacteria 751
280 Ga0207703_11403413 3300026035 Bacteria 672
281 Ga0207639_10159671 3300026041 Bacteria 1898
282 Ga0207639_10273054 3300026041 Bacteria 1484
283 Ga0207678_10003485 3300026067 Bacteria 14158
284 Ga0207708_10015051 3300026075 Bacteria 5798
285 Ga0207708_10046146 3300026075 Bacteria 3319
286 Ga0207702_10303102 3300026078 Bacteria 1516
287 Ga0207641_10318566 3300026088 Bacteria 1474
288 Ga0207641_12398435 3300026088 Bacteria 526
289 Ga0207648_10080692 3300026089 Bacteria 2838
290 Ga0207648_10995124 3300026089 Bacteria 785
291 Ga0207676_10220003 3300026095 Bacteria 1690
292 Ga0207676_10820286 3300026095 Bacteria 908
293 Ga0207674_10022294 3300026116 Bacteria 6801
294 Ga0207675_100020330 3300026118 Bacteria 6189
295 Ga0207675_102318363 3300026118 Bacteria 550
296 Ga0207683_10043502 3300026121 Bacteria 3925
297 Ga0207683_11292817 3300026121 Bacteria 675
298 Ga0207698_10495915 3300026142 Bacteria 1187
299 Ga0209966_1083708 3300027695 Bacteria 709
300 Ga0207428_10020001 3300027907 Bacteria 5701
301 Ga0207428_10393547 3300027907 Bacteria 1015
302 Ga0268266_10033590 3300028379 Bacteria 4361
303 Ga0268265_11974282 3300028380 Bacteria 590
304 Ga0268264_10410820 3300028381 Bacteria 1303
305 Ga0268264_10515443 3300028381 Bacteria 1168
306 Ga0265762_1031595 3300030760 Bacteria 1007
307 Ga0307408_100630404 3300031548 Bacteria 956
308 Ga0307405_10657940 3300031731 Bacteria 862
309 Ga0307412_10026326 3300031911 Bacteria 3614
310 Ga0307409_100014029 3300031995 Bacteria 5190
311 Ga0307409_101254895 3300031995 Bacteria 765
312 Ga0307416_100020900 3300032002 Bacteria 4684
313 Ga0307414_10407577 3300032004 Bacteria 1182
314 Ga0307415_100007212 3300032126 Bacteria 6065
315 Ga0307415_101112306 3300032126 Bacteria 740
316 Ga0373938_0165877 3300034957 Bacteria 596
317 Ga0373929_0233364 3300035085 Bacteria 528
318 Ga0373934_0005100 3300035086 Bacteria 4869
319 Ga0373944_0004073 3300035089 Bacteria 3790
320 Ga0373923_0069059 3300035111 Bacteria 1514
321 Ga0373936_0010091 3300035113 Bacteria 3567
322 Ga0373945_0036258 3300035116 Bacteria 1766
323 Ga0373953_0001799 3300035117 Bacteria 6338
324 Ga0373956_0019398 3300035119 Bacteria 2883
325 Ga0373957_0003020 3300035120 Bacteria 4889
326 Ga0373955_0018728 3300035172 Bacteria 3449
327 Ga0373924_0023847 3300035410 Bacteria 2405
328 Ga0373935_0030862 3300035692 Bacteria 3322
329 Ga0373927_0120043 3300035695 Bacteria 1716
330 Ga0373933_0057240 3300035724 Bacteria 2342
331 Ga0373947_0173050 3300035725 Bacteria 1402
332 Ga0373937_0009672 3300036401 Bacteria 8398
333 Ga0373925_0142246 3300037068 Bacteria 1878
334 Ga0395899_0220766 3300037312 Bacteria 1313
335 Ga0395900_0057704 3300037418 Bacteria 3997
336 Ga0395901_0667199 3300038443 Bacteria 1041
337 Ga0395901_0729749 3300038443 Bacteria 985
338 Ga0436363_1264474 3300039450 Bacteria 821
339 Ga0439466_0091387 3300041411 Bacteria 954
340 Ga0451793_0892428 3300041452 Bacteria 726
341 Ga0451800_0338843 3300041459 Bacteria 567
342 Ga0451855_1803169 3300041511 Bacteria 516
343 Ga0451853_1196001 3300041512 Bacteria 2734
344 Ga0439451_067772 3300042009 Bacteria 714
345 Ga0439456_140015 3300042013 Unclassified 561
346 Ga0466964_0231457 3300044706 Bacteria 902
347 Ga0466968_0136540 3300044735 Bacteria 1119
348 Ga0466970_0563761 3300044765 Bacteria 659
349 Ga0495592_0017593 3300046454 Bacteria 5433
350 Ga0495603_0128099 3300046455 Bacteria 1479
351 Ga0495629_0020338 3300046459 Bacteria 4741
352 Ga0495641_0059818 3300046461 Bacteria 1722
353 Ga0495651_0161836 3300046462 Bacteria 1602
354 Ga0495653_0119269 3300046463 Bacteria 1883
355 Ga0495582_0192635 3300046473 Bacteria 1163
356 Ga0495662_0017149 3300046476 Bacteria 3506
357 Ga0495664_0036411 3300046477 Bacteria 2900
358 Ga0495585_0408015 3300046492 Bacteria 654
359 Ga0495585_0534472 3300046492 Bacteria 555
360 Ga0495596_0048247 3300046500 Bacteria 1670
361 Ga0495596_0129355 3300046500 Bacteria 980
362 Ga0495608_0022201 3300046511 Bacteria 4349
363 Ga0495616_0183085 3300046513 Bacteria 930
364 Ga0495618_0056182 3300046514 Bacteria 2492
365 Ga0495630_0094983 3300046517 Bacteria 2253
366 Ga0495630_1411911 3300046517 Bacteria 523
367 Ga0495631_0397374 3300046518 Bacteria 587
368 Ga0495644_0254805 3300046523 Bacteria 682
369 Ga0495663_0117847 3300046525 Bacteria 887
370 Ga0495654_0120698 3300046530 Bacteria 1187
371 Ga0495586_0039925 3300046535 Bacteria 2524
372 Ga0495587_0025213 3300046536 Bacteria 3634
373 Ga0495587_0815931 3300046536 Bacteria 509
374 Ga0495633_0330139 3300046558 Unclassified 692
375 Ga0495656_0064909 3300046615 Bacteria 1604
376 Ga0495634_0100561 3300046642 Bacteria 1868
377 Ga0495611_0142571 3300046648 Bacteria 1119
378 Ga0495661_0311219 3300046665 Bacteria 785
379 Ga0495657_0059609 3300046675 Bacteria 2532
380 Ga0495599_0010084 3300046678 Bacteria 5781
381 Ga0495599_0336894 3300046678 Bacteria 906
382 Ga0495623_0268491 3300046679 Bacteria 953
383 Ga0495646_0019588 3300046680 Bacteria 4280
384 Ga0495658_0157616 3300046683 Bacteria 1398
385 Ga0495613_0174662 3300046689 Bacteria 1523
386 Ga0495670_0249209 3300046691 Bacteria 947
387 Ga0495671_0336901 3300046692 Bacteria 724
388 Ga0495600_0174233 3300046809 Bacteria 1387
389 Ga0495581_0049755 3300047315 Bacteria 2420
390 Ga0495604_0012426 3300047317 Bacteria 6770
391 Ga0495604_0737596 3300047317 Unclassified 624
392 Ga0495636_0192901 3300047318 Bacteria 928
393 Ga0495674_0241467 3300047319 Bacteria 1488
394 Ga0495676_0311390 3300047321 Bacteria 1059
395 Ga0495680_0088509 3300047322 Bacteria 2326
396 Ga0495680_0388995 3300047322 Bacteria 965
397 Ga0495675_0012275 3300047444 Bacteria 5392
398 Ga0495685_178263 3300047447 Bacteria 685
399 Ga0495593_0047823 3300047673 Bacteria 2274
400 Ga0495602_0230604 3300048088 Bacteria 1391
401 Ga0495615_0038871 3300048090 Bacteria 1178
402 Ga0496101_0577905 3300048904 Bacteria 889
403 Ga0496102_0564568 3300048905 Bacteria 1061
404 Ga0496104_0060393 3300048907 Bacteria 3591
405 Ga0496105_0020766 3300048908 Bacteria 5309
406 Ga0496105_0593207 3300048908 Bacteria 860
407 Ga0496107_1159146 3300048910 Bacteria 557
408 Ga0496108_0000036 3300048911 Bacteria 152347
409 Ga0496108_0029093 3300048911 Bacteria 4573
410 Ga0496108_1056721 3300048911 Bacteria 691
411 Ga0496109_0121218 3300048912 Bacteria 2437
412 Ga0496109_0713485 3300048912 Bacteria 940
413 Ga0496109_0825561 3300048912 Bacteria 865
414 Ga0496109_1039242 3300048912 Bacteria 757
415 Ga0496109_1048760 3300048912 Bacteria 753
416 Ga0496110_0231831 3300048913 Bacteria 1679
417 Ga0496110_1057212 3300048913 Bacteria 720
418 Ga0496111_0082362 3300048914 Bacteria 2350
419 Ga0496111_0406514 3300048914 Bacteria 1006
420 Ga0496112_0196667 3300048915 Bacteria 1976
421 Ga0496112_0711743 3300048915 Unclassified 932
422 Ga0496114_0159145 3300048917 Bacteria 1962
423 Ga0496114_0676855 3300048917 Bacteria 906
424 Ga0496115_0131488 3300048918 Bacteria 2063
425 Ga0501034_0273226 3300049571 Bacteria 1631
426 Ga0501034_1659677 3300049571 Bacteria 512
427 Ga0501036_0480766 3300049572 Bacteria 1034
428 Ga0501040_0019851 3300049576 Bacteria 4473
429 Ga0501042_0121859 3300049578 Bacteria 1878
430 Ga0501048_1198751 3300049582 Bacteria 546
431 Ga0501068_0428420 3300049584 Bacteria 855
432 Ga0501070_0250663 3300049586 Bacteria 1448
433 Ga0501071_0432706 3300049587 Bacteria 1006
434 Ga0501073_0510521 3300049589 Bacteria 831
435 Ga0501075_1365162 3300049591 Bacteria 537
436 Ga0501076_0176350 3300049592 Bacteria 1742
437 Ga0501076_0565490 3300049592 Bacteria 938
438 Ga0501077_0108510 3300049593 Bacteria 1759
439 Ga0501079_1553519 3300049741 Bacteria 521
440 Ga0501271_062999 3300049768 Bacteria 524
441 Ga0501044_1425359 3300049823 Bacteria 558
442 Ga0501044_1615885 3300049823 Bacteria 513
443 nmdc:mga03683_223481_c1 3300050489 Bacteria 869
444 nmdc:mga00v17_51891_c1 3300050491 Bacteria 2494
445 nmdc:mga05p37_191871_c1 3300050507 Bacteria 2480
446 nmdc:mga05p37_197786_c1 3300050507 Bacteria 2437
447 nmdc:mga05p37_840187_c1 3300050507 Bacteria 999
448 nmdc:mga09592_868409_c1 3300050508 Bacteria 760
449 nmdc:mga06r32_813263_c1 3300050510 Bacteria 894
450 nmdc:mga08y16_61961_c1 3300050511 Bacteria 3906
451 nmdc:mga0n895_221932_c1 3300050512 Bacteria 1919
452 nmdc:mga0n895_60438_c1 3300050512 Bacteria 3739
453 nmdc:mga08x19_1069245_c1 3300050514 Bacteria 573
454 nmdc:mga08x19_258801_c1 3300050514 Bacteria 1203
455 nmdc:mga08x19_614208_c1 3300050514 Bacteria 771
456 nmdc:mga0a205_34782_c1 3300050515 Bacteria 4835
457 nmdc:mga0a205_73632_c1 3300050515 Bacteria 3300
458 Ga0495655_0026522 3300053083 Bacteria 1366
459 Ga0495595_0009069 3300053084 Bacteria 4108
460 Ga0495619_0024458 3300053085 Bacteria 3874
461 Ga0501082_0223715 3300060353 Bacteria 1638
462 Ga0501082_0368566 3300060353 Bacteria 1253
463 Ga0530510_1122057 3300061734 Bacteria 603
464 Ga0395898_0591516
465 JGI24738J21930_10011698
466 JGI24744J21845_10015823
467 JGI24033J26618_1027983
468 JGI24742J22300_10001807
469 JGI24742J22300_10079034
470 JGI25407J50210_10065688
471 Ga0070683_101079304
472 Ga0070690_100181232
473 Ga0070690_100941692
474 Ga0070670_100964421
475 Ga0070670_101154145
476 Ga0070670_102135858
477 Ga0068869_100059988
478 Ga0070680_100173873
479 Ga0070682_100058924
480 Ga0068868_100487907
481 Ga0070660_100605555
482 Ga0070689_100090925
483 Ga0070691_10356871
484 Ga0070687_100105628
485 Ga0070687_100867660
486 Ga0070692_10345238
487 Ga0070668_100183945
488 Ga0070668_102045003
489 Ga0070675_100074976
490 Ga0070671_100044728
491 Ga0070674_100091204
492 Ga0070674_101221406
493 Ga0070673_100493970
494 Ga0070688_100051988
495 Ga0070688_100182448
496 Ga0070688_100227044
497 Ga0070659_101349222
498 Ga0070659_101816185
499 Ga0070709_10031755
500 Ga0070709_10184063
501 Ga0070713_100298096
502 Ga0070713_100608986
503 Ga0070701_10014939
504 Ga0070701_10207077
505 Ga0070711_100014398
506 Ga0070711_101614762
507 Ga0070705_100048808
508 Ga0070700_100050371
509 Ga0070700_101496487
510 Ga0070708_101031059
511 Ga0070663_100056245
512 Ga0070663_100287842
513 Ga0070663_100438767
514 Ga0070678_100089151
515 Ga0070678_100889179
516 Ga0070662_100120682
517 Ga0070662_100928594
518 Ga0070681_11198641
519 Ga0068867_100020871
520 Ga0068867_101046115
521 Ga0070685_10166009
522 Ga0070706_101942478
523 Ga0070707_100251185
524 Ga0070707_101630988
525 Ga0070698_100023165
526 Ga0070698_100346879
527 Ga0070679_100881458
528 Ga0070684_100211480
529 Ga0070684_100520046
530 Ga0070697_102141080
531 Ga0068853_100289430
532 Ga0070672_100190814
533 Ga0070686_100294204
534 Ga0070686_100613427
535 Ga0070686_101463324
536 Ga0070695_100026193
537 Ga0070696_100032827
538 Ga0070693_100429290
539 Ga0070693_100616984
540 Ga0070665_100027133
541 Ga0070665_100117430
542 Ga0070665_100577530
543 Ga0070704_100016151
544 Ga0068855_100445925
545 Ga0068855_100664676
546 Ga0070664_100280574
547 Ga0068857_100661572
548 Ga0068857_101201848
549 Ga0068854_101399855
550 Ga0070702_100135198
551 Ga0070702_100845762
552 Ga0068852_100526698
553 Ga0068852_101107253
554 Ga0068859_100263133
555 Ga0068859_101137323
556 Ga0068859_101626640
557 Ga0068859_102005434
558 Ga0068859_102302809
559 Ga0068864_100008649
560 Ga0068864_100833463
561 Ga0068864_101155759
562 Ga0068866_10275151
563 Ga0068866_10316148
564 Ga0068861_100089866
565 Ga0068861_100361736
566 Ga0068861_100616887
567 Ga0068861_101266742
568 Ga0068861_102410507
569 Ga0068851_10193881
570 Ga0068851_11088677
571 Ga0068870_10016350
572 Ga0068870_10104673
573 Ga0068870_10485580
574 Ga0068863_101147408
575 Ga0068858_100164693
576 Ga0068858_100611047
577 Ga0068858_100752528
578 Ga0068858_101761279
579 Ga0068860_100072099
580 Ga0068860_100338305
581 Ga0068860_100775870
582 Ga0068862_100343810
583 Ga0068862_100353322
584 Ga0068862_101367604
585 Ga0068862_101454004
586 Ga0068862_102102358
587 Ga0081455_10007797
588 Ga0081540_1000527
589 Ga0081540_1136326
590 Ga0081540_1282858
591 Ga0075364_10202832
592 Ga0070715_10344257
593 Ga0070716_100004089
594 Ga0070712_100721724
595 Ga0097621_100581963
596 Ga0068871_100593734
597 Ga0068871_101659343
598 Ga0068871_102407686
599 Ga0075428_100000612
600 Ga0075428_100034640
601 Ga0075428_100124582
602 Ga0075430_100049019
603 Ga0075430_100087297
604 Ga0075431_100028839
605 Ga0075431_100867337
606 Ga0075431_100951807
607 Ga0075433_10187260
608 Ga0075433_10802377
609 Ga0075434_100027084
610 Ga0075434_100041369
611 Ga0075434_100090292
612 Ga0075434_100964574
613 Ga0075429_100084167
614 Ga0075429_100532678
615 Ga0075429_101059003
616 Ga0068865_100572195
617 Ga0075436_100310018
618 Ga0075436_100768936
619 Ga0097620_100263107
620 Ga0097620_100899666
621 Ga0097620_101137327
622 Ga0097620_101626688
623 Ga0097620_102006089
624 Ga0097620_102302529
625 Ga0075435_100041565
626 Ga0111539_10021223
627 Ga0111539_10097887
628 Ga0111539_10423312
629 Ga0111539_10963104
630 Ga0111539_12723503
631 Ga0105245_10776617
632 Ga0105245_11735476
633 Ga0105247_10606018
634 Ga0114129_10000091
635 Ga0114129_10033589
636 Ga0114129_10402700
637 Ga0114129_10854825
638 Ga0114129_11063331
639 Ga0105243_10270024
640 Ga0105243_10728996
641 Ga0105241_11225254
642 Ga0105242_10552074
643 Ga0105242_12000776
644 Ga0105242_12040581
645 Ga0105248_10079258
646 Ga0105237_10879513
647 Ga0105238_11145533
648 Ga0105249_10114254
649 Ga0105249_10202641
650 Ga0105239_10375809
651 Ga0105239_12650622
652 Ga0105246_10500483
653 Ga0157369_10361492
654 Ga0157369_10764395
655 Ga0157374_11130885
656 Ga0157374_11176387
657 Ga0157378_11160325
658 Ga0163162_10824447
659 Ga0163162_11301247
660 Ga0163162_12464607
661 Ga0157372_10754326
662 Ga0157372_11607079
663 Ga0157375_10180505
664 Ga0157375_10923556
665 Ga0157375_11223145
666 Ga0157375_11642762
667 Ga0163163_10002849
668 Ga0163163_10027996
669 Ga0163163_12044067
670 Ga0157380_10020557
671 Ga0157380_12132846
672 Ga0157380_12865596
673 Ga0157377_10206848
674 Ga0157377_11009303
675 Ga0157379_10018092
676 Ga0157379_11217859
677 Ga0157379_11628530
678 Ga0157379_11786893
679 Ga0157376_10185039
680 Ga0157376_10866706
681 Ga0163161_10034101
682 Ga0224572_1000948
683 Ga0207656_10145119
684 Ga0207688_10004459
685 Ga0207688_10279278
686 Ga0207680_10153709
687 Ga0207680_10603017
688 Ga0207680_10870708
689 Ga0207647_10038914
690 Ga0207699_10019740
691 Ga0207699_10254184
692 Ga0207699_11192796
693 Ga0207645_10061030
694 Ga0207643_10234779
695 Ga0207643_10638462
696 Ga0207643_11133801
697 Ga0207654_10016336
698 Ga0207654_10400450
699 Ga0207707_11048104
700 Ga0207707_11107702
701 Ga0207695_11367606
702 Ga0207671_10790642
703 Ga0207662_10064940
704 Ga0207662_10071877
705 Ga0207652_10096335
706 Ga0207646_10000013
707 Ga0207646_10043438
708 Ga0207646_10139906
709 Ga0207646_10390187
710 Ga0207646_10771887
711 Ga0207681_10195745
712 Ga0207659_10010437
713 Ga0207659_10834657
714 Ga0207687_10105537
715 Ga0207687_10155578
716 Ga0207687_10522313
717 Ga0207690_10957071
718 Ga0207706_10052081
719 Ga0207686_10498089
720 Ga0207709_10038903
721 Ga0207709_10304229
722 Ga0207670_10435691
723 Ga0207669_10013923
724 Ga0207665_10022096
725 Ga0207665_10025277
726 Ga0207691_10073301
727 Ga0207691_10314959
728 Ga0207691_10752648
729 Ga0207711_10106585
730 Ga0207689_10037220
731 Ga0207661_11203257
732 Ga0207679_10649562
733 Ga0207651_10597470
734 Ga0207712_10490396
735 Ga0207668_10565105
736 Ga0207640_10429709
737 Ga0207677_10759451
738 Ga0207677_11138461
739 Ga0207677_11663354
740 Ga0207703_10201555
741 Ga0207703_10321785
742 Ga0207703_11133912
743 Ga0207703_11403413
744 Ga0207639_10159671
745 Ga0207639_10273054
746 Ga0207678_10003485
747 Ga0207708_10015051
748 Ga0207708_10046146
749 Ga0207702_10303102
750 Ga0207641_10318566
751 Ga0207641_12398435
752 Ga0207648_10080692
753 Ga0207648_10995124
754 Ga0207676_10220003
755 Ga0207676_10820286
756 Ga0207674_10022294
757 Ga0207675_100020330
758 Ga0207675_102318363
759 Ga0207683_10043502
760 Ga0207683_11292817
761 Ga0207698_10495915
762 Ga0209966_1083708
763 Ga0207428_10020001
764 Ga0207428_10393547
765 Ga0268266_10033590
766 Ga0268265_11974282
767 Ga0268264_10410820
768 Ga0268264_10515443
769 Ga0265762_1031595
770 Ga0307408_100630404
771 Ga0307405_10657940
772 Ga0307412_10026326
773 Ga0307409_100014029
774 Ga0307409_101254895
775 Ga0307416_100020900
776 Ga0307414_10407577
777 Ga0307415_100007212
778 Ga0307415_101112306
779 Ga0373938_0165877
780 Ga0373929_0233364
781 Ga0373934_0005100
782 Ga0373944_0004073
783 Ga0373923_0069059
784 Ga0373936_0010091
785 Ga0373945_0036258
786 Ga0373953_0001799
787 Ga0373956_0019398
788 Ga0373957_0003020
789 Ga0373955_0018728
790 Ga0373924_0023847
791 Ga0373935_0030862
792 Ga0373927_0120043
793 Ga0373933_0057240
794 Ga0373947_0173050
795 Ga0373937_0009672
796 Ga0373925_0142246
797 Ga0395899_0220766
798 Ga0395900_0057704
799 Ga0395901_0667199
800 Ga0395901_0729749
801 Ga0436363_1264474
802 Ga0439466_0091387
803 Ga0451793_0892428
804 Ga0451800_0338843
805 Ga0451855_1803169
806 Ga0451853_1196001
807 Ga0439451_067772
808 Ga0439456_140015
809 Ga0466964_0231457
810 Ga0466968_0136540
811 Ga0466970_0563761
812 Ga0495592_0017593
813 Ga0495603_0128099
814 Ga0495629_0020338
815 Ga0495641_0059818
816 Ga0495651_0161836
817 Ga0495653_0119269
818 Ga0495582_0192635
819 Ga0495662_0017149
820 Ga0495664_0036411
821 Ga0495585_0408015
822 Ga0495585_0534472
823 Ga0495596_0048247
824 Ga0495596_0129355
825 Ga0495608_0022201
826 Ga0495616_0183085
827 Ga0495618_0056182
828 Ga0495630_0094983
829 Ga0495630_1411911
830 Ga0495631_0397374
831 Ga0495644_0254805
832 Ga0495663_0117847
833 Ga0495654_0120698
834 Ga0495586_0039925
835 Ga0495587_0025213
836 Ga0495587_0815931
837 Ga0495633_0330139
838 Ga0495656_0064909
839 Ga0495634_0100561
840 Ga0495611_0142571
841 Ga0495661_0311219
842 Ga0495657_0059609
843 Ga0495599_0010084
844 Ga0495599_0336894
845 Ga0495623_0268491
846 Ga0495646_0019588
847 Ga0495658_0157616
848 Ga0495613_0174662
849 Ga0495670_0249209
850 Ga0495671_0336901
851 Ga0495600_0174233
852 Ga0495581_0049755
853 Ga0495604_0012426
854 Ga0495604_0737596
855 Ga0495636_0192901
856 Ga0495674_0241467
857 Ga0495676_0311390
858 Ga0495680_0088509
859 Ga0495680_0388995
860 Ga0495675_0012275
861 Ga0495685_178263
862 Ga0495593_0047823
863 Ga0495602_0230604
864 Ga0495615_0038871
865 Ga0496101_0577905
866 Ga0496102_0564568
867 Ga0496104_0060393
868 Ga0496105_0020766
869 Ga0496105_0593207
870 Ga0496107_1159146
871 Ga0496108_0000036
872 Ga0496108_0029093
873 Ga0496108_1056721
874 Ga0496109_0121218
875 Ga0496109_0713485
876 Ga0496109_0825561
877 Ga0496109_1039242
878 Ga0496109_1048760
879 Ga0496110_0231831
880 Ga0496110_1057212
881 Ga0496111_0082362
882 Ga0496111_0406514
883 Ga0496112_0196667
884 Ga0496112_0711743
885 Ga0496114_0159145
886 Ga0496114_0676855
887 Ga0496115_0131488
888 Ga0501034_0273226
889 Ga0501034_1659677
890 Ga0501036_0480766
891 Ga0501040_0019851
892 Ga0501042_0121859
893 Ga0501048_1198751
894 Ga0501068_0428420
895 Ga0501070_0250663
896 Ga0501071_0432706
897 Ga0501073_0510521
898 Ga0501075_1365162
899 Ga0501076_0176350
900 Ga0501076_0565490
901 Ga0501077_0108510
902 Ga0501079_1553519
903 Ga0501271_062999
904 Ga0501044_1425359
905 Ga0501044_1615885
906 nmdc:mga03683_223481_c1
907 nmdc:mga00v17_51891_c1
908 nmdc:mga05p37_191871_c1
909 nmdc:mga05p37_197786_c1
910 nmdc:mga05p37_840187_c1
911 nmdc:mga09592_868409_c1
912 nmdc:mga06r32_813263_c1
913 nmdc:mga08y16_61961_c1
914 nmdc:mga0n895_221932_c1
915 nmdc:mga0n895_60438_c1
916 nmdc:mga08x19_1069245_c1
917 nmdc:mga08x19_258801_c1
918 nmdc:mga08x19_614208_c1
919 nmdc:mga0a205_34782_c1
920 nmdc:mga0a205_73632_c1
921 Ga0495655_0026522
922 Ga0495595_0009069
923 Ga0495619_0024458
924 Ga0501082_0223715
925 Ga0501082_0368566
926 Ga0530510_1122057

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04237

YjbR

YjbR

36

124

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.8339 11 115
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.7263 11 115
6r82-assembly2.cif.gz_B crystal structure of the tldc domain of skywalker/tbc1d24 from drosophila melanogaster 0.7012 28 58
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.6903 12 119
7mi4-assembly1.cif.gz_B symmetrical pam-pam prespacer bound cas4/cas1/cas2 complex 0.6865 25 47
ID Description Score Start End Superfamily
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8339 11 115 3.90.1150.30
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8181 15 118 3.30.70.1230
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7837 15 120 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7833 12 119 3.90.1150.30
4n06B01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2;CRISPR-associated endonuclease Cas1, N-terminal domain 0.7797 26 47 3.100.10.20
ID Description Score Start End GO Terms
AF-A0A1A3SLZ5-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9961 12 121
AF-A0A7W0HUI6-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9892 12 119
AF-A0A372JQG1-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9876 12 119 GO:0003677
AF-A0A3A0ARM9-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.987 12 119
AF-A0A5D0P3M8-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9869 12 119 GO:0003677

Map