F449128

General Info

Members Datasets Scaffolds Average Seq Length
463 240 378 247

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10059733|Ga0307515_100597331
Length 265
Sequence VRGNLTDGAVGYAFHLVTEFNRAPRLTLLPAVDVADGKAVRLTQGEAGSETSYGDPIEAAANWANQGAEWIHLVDLDAAFGRGNNHAVIKKVIKNTPRKVNIELSGGIRDDESLEAALSTGAKRINLGTAALENPEWAAHVIAEYGDAIAVGLDVRGTTLAARGWTQDGGDLWTVLERLEAAGCSRYVVTDVTKDGTLKGPNLELLAEVCSRTDRPVIASGGIADLDDIAELRELVPQGLEGAIVGKALYAGAFTLAEALDVASV

Samples

Sample ID Description Type Environment
1 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
2 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
3 2643221546 Microbacterium sp. Root53 Isolate Unclassified
4 2643221549 Agromyces sp. Root1464 Isolate Unclassified
5 2643221553 Microbacterium sp. Root553 Isolate Unclassified
6 2643221566 Microbacterium sp. Root166 Isolate Unclassified
7 2643221575 Microbacterium sp. Root61 Isolate Unclassified
8 2643221597 Microbacterium sp. Root180 Isolate Unclassified
9 2643221616 Leifsonia sp. Root227 Isolate Unclassified
10 2643221619 Agromyces sp. Root81 Isolate Unclassified
11 2643221630 Microbacterium sp. Root322 Isolate Unclassified
12 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
13 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
14 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
15 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
16 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
17 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
18 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
19 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
20 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
21 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
22 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
23 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
24 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
25 2808606372 Agromyces sp. 23-23 Isolate Unclassified
26 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
27 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
28 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
29 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
30 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
31 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
32 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
33 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
34 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
35 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
36 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
37 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
38 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
39 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
40 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
41 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
42 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
43 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
44 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
45 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
46 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
47 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
48 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
49 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
50 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
51 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
52 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
53 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
54 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
55 2919069694 Microbacterium sp. 1154 Isolate Unclassified
56 2919395869 Microbacterium resistens 2980 Isolate Unclassified
57 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
58 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
59 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
60 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
61 2928153084 Leifsonia sp. 563 Isolate Unclassified
62 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
63 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
64 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
65 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
66 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
67 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
68 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
69 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
70 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
71 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
72 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
73 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
74 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
75 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
76 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
77 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
78 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
79 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
80 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
81 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
82 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
83 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
84 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
85 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
86 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
87 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
88 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
89 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
90 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
91 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
92 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
93 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
94 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
97 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
98 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
101 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
121 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
124 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
137 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
145 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
151 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
165 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
168 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
169 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
170 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
219 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
220 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
221 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
222 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
223 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
224 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
228 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
229 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
234 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
235 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
236 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
237 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
238 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
239 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
240 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.56
Metatranscriptomes 1.08
Isolates 18.36

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 15.33
Nodule 0
Rhizoplane 5.4
Rhizosphere 50.11
Stem 0
Stem Tuber 0.22
Unclassified 28.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001577 3300001979 Bacteria 10469
2 JGI25154J39366_1000828 3300002738 Bacteria 13428
3 JGI25164J39214_1000620 3300002772 Bacteria 15088
4 JGI25165J46597_1000004 3300003214 Bacteria 667510
5 Ga0006562J51391_1106503 3300003578 Bacteria 9350
6 Ga0006562J51391_1106506 3300003578 Bacteria 6320
7 Ga0006562J51391_1175917 3300003578 Bacteria 8784
8 Ga0006562J51391_1175918 3300003578 Bacteria 8784
9 Ga0055539_1000005 3300003752 Bacteria 609598
10 Ga0055533_1000001 3300003756 Bacteria 1863437
11 Ga0055525_1000237 3300003759 Bacteria 57574
12 Ga0055527_1000001 3300003760 Bacteria 850044
13 Ga0055529_1000019 3300003763 Bacteria 332786
14 Ga0055541_1002324 3300003841 Bacteria 3828
15 Ga0070668_100000654 3300005347 Bacteria 23449
16 Ga0070659_100149342 3300005366 Bacteria 1906
17 Ga0070710_10018169 3300005437 Bacteria 3613
18 Ga0070663_100000249 3300005455 Bacteria 27248
19 Ga0070663_100318953 3300005455 Bacteria 1249
20 Ga0070665_100545518 3300005548 Bacteria 1171
21 Ga0068861_100028136 3300005719 Bacteria 4101
22 Ga0075365_10004167 3300006038 Bacteria 7610
23 Ga0075365_10079723 3300006038 Bacteria 2216
24 Ga0075365_10126226 3300006038 Bacteria 1768
25 Ga0075365_10300752 3300006038 Bacteria 1129
26 Ga0075368_10207868 3300006042 Bacteria 829
27 Ga0075364_10008890 3300006051 Bacteria 6017
28 Ga0075364_10020414 3300006051 Bacteria 4166
29 Ga0075364_10026521 3300006051 Bacteria 3697
30 Ga0075364_10035873 3300006051 Bacteria 3205
31 Ga0075364_10413418 3300006051 Bacteria 921
32 Ga0075367_10004065 3300006178 Bacteria 7078
33 Ga0075367_10320280 3300006178 Bacteria 977
34 Ga0075369_10005242 3300006186 Bacteria 4832
35 Ga0105244_10014442 3300009036 Bacteria 4565
36 Ga0105244_10041324 3300009036 Bacteria 2390
37 Ga0105244_10216536 3300009036 Bacteria 899
38 Ga0111539_10531350 3300009094 Bacteria 1370
39 Ga0105243_10010890 3300009148 Bacteria 6880
40 Ga0105243_10478282 3300009148 Bacteria 1175
41 Ga0157370_10068448 3300013104 Bacteria 3355
42 Ga0157369_10001248 3300013105 Bacteria 31691
43 Ga0157369_10072084 3300013105 Bacteria 3708
44 Ga0157369_10129588 3300013105 Bacteria 2674
45 Ga0157369_10487599 3300013105 Bacteria 1275
46 Ga0157369_10922095 3300013105 Bacteria 895
47 Ga0171462_1001 3300013250 Bacteria 1135406
48 Ga0163162_10545821 3300013306 Bacteria 1287
49 Ga0157372_10672439 3300013307 Bacteria 1205
50 Ga0157380_10693724 3300014326 Bacteria 1022
51 Ga0157380_10737284 3300014326 Bacteria 995
52 Ga0163161_10227068 3300017792 Bacteria 1448
53 Ga0163161_10467893 3300017792 Bacteria 1022
54 Ga0206353_11639430 3300020082 Bacteria 6954
55 Ga0209566_100105 3300025225 Bacteria 125766
56 Ga0209674_100001 3300025226 Bacteria 4013750
57 Ga0209672_100006 3300025228 Bacteria 1004497
58 Ga0209147_100854 3300025229 Bacteria 14264
59 Ga0209563_100001 3300025230 Bacteria 4013775
60 Ga0207427_100010 3300025231 Bacteria 648610
61 Ga0209437_101360 3300025233 Bacteria 6308
62 Ga0209258_101278 3300025242 Bacteria 9455
63 Ga0209646_1000013 3300025246 Bacteria 565830
64 Ga0209677_100001 3300025253 Bacteria 4013787
65 Ga0209677_108322 3300025253 Bacteria 2029
66 Ga0209148_1000015 3300025254 Bacteria 850103
67 Ga0209233_1000001 3300025261 Bacteria 2992747
68 Ga0209455_1000013 3300025272 Bacteria 850103
69 Ga0209455_1000928 3300025272 Bacteria 15084
70 Ga0207655_1004214 3300025728 Bacteria 10305
71 Ga0207655_1028318 3300025728 Bacteria 2645
72 Ga0207655_1060498 3300025728 Bacteria 1468
73 Ga0207692_10207506 3300025898 Bacteria 1155
74 Ga0207647_10018369 3300025904 Bacteria 4733
75 Ga0207664_10013133 3300025929 Bacteria 5939
76 Ga0207690_10133570 3300025932 Bacteria 1819
77 Ga0207709_10003288 3300025935 Bacteria 9699
78 Ga0207668_10174890 3300025972 Bacteria 1688
79 Ga0207658_10018383 3300025986 Bacteria 4827
80 Ga0207678_10000065 3300026067 Bacteria 83028
81 Ga0207678_10399392 3300026067 Bacteria 1190
82 Ga0268266_10148907 3300028379 Bacteria 2108
83 Ga0307515_10059733 3300028794 Bacteria 5457
84 Ga0307515_10138279 3300028794 Bacteria 2631
85 Ga0307512_10096752 3300030522 Bacteria 2023
86 Ga0316576_10112732 3300031727 Bacteria 2039
87 Ga0307405_10062282 3300031731 Bacteria 2362
88 Ga0307413_10056723 3300031824 Bacteria 2391
89 Ga0307406_10000213 3300031901 Bacteria 34975
90 Ga0307406_10000509 3300031901 Bacteria 22369
91 Ga0307406_10005107 3300031901 Bacteria 7161
92 Ga0307406_10134035 3300031901 Bacteria 1743
93 Ga0307406_10179062 3300031901 Bacteria 1542
94 Ga0307406_10184409 3300031901 Bacteria 1522
95 Ga0307406_10428881 3300031901 Bacteria 1055
96 Ga0307406_10635437 3300031901 Bacteria 884
97 Ga0307412_10025994 3300031911 Bacteria 3634
98 Ga0307416_100680287 3300032002 Bacteria 1116
99 Ga0307415_100464053 3300032126 Bacteria 1098
100 Ga0316574_0011550 3300035398 Bacteria 5023
101 Ga0316584_0285584 3300036712 Bacteria 1198
102 Ga0395899_0001103 3300037312 Bacteria 24193
103 Ga0395899_0049816 3300037312 Bacteria 3112
104 Ga0395900_0023407 3300037418 Bacteria 6323
105 Ga0395900_0154864 3300037418 Bacteria 2341
106 Ga0395898_0000015 3300037466 Bacteria 439819
107 Ga0395898_0044738 3300037466 Bacteria 4355
108 Ga0395898_0049048 3300037466 Bacteria 4138
109 Ga0395901_0132943 3300038443 Bacteria 2615
110 Ga0451793_0428684 3300041452 Bacteria 820
111 Ga0451793_0851508 3300041452 Bacteria 2309
112 Ga0451793_1135981 3300041452 Bacteria 1440
113 Ga0451837_0575325 3300041494 Bacteria 852
114 Ga0466972_0003105 3300044658 Bacteria 8240
115 Ga0466972_0027024 3300044658 Bacteria 2841
116 Ga0466972_0039731 3300044658 Bacteria 2295
117 Ga0466965_0000002 3300044683 Bacteria 297957
118 Ga0466965_0015433 3300044683 Bacteria 3629
119 Ga0466965_0020486 3300044683 Bacteria 3179
120 Ga0466965_0041750 3300044683 Bacteria 2260
121 Ga0466965_0102617 3300044683 Bacteria 1464
122 Ga0466965_0197495 3300044683 Bacteria 1066
123 Ga0466966_0115617 3300044684 Bacteria 1651
124 Ga0466961_0069490 3300044693 Bacteria 2236
125 Ga0466961_0125495 3300044693 Bacteria 1610
126 Ga0466971_0014183 3300044719 Bacteria 3504
127 Ga0466968_0053422 3300044735 Bacteria 1730
128 Ga0466968_0125598 3300044735 Bacteria 1164
129 Ga0466970_0000017 3300044765 Bacteria 64907
130 Ga0466970_0011275 3300044765 Bacteria 4554
131 Ga0466970_0020017 3300044765 Bacteria 3472
132 Ga0466970_0023084 3300044765 Bacteria 3247
133 Ga0466970_0032051 3300044765 Bacteria 2776
134 Ga0466970_0035683 3300044765 Bacteria 2634
135 Ga0466970_0053658 3300044765 Bacteria 2153
136 Ga0466970_0054846 3300044765 Bacteria 2128
137 Ga0466970_0132213 3300044765 Bacteria 1371
138 Ga0466970_0136952 3300044765 Bacteria 1347
139 Ga0466957_0039892 3300044842 Bacteria 2834
140 Ga0466957_0171164 3300044842 Bacteria 1415
141 Ga0466960_0057764 3300044901 Bacteria 1893
142 Ga0466959_0124837 3300045049 Bacteria 1827
143 Ga0466959_0147279 3300045049 Bacteria 1661
144 Ga0466959_0219020 3300045049 Bacteria 1321
145 Ga0466959_0540387 3300045049 Bacteria 786
146 Ga0466958_0286239 3300045836 Bacteria 1057
147 Ga0466967_0032541 3300045976 Bacteria 4404
148 Ga0466967_0259694 3300045976 Bacteria 1662
149 Ga0495627_012915 3300046453 Bacteria 2948
150 Ga0495590_0000183 3300046457 Bacteria 36526
151 Ga0495650_0112283 3300046471 Bacteria 1011
152 Ga0495631_0084608 3300046518 Bacteria 1367
153 Ga0495644_0086986 3300046523 Bacteria 1178
154 Ga0495609_0134898 3300046538 Bacteria 1056
155 Ga0495621_0113074 3300046539 Bacteria 1043
156 Ga0496100_0127375 3300048903 Bacteria 1789
157 Ga0496101_0147391 3300048904 Bacteria 1798
158 Ga0496101_0315221 3300048904 Bacteria 1227
159 Ga0496102_0297683 3300048905 Bacteria 1521
160 Ga0496104_0098885 3300048907 Bacteria 2793
161 Ga0496104_0251855 3300048907 Bacteria 1679
162 Ga0496105_0072215 3300048908 Bacteria 2852
163 Ga0496105_0112283 3300048908 Bacteria 2249
164 Ga0496105_0120150 3300048908 Bacteria 2167
165 Ga0496109_0084400 3300048912 Bacteria 2930
166 Ga0496111_0057428 3300048914 Bacteria 2818
167 Ga0496111_0516425 3300048914 Bacteria 879
168 Ga0496113_0111285 3300048916 Bacteria 2132
169 Ga0496114_0033419 3300048917 Bacteria 4238
170 Ga0496114_0173709 3300048917 Bacteria 1879
171 Ga0496114_0182310 3300048917 Bacteria 1834
172 Ga0496114_0202547 3300048917 Bacteria 1739
173 Ga0496114_0252385 3300048917 Bacteria 1552
174 Ga0496114_0261604 3300048917 Bacteria 1523
175 Ga0496115_0093637 3300048918 Bacteria 2457
176 Ga0496115_0103147 3300048918 Bacteria 2339
177 Ga0496115_0458365 3300048918 Bacteria 1029
178 Ga0496116_0120959 3300048919 Bacteria 1515
179 Ga0496117_0000028 3300048920 Bacteria 407392
180 Ga0496117_0001238 3300048920 Bacteria 38206
181 Ga0496117_0002355 3300048920 Bacteria 24155
182 Ga0496117_0002931 3300048920 Bacteria 20647
183 Ga0496117_0006826 3300048920 Bacteria 11363
184 Ga0496117_0017818 3300048920 Bacteria 5919
185 Ga0496117_0025083 3300048920 Bacteria 4695
186 Ga0496117_0047832 3300048920 Bacteria 3062
187 Ga0496117_0060812 3300048920 Bacteria 2600
188 Ga0496117_0069973 3300048920 Bacteria 2360
189 Ga0496117_0126460 3300048920 Bacteria 1559
190 Ga0496117_0268867 3300048920 Bacteria 919
191 Ga0496118_0000149 3300048921 Bacteria 123317
192 Ga0496118_0009971 3300048921 Bacteria 9486
193 Ga0496118_0013519 3300048921 Bacteria 7712
194 Ga0496118_0013711 3300048921 Bacteria 7647
195 Ga0496118_0038535 3300048921 Bacteria 3828
196 Ga0496118_0098457 3300048921 Bacteria 1986
197 Ga0496119_0002490 3300048922 Bacteria 20129
198 Ga0496119_0006823 3300048922 Bacteria 10468
199 Ga0496119_0011987 3300048922 Bacteria 7099
200 Ga0496119_0015108 3300048922 Bacteria 5975
201 Ga0496119_0019797 3300048922 Bacteria 4935
202 Ga0496119_0033780 3300048922 Bacteria 3384
203 Ga0496119_0052975 3300048922 Bacteria 2482
204 Ga0496119_0147311 3300048922 Bacteria 1265
205 Ga0496119_0197807 3300048922 Bacteria 1042
206 Ga0496119_0263972 3300048922 Bacteria 863
207 Ga0496120_0000553 3300048923 Bacteria 56978
208 Ga0496120_0000809 3300048923 Bacteria 44906
209 Ga0496120_0002169 3300048923 Bacteria 20844
210 Ga0496120_0028722 3300048923 Bacteria 3404
211 Ga0496121_0000277 3300048924 Bacteria 107014
212 Ga0496121_0024521 3300048924 Bacteria 5765
213 Ga0496122_0000036 3300048925 Bacteria 312598
214 Ga0496122_0000055 3300048925 Bacteria 258485
215 Ga0496122_0002530 3300048925 Bacteria 25739
216 Ga0496122_0012349 3300048925 Bacteria 8523
217 Ga0496122_0017586 3300048925 Bacteria 6672
218 Ga0496122_0059043 3300048925 Bacteria 2834
219 Ga0496122_0061337 3300048925 Bacteria 2761
220 Ga0496122_0073563 3300048925 Bacteria 2422
221 Ga0496122_0132419 3300048925 Bacteria 1581
222 Ga0496123_0000003 3300048926 Bacteria 866556
223 Ga0496123_0000011 3300048926 Bacteria 493925
224 Ga0496123_0002201 3300048926 Bacteria 24786
225 Ga0496123_0006381 3300048926 Bacteria 11443
226 Ga0496123_0016558 3300048926 Bacteria 5978
227 Ga0496123_0022170 3300048926 Bacteria 4905
228 Ga0496123_0194450 3300048926 Bacteria 1046
229 Ga0496124_0003142 3300048927 Bacteria 20440
230 Ga0496124_0003169 3300048927 Bacteria 20336
231 Ga0496124_0003796 3300048927 Bacteria 18150
232 Ga0496124_0010149 3300048927 Bacteria 9583
233 Ga0496124_0025041 3300048927 Bacteria 5411
234 Ga0496124_0044534 3300048927 Bacteria 3807
235 Ga0496124_0095398 3300048927 Bacteria 2418
236 Ga0496124_0204182 3300048927 Bacteria 1500
237 Ga0496125_0000473 3300048928 Bacteria 71177
238 Ga0496125_0001414 3300048928 Bacteria 35032
239 Ga0496125_0003322 3300048928 Bacteria 19662
240 Ga0496125_0006023 3300048928 Bacteria 13265
241 Ga0496125_0007780 3300048928 Bacteria 11338
242 Ga0496125_0032231 3300048928 Bacteria 4657
243 Ga0496125_0054853 3300048928 Bacteria 3254
244 Ga0496125_0200409 3300048928 Bacteria 1307
245 Ga0496125_0204211 3300048928 Bacteria 1290
246 Ga0496126_0003639 3300048929 Bacteria 19260
247 Ga0496126_0007023 3300048929 Bacteria 12421
248 Ga0496126_0010550 3300048929 Bacteria 9667
249 Ga0496126_0019741 3300048929 Bacteria 6632
250 Ga0496126_0042568 3300048929 Bacteria 4194
251 Ga0496126_0128492 3300048929 Bacteria 2191
252 Ga0496126_0217570 3300048929 Bacteria 1606
253 Ga0501031_0029883 3300049568 Bacteria 3554
254 Ga0501032_0059844 3300049569 Bacteria 2555
255 Ga0501032_0096078 3300049569 Bacteria 1964
256 Ga0501032_0203587 3300049569 Bacteria 1291
257 Ga0501033_0010214 3300049570 Bacteria 7208
258 Ga0501033_0015199 3300049570 Bacteria 5842
259 Ga0501033_0022405 3300049570 Bacteria 4765
260 Ga0501033_0143989 3300049570 Bacteria 1722
261 Ga0501033_0430619 3300049570 Bacteria 918
262 Ga0501034_0000699 3300049571 Bacteria 50906
263 Ga0501034_0005600 3300049571 Bacteria 13679
264 Ga0501034_0010917 3300049571 Bacteria 9436
265 Ga0501034_0032570 3300049571 Bacteria 5292
266 Ga0501034_0032981 3300049571 Bacteria 5258
267 Ga0501034_0079856 3300049571 Bacteria 3275
268 Ga0501034_0104108 3300049571 Bacteria 2831
269 Ga0501034_0107252 3300049571 Bacteria 2785
270 Ga0501034_0108460 3300049571 Bacteria 2768
271 Ga0501034_0118651 3300049571 Bacteria 2632
272 Ga0501034_0140557 3300049571 Bacteria 2394
273 Ga0501034_0143769 3300049571 Bacteria 2363
274 Ga0501036_0042309 3300049572 Bacteria 3857
275 Ga0501036_0148896 3300049572 Bacteria 1974
276 Ga0501036_0186145 3300049572 Bacteria 1747
277 Ga0501037_0097226 3300049573 Bacteria 2127
278 Ga0501037_0271390 3300049573 Bacteria 1183
279 Ga0501038_0021753 3300049574 Bacteria 5755
280 Ga0501038_0083236 3300049574 Bacteria 2693
281 Ga0501038_0094493 3300049574 Bacteria 2499
282 Ga0501039_0016460 3300049575 Bacteria 5664
283 Ga0501039_0033838 3300049575 Bacteria 3943
284 Ga0501039_0172397 3300049575 Bacteria 1701
285 Ga0501039_0172939 3300049575 Bacteria 1698
286 Ga0501039_0290419 3300049575 Bacteria 1285
287 Ga0501042_0003829 3300049578 Bacteria 9514
288 Ga0501043_0022996 3300049579 Bacteria 4888
289 Ga0501043_0035485 3300049579 Bacteria 3922
290 Ga0501043_0082923 3300049579 Bacteria 2520
291 Ga0501043_0084109 3300049579 Bacteria 2501
292 Ga0501043_0239993 3300049579 Bacteria 1398
293 Ga0501046_0006653 3300049580 Bacteria 10206
294 Ga0501046_0041935 3300049580 Bacteria 3649
295 Ga0501047_0000018 3300049581 Bacteria 274180
296 Ga0501047_0014678 3300049581 Bacteria 7454
297 Ga0501047_0087772 3300049581 Bacteria 2988
298 Ga0501047_0105685 3300049581 Bacteria 2695
299 Ga0501047_0202860 3300049581 Bacteria 1843
300 Ga0501047_0330879 3300049581 Bacteria 1362
301 Ga0501068_0136618 3300049584 Bacteria 1535
302 Ga0501068_0174087 3300049584 Bacteria 1359
303 Ga0501070_0000150 3300049586 Bacteria 64208
304 Ga0501070_0001815 3300049586 Bacteria 18803
305 Ga0501070_0005356 3300049586 Bacteria 10946
306 Ga0501070_0019809 3300049586 Bacteria 5641
307 Ga0501070_0025075 3300049586 Bacteria 5000
308 Ga0501070_0035763 3300049586 Bacteria 4148
309 Ga0501070_0040339 3300049586 Bacteria 3893
310 Ga0501070_0154781 3300049586 Bacteria 1891
311 Ga0501071_0000061 3300049587 Bacteria 37719
312 Ga0501071_0337920 3300049587 Bacteria 1145
313 Ga0501072_0169500 3300049588 Bacteria 1742
314 Ga0501072_0260998 3300049588 Bacteria 1379
315 Ga0501073_0000024 3300049589 Bacteria 128851
316 Ga0501073_0077982 3300049589 Bacteria 2305
317 Ga0501073_0159365 3300049589 Bacteria 1564
318 Ga0501073_0286138 3300049589 Bacteria 1137
319 Ga0501074_0223805 3300049590 Bacteria 1339
320 Ga0501080_0000058 3300049742 Bacteria 72664
321 Ga0501080_0056542 3300049742 Bacteria 3653
322 Ga0501083_0000056 3300049744 Bacteria 82115
323 Ga0501083_0006666 3300049744 Bacteria 8191
324 Ga0501083_0039348 3300049744 Bacteria 3212
325 Ga0501035_0019411 3300049822 Bacteria 6252
326 Ga0501035_0050407 3300049822 Bacteria 3731
327 Ga0501035_0053302 3300049822 Bacteria 3618
328 Ga0501035_0165806 3300049822 Bacteria 1910
329 Ga0501035_0280039 3300049822 Bacteria 1409
330 Ga0501035_0316279 3300049822 Bacteria 1312
331 Ga0501044_0005435 3300049823 Bacteria 14154
332 Ga0501044_0015675 3300049823 Bacteria 8162
333 Ga0501044_0131499 3300049823 Bacteria 2496
334 Ga0501044_0375530 3300049823 Bacteria 1337
335 Ga0501044_0387625 3300049823 Bacteria 1311
336 Ga0501044_0711604 3300049823 Bacteria 889
337 Ga0501045_0162409 3300049824 Bacteria 1663
338 nmdc:mga03n38_127055_c1 3300050490 Bacteria 1259
339 nmdc:mga00v17_128995_c1 3300050491 Bacteria 1615
340 nmdc:mga00v17_33519_c1 3300050491 Bacteria 3043
341 nmdc:mga0yw44_138077_c1 3300050492 Bacteria 1582
342 nmdc:mga0yw44_180378_c1 3300050492 Bacteria 1390
343 nmdc:mga0yw44_21477_c1 3300050492 Bacteria 3601
344 nmdc:mga0yw44_40546_c1 3300050492 Bacteria 2767
345 nmdc:mga0yw44_59711_c1 3300050492 Bacteria 2334
346 nmdc:mga0sz30_19925_c1 3300050516 Bacteria 2701
347 Ga0500635_0000039 3300053080 Bacteria 93004
348 Ga0500650_0002152 3300053098 Bacteria 6375
349 Ga0500556_0000062 3300053104 Bacteria 110818
350 Ga0500556_0001014 3300053104 Bacteria 14754
351 Ga0500562_000346 3300053108 Bacteria 11134
352 Ga0500562_087924 3300053108 Bacteria 843
353 Ga0500593_000363 3300053117 Bacteria 18295
354 Ga0500655_001024 3300053133 Bacteria 5398
355 Ga0500559_0000496 3300053136 Bacteria 27644
356 Ga0500559_0001158 3300053136 Bacteria 15884
357 Ga0500559_0038610 3300053136 Bacteria 2074
358 Ga0500568_0000060 3300053139 Bacteria 107901
359 Ga0500568_0000075 3300053139 Bacteria 94413
360 Ga0500568_0000151 3300053139 Bacteria 60575
361 Ga0500568_0003966 3300053139 Bacteria 8048
362 Ga0500568_0019144 3300053139 Bacteria 2981
363 Ga0500573_0006182 3300053140 Bacteria 6456
364 Ga0500573_0031312 3300053140 Bacteria 3070
365 Ga0500573_0044916 3300053140 Bacteria 2547
366 Ga0500573_0065572 3300053140 Bacteria 2076
367 Ga0500573_0141644 3300053140 Bacteria 1323
368 Ga0500577_0030923 3300053142 Bacteria 1868
369 Ga0500588_0049157 3300053146 Bacteria 1307
370 Ga0500616_0000071 3300053153 Bacteria 232527
371 Ga0500616_0000781 3300053153 Bacteria 36581
372 Ga0500616_0001401 3300053153 Bacteria 23221
373 Ga0500616_0031943 3300053153 Bacteria 2880
374 Ga0501084_0190913 3300054114 Bacteria 1728
375 Ga0501082_0060608 3300060353 Bacteria 3258
376 Ga0501082_0378903 3300060353 Bacteria 1234
377 Ga0501082_0702187 3300060353 Bacteria 885
378 Ga0466962_0026411 3300061719 Bacteria 2788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_10545821 Ga0163162_105458212 225
2 3300045049 Ga0466959_0540387 Ga0466959_0540387_54_755 227
3 iso_pu_bacteria 8003314358 8003322291 230
4 3300048904 Ga0496101_0147391 Ga0496101_0147391_541_1260 232
5 iso_pu_bacteria 8056060235 8056061989 232
6 3300005347 Ga0070668_100000654 Ga0070668_1000006544 233
7 3300005455 Ga0070663_100000249 Ga0070663_1000002496 233
8 3300026067 Ga0207678_10000065 Ga0207678_1000006529 233
9 3300030522 Ga0307512_10096752 Ga0307512_100967522 233
10 3300044658 Ga0466972_0003105 Ga0466972_0003105_3341_4078 233
11 3300044765 Ga0466970_0136952 Ga0466970_0136952_389_1126 233
12 iso_pu_bacteria 2654587600 2655032029 234
13 iso_pu_bacteria 2870804320 2870804988 235
14 iso_pu_bacteria 2919051321 2919053200 235
15 iso_pu_bacteria 2990088156 2990089688 235
16 3300031727 Ga0316576_10112732 Ga0316576_101127322 236
17 3300035398 Ga0316574_0011550 Ga0316574_0011550_4102_4833 236
18 3300036712 Ga0316584_0285584 Ga0316584_0285584_117_848 236
19 3300048922 Ga0496119_0147311 Ga0496119_0147311_11_745 236
20 3300048926 Ga0496123_0194450 Ga0496123_0194450_177_908 236
21 3300049579 Ga0501043_0239993 Ga0501043_0239993_249_980 236
22 3300049581 Ga0501047_0000018 Ga0501047_0000018_204440_205171 236
23 iso_pu_bacteria 2946024296 2946025269 236
24 3300014326 Ga0157380_10737284 Ga0157380_107372841 237
25 3300025972 Ga0207668_10174890 Ga0207668_101748903 237
26 3300044693 Ga0466961_0069490 Ga0466961_0069490_463_1194 237
27 3300045049 Ga0466959_0147279 Ga0466959_0147279_790_1521 237
28 3300048914 Ga0496111_0516425 Ga0496111_0516425_36_776 237
29 3300048917 Ga0496114_0202547 Ga0496114_0202547_610_1347 237
30 3300048920 Ga0496117_0069973 Ga0496117_0069973_1023_1766 237
31 3300048924 Ga0496121_0000277 Ga0496121_0000277_81585_82328 237
32 3300048924 Ga0496121_0024521 Ga0496121_0024521_5010_5753 237
33 iso_pu_bacteria 2811994880 2812365440 237
34 iso_pu_bacteria 2966924647 2966927664 237
35 3300003760 Ga0055527_1000001 Ga0055527_1000001630 238
36 3300003763 Ga0055529_1000019 Ga0055529_1000019136 238
37 3300025228 Ga0209672_100006 Ga0209672_100006345 238
38 3300025229 Ga0209147_100854 Ga0209147_10085410 238
39 3300025242 Ga0209258_101278 Ga0209258_1012782 238
40 3300025254 Ga0209148_1000015 Ga0209148_1000015189 238
41 3300025272 Ga0209455_1000013 Ga0209455_1000013189 238
42 3300031911 Ga0307412_10025994 Ga0307412_100259945 238
43 3300045976 Ga0466967_0032541 Ga0466967_0032541_3203_3949 238
44 iso_pu_bacteria 2585428157 2588106557 238
45 iso_pu_bacteria 2643221542 2643735115 238
46 iso_pu_bacteria 2643221546 2643754217 238
47 iso_pu_bacteria 2643221549 2643769314 238
48 iso_pu_bacteria 2643221553 2643786765 238
49 iso_pu_bacteria 2643221566 2643849583 238
50 iso_pu_bacteria 2643221575 2643888732 238
51 iso_pu_bacteria 2643221597 2643996189 238
52 iso_pu_bacteria 2643221616 2644097007 238
53 iso_pu_bacteria 2643221619 2644113931 238
54 iso_pu_bacteria 2643221630 2644173277 238
55 iso_pu_bacteria 2643221632 2644183877 238
56 iso_pu_bacteria 2643221635 2644198567 238
57 iso_pu_bacteria 2643221724 2644681438 238
58 iso_pu_bacteria 2721755702 2723642606 238
59 iso_pu_bacteria 2728369380 2730230124 238
60 iso_pu_bacteria 2747842429 2747953831 238
61 iso_pu_bacteria 2751185788 2753301417 238
62 iso_pu_bacteria 2757320536 2758224218 238
63 iso_pu_bacteria 2773857758 2774381506 238
64 iso_pu_bacteria 2773857763 2774399976 238
65 iso_pu_bacteria 2808606306 2808631560 238
66 iso_pu_bacteria 2808606368 2808885257 238
67 iso_pu_bacteria 2808606372 2808902577 238
68 iso_pu_bacteria 2808606447 2809227033 238
69 iso_pu_bacteria 2811994872 2812322654 238
70 iso_pu_bacteria 2821268502 2821269576 238
71 iso_pu_bacteria 2833709550 2833710489 238
72 iso_pu_bacteria 2844841374 2844842821 238
73 iso_pu_bacteria 2844852863 2844854895 238
74 iso_pu_bacteria 2852632344 2852633581 238
75 iso_pu_bacteria 2852646457 2852649604 238
76 iso_pu_bacteria 2852663356 2852665569 238
77 iso_pu_bacteria 2857720070 2857720434 238
78 iso_pu_bacteria 2857723135 2857725071 238
79 iso_pu_bacteria 2857733635 2857735433 238
80 iso_pu_bacteria 2862993130 2862993284 238
81 iso_pu_bacteria 2870622029 2870623211 238
82 iso_pu_bacteria 2870628048 2870629917 238
83 iso_pu_bacteria 2884763398 2884765797 238
84 iso_pu_bacteria 2897561785 2897564731 238
85 iso_pu_bacteria 2904430863 2904433362 238
86 iso_pu_bacteria 2904501621 2904503769 238
87 iso_pu_bacteria 2904509784 2904509808 238
88 iso_pu_bacteria 2908674828 2908675409 238
89 iso_pu_bacteria 2908678064 2908678976 238
90 iso_pu_bacteria 2909074476 2909077663 238
91 iso_pu_bacteria 2919039151 2919041992 238
92 iso_pu_bacteria 2919042368 2919045044 238
93 iso_pu_bacteria 2919055335 2919059062 238
94 iso_pu_bacteria 2919069694 2919071324 238
95 iso_pu_bacteria 2919395869 2919395892 238
96 iso_pu_bacteria 2919443155 2919443184 238
97 iso_pu_bacteria 2919523602 2919524906 238
98 iso_pu_bacteria 2928104781 2928108381 238
99 iso_pu_bacteria 2928153084 2928156902 238
100 iso_pu_bacteria 2928500415 2928501434 238
101 iso_pu_bacteria 2935409751 2935413231 238
102 iso_pu_bacteria 2939657138 2939657607 238
103 iso_pu_bacteria 2945968032 2945968311 238
104 iso_pu_bacteria 2946041624 2946044771 238
105 iso_pu_bacteria 2946080515 2946084605 238
106 iso_pu_bacteria 2966921586 2966923897 238
107 iso_pu_bacteria 2974294766 2974297833 238
108 iso_pu_bacteria 2974324384 2974325932 238
109 iso_pu_bacteria 2977228692 2977230880 238
110 iso_pu_bacteria 2977236895 2977239678 238
111 iso_pu_bacteria 2977264416 2977266108 238
112 iso_pu_bacteria 2984542743 2984546050 238
113 iso_pu_bacteria 8004182704 8004185659 238
114 iso_pu_bacteria 8004212874 8004214504 238
115 iso_pu_bacteria 8045830549 8045831261 238
116 iso_pu_bacteria 8056037122 8056038835 238
117 iso_pu_bacteria 8057345674 8057349542 238
118 3300006038 Ga0075365_10300752 Ga0075365_103007521 239
119 3300037312 Ga0395899_0049816 Ga0395899_0049816_2305_3045 239
120 3300037466 Ga0395898_0049048 Ga0395898_0049048_584_1324 239
121 3300048929 Ga0496126_0019741 Ga0496126_0019741_2471_3223 239
122 3300049568 Ga0501031_0029883 Ga0501031_0029883_1436_2173 239
123 3300049569 Ga0501032_0203587 Ga0501032_0203587_24_761 239
124 3300049570 Ga0501033_0015199 Ga0501033_0015199_3677_4414 239
125 3300049570 Ga0501033_0143989 Ga0501033_0143989_777_1514 239
126 3300049571 Ga0501034_0108460 Ga0501034_0108460_1878_2621 239
127 3300049572 Ga0501036_0042309 Ga0501036_0042309_427_1164 239
128 3300049572 Ga0501036_0148896 Ga0501036_0148896_32_769 239
129 3300049573 Ga0501037_0271390 Ga0501037_0271390_431_1168 239
130 3300049574 Ga0501038_0083236 Ga0501038_0083236_529_1266 239
131 3300049575 Ga0501039_0016460 Ga0501039_0016460_3500_4237 239
132 3300049575 Ga0501039_0290419 Ga0501039_0290419_80_817 239
133 3300049579 Ga0501043_0082923 Ga0501043_0082923_431_1168 239
134 3300049580 Ga0501046_0041935 Ga0501046_0041935_1809_2546 239
135 3300049581 Ga0501047_0105685 Ga0501047_0105685_1428_2165 239
136 3300049586 Ga0501070_0019809 Ga0501070_0019809_4078_4815 239
137 3300049590 Ga0501074_0223805 Ga0501074_0223805_237_974 239
138 3300049822 Ga0501035_0165806 Ga0501035_0165806_462_1199 239
139 3300049822 Ga0501035_0280039 Ga0501035_0280039_14_751 239
140 3300049822 Ga0501035_0316279 Ga0501035_0316279_562_1299 239
141 3300049823 Ga0501044_0131499 Ga0501044_0131499_662_1399 239
142 3300049823 Ga0501044_0375530 Ga0501044_0375530_170_907 239
143 3300049823 Ga0501044_0387625 Ga0501044_0387625_144_881 239
144 3300049824 Ga0501045_0162409 Ga0501045_0162409_496_1233 239
145 3300053136 Ga0500559_0038610 Ga0500559_0038610_553_1299 239
146 3300013307 Ga0157372_10672439 Ga0157372_106724391 240
147 3300037466 Ga0395898_0044738 Ga0395898_0044738_17_763 240
148 3300044765 Ga0466970_0000017 Ga0466970_0000017_40114_40860 240
149 3300044842 Ga0466957_0171164 Ga0466957_0171164_629_1399 240
150 3300045976 Ga0466967_0259694 Ga0466967_0259694_162_908 240
151 3300049570 Ga0501033_0430619 Ga0501033_0430619_28_768 240
152 3300001979 JGI24740J21852_10001577 JGI24740J21852_100015773 242
153 3300002738 JGI25154J39366_1000828 JGI25154J39366_100082810 242
154 3300002772 JGI25164J39214_1000620 JGI25164J39214_10006209 242
155 3300003214 JGI25165J46597_1000004 JGI25165J46597_1000004345 242
156 3300003578 Ga0006562J51391_1106503 Ga0006562J51391_11065037 242
157 3300003578 Ga0006562J51391_1106506 Ga0006562J51391_11065066 242
158 3300003578 Ga0006562J51391_1175917 Ga0006562J51391_11759178 242
159 3300003578 Ga0006562J51391_1175918 Ga0006562J51391_11759184 242
160 3300003752 Ga0055539_1000005 Ga0055539_100000586 242
161 3300003756 Ga0055533_1000001 Ga0055533_10000011155 242
162 3300003759 Ga0055525_1000237 Ga0055525_100023710 242
163 3300003841 Ga0055541_1002324 Ga0055541_10023242 242
164 3300005366 Ga0070659_100149342 Ga0070659_1001493422 242
165 3300005437 Ga0070710_10018169 Ga0070710_100181693 242
166 3300005455 Ga0070663_100318953 Ga0070663_1003189531 242
167 3300005548 Ga0070665_100545518 Ga0070665_1005455182 242
168 3300005719 Ga0068861_100028136 Ga0068861_1000281364 242
169 3300006038 Ga0075365_10004167 Ga0075365_100041674 242
170 3300006038 Ga0075365_10079723 Ga0075365_100797231 242
171 3300006038 Ga0075365_10126226 Ga0075365_101262262 242
172 3300006042 Ga0075368_10207868 Ga0075368_102078681 242
173 3300006051 Ga0075364_10008890 Ga0075364_100088907 242
174 3300006051 Ga0075364_10020414 Ga0075364_100204141 242
175 3300006051 Ga0075364_10026521 Ga0075364_100265213 242
176 3300006051 Ga0075364_10035873 Ga0075364_100358732 242
177 3300006051 Ga0075364_10413418 Ga0075364_104134181 242
178 3300006178 Ga0075367_10004065 Ga0075367_100040652 242
179 3300006178 Ga0075367_10320280 Ga0075367_103202801 242
180 3300006186 Ga0075369_10005242 Ga0075369_100052424 242
181 3300009036 Ga0105244_10014442 Ga0105244_100144422 242
182 3300009036 Ga0105244_10041324 Ga0105244_100413243 242
183 3300009036 Ga0105244_10216536 Ga0105244_102165361 242
184 3300009094 Ga0111539_10531350 Ga0111539_105313502 242
185 3300009148 Ga0105243_10010890 Ga0105243_100108902 242
186 3300009148 Ga0105243_10478282 Ga0105243_104782822 242
187 3300013104 Ga0157370_10068448 Ga0157370_100684483 242
188 3300013105 Ga0157369_10001248 Ga0157369_1000124811 242
189 3300013105 Ga0157369_10072084 Ga0157369_100720842 242
190 3300013105 Ga0157369_10129588 Ga0157369_101295884 242
191 3300013105 Ga0157369_10487599 Ga0157369_104875992 242
192 3300013105 Ga0157369_10922095 Ga0157369_109220952 242
193 3300013250 Ga0171462_1001 Ga0171462_100132 242
194 3300014326 Ga0157380_10693724 Ga0157380_106937242 242
195 3300017792 Ga0163161_10227068 Ga0163161_102270682 242
196 3300017792 Ga0163161_10467893 Ga0163161_104678932 242
197 3300020082 Ga0206353_11639430 Ga0206353_116394304 242
198 3300025225 Ga0209566_100105 Ga0209566_10010546 242
199 3300025226 Ga0209674_100001 Ga0209674_1000011155 242
200 3300025230 Ga0209563_100001 Ga0209563_1000011155 242
201 3300025231 Ga0207427_100010 Ga0207427_100010236 242
202 3300025233 Ga0209437_101360 Ga0209437_1013605 242
203 3300025246 Ga0209646_1000013 Ga0209646_1000013531 242
204 3300025253 Ga0209677_100001 Ga0209677_1000011155 242
205 3300025253 Ga0209677_108322 Ga0209677_1083223 242
206 3300025261 Ga0209233_1000001 Ga0209233_10000011713 242
207 3300025272 Ga0209455_1000928 Ga0209455_10009287 242
208 3300025728 Ga0207655_1004214 Ga0207655_10042143 242
209 3300025728 Ga0207655_1028318 Ga0207655_10283183 242
210 3300025728 Ga0207655_1060498 Ga0207655_10604982 242
211 3300025898 Ga0207692_10207506 Ga0207692_102075062 242
212 3300025904 Ga0207647_10018369 Ga0207647_100183692 242
213 3300025929 Ga0207664_10013133 Ga0207664_100131334 242
214 3300025932 Ga0207690_10133570 Ga0207690_101335702 242
215 3300025935 Ga0207709_10003288 Ga0207709_100032882 242
216 3300025986 Ga0207658_10018383 Ga0207658_100183833 242
217 3300026067 Ga0207678_10399392 Ga0207678_103993921 242
218 3300028379 Ga0268266_10148907 Ga0268266_101489073 242
219 3300028794 Ga0307515_10059733 Ga0307515_100597331 242
220 3300028794 Ga0307515_10138279 Ga0307515_101382792 242
221 3300031731 Ga0307405_10062282 Ga0307405_100622823 242
222 3300031824 Ga0307413_10056723 Ga0307413_100567233 242
223 3300031901 Ga0307406_10000213 Ga0307406_1000021341 242
224 3300031901 Ga0307406_10000509 Ga0307406_100005098 242
225 3300031901 Ga0307406_10005107 Ga0307406_100051078 242
226 3300031901 Ga0307406_10134035 Ga0307406_101340352 242
227 3300031901 Ga0307406_10179062 Ga0307406_101790622 242
228 3300031901 Ga0307406_10184409 Ga0307406_101844092 242
229 3300031901 Ga0307406_10428881 Ga0307406_104288812 242
230 3300031901 Ga0307406_10635437 Ga0307406_106354372 242
231 3300032002 Ga0307416_100680287 Ga0307416_1006802872 242
232 3300032126 Ga0307415_100464053 Ga0307415_1004640532 242
233 3300037312 Ga0395899_0001103 Ga0395899_0001103_7852_8598 242
234 3300037418 Ga0395900_0023407 Ga0395900_0023407_4210_4956 242
235 3300037418 Ga0395900_0154864 Ga0395900_0154864_1259_2005 242
236 3300037466 Ga0395898_0000015 Ga0395898_0000015_200681_201427 242
237 3300038443 Ga0395901_0132943 Ga0395901_0132943_778_1524 242
238 3300041452 Ga0451793_0428684 Ga0451793_0428684_14_760 242
239 3300041452 Ga0451793_0851508 Ga0451793_0851508_716_1465 242
240 3300041452 Ga0451793_1135981 Ga0451793_1135981_398_1147 242
241 3300041494 Ga0451837_0575325 Ga0451837_0575325_92_838 242
242 3300044658 Ga0466972_0027024 Ga0466972_0027024_710_1456 242
243 3300044658 Ga0466972_0039731 Ga0466972_0039731_1460_2206 242
244 3300044683 Ga0466965_0000002 Ga0466965_0000002_32234_32983 242
245 3300044683 Ga0466965_0015433 Ga0466965_0015433_1328_2074 242
246 3300044683 Ga0466965_0020486 Ga0466965_0020486_421_1167 242
247 3300044683 Ga0466965_0041750 Ga0466965_0041750_904_1650 242
248 3300044683 Ga0466965_0102617 Ga0466965_0102617_327_1076 242
249 3300044683 Ga0466965_0197495 Ga0466965_0197495_147_893 242
250 3300044684 Ga0466966_0115617 Ga0466966_0115617_101_847 242
251 3300044693 Ga0466961_0125495 Ga0466961_0125495_711_1457 242
252 3300044719 Ga0466971_0014183 Ga0466971_0014183_1779_2525 242
253 3300044735 Ga0466968_0053422 Ga0466968_0053422_45_791 242
254 3300044735 Ga0466968_0125598 Ga0466968_0125598_209_955 242
255 3300044765 Ga0466970_0011275 Ga0466970_0011275_2761_3507 242
256 3300044765 Ga0466970_0020017 Ga0466970_0020017_242_988 242
257 3300044765 Ga0466970_0023084 Ga0466970_0023084_1885_2631 242
258 3300044765 Ga0466970_0032051 Ga0466970_0032051_1979_2725 242
259 3300044765 Ga0466970_0035683 Ga0466970_0035683_722_1468 242
260 3300044765 Ga0466970_0053658 Ga0466970_0053658_240_986 242
261 3300044765 Ga0466970_0054846 Ga0466970_0054846_588_1334 242
262 3300044765 Ga0466970_0132213 Ga0466970_0132213_203_949 242
263 3300044842 Ga0466957_0039892 Ga0466957_0039892_1378_2124 242
264 3300044901 Ga0466960_0057764 Ga0466960_0057764_690_1436 242
265 3300045049 Ga0466959_0124837 Ga0466959_0124837_154_900 242
266 3300045049 Ga0466959_0219020 Ga0466959_0219020_193_939 242
267 3300045836 Ga0466958_0286239 Ga0466958_0286239_173_925 242
268 3300046453 Ga0495627_012915 Ga0495627_012915_904_1650 242
269 3300046457 Ga0495590_0000183 Ga0495590_0000183_6103_6852 242
270 3300046471 Ga0495650_0112283 Ga0495650_0112283_46_792 242
271 3300046518 Ga0495631_0084608 Ga0495631_0084608_394_1140 242
272 3300046523 Ga0495644_0086986 Ga0495644_0086986_140_889 242
273 3300046538 Ga0495609_0134898 Ga0495609_0134898_255_1001 242
274 3300046539 Ga0495621_0113074 Ga0495621_0113074_19_765 242
275 3300048903 Ga0496100_0127375 Ga0496100_0127375_577_1368 242
276 3300048904 Ga0496101_0315221 Ga0496101_0315221_378_1124 242
277 3300048905 Ga0496102_0297683 Ga0496102_0297683_714_1460 242
278 3300048907 Ga0496104_0098885 Ga0496104_0098885_636_1382 242
279 3300048907 Ga0496104_0251855 Ga0496104_0251855_272_1063 242
280 3300048908 Ga0496105_0072215 Ga0496105_0072215_903_1649 242
281 3300048908 Ga0496105_0112283 Ga0496105_0112283_169_915 242
282 3300048908 Ga0496105_0120150 Ga0496105_0120150_1274_2047 242
283 3300048912 Ga0496109_0084400 Ga0496109_0084400_1265_2011 242
284 3300048914 Ga0496111_0057428 Ga0496111_0057428_1923_2669 242
285 3300048916 Ga0496113_0111285 Ga0496113_0111285_939_1685 242
286 3300048917 Ga0496114_0033419 Ga0496114_0033419_3002_3748 242
287 3300048917 Ga0496114_0173709 Ga0496114_0173709_1050_1796 242
288 3300048917 Ga0496114_0182310 Ga0496114_0182310_16_762 242
289 3300048917 Ga0496114_0252385 Ga0496114_0252385_77_823 242
290 3300048917 Ga0496114_0261604 Ga0496114_0261604_292_1038 242
291 3300048918 Ga0496115_0093637 Ga0496115_0093637_1152_1898 242
292 3300048918 Ga0496115_0103147 Ga0496115_0103147_699_1490 242
293 3300048918 Ga0496115_0458365 Ga0496115_0458365_184_930 242
294 3300048919 Ga0496116_0120959 Ga0496116_0120959_511_1257 242
295 3300048920 Ga0496117_0000028 Ga0496117_0000028_383578_384324 242
296 3300048920 Ga0496117_0001238 Ga0496117_0001238_28053_28799 242
297 3300048920 Ga0496117_0002355 Ga0496117_0002355_22700_23446 242
298 3300048920 Ga0496117_0002931 Ga0496117_0002931_12456_13202 242
299 3300048920 Ga0496117_0006826 Ga0496117_0006826_2580_3326 242
300 3300048920 Ga0496117_0017818 Ga0496117_0017818_4458_5204 242
301 3300048920 Ga0496117_0025083 Ga0496117_0025083_367_1113 242
302 3300048920 Ga0496117_0047832 Ga0496117_0047832_353_1099 242
303 3300048920 Ga0496117_0060812 Ga0496117_0060812_279_1025 242
304 3300048920 Ga0496117_0126460 Ga0496117_0126460_242_988 242
305 3300048920 Ga0496117_0268867 Ga0496117_0268867_51_797 242
306 3300048921 Ga0496118_0000149 Ga0496118_0000149_97274_98020 242
307 3300048921 Ga0496118_0009971 Ga0496118_0009971_5331_6077 242
308 3300048921 Ga0496118_0013519 Ga0496118_0013519_278_1024 242
309 3300048921 Ga0496118_0013711 Ga0496118_0013711_6181_6927 242
310 3300048921 Ga0496118_0038535 Ga0496118_0038535_2039_2785 242
311 3300048921 Ga0496118_0098457 Ga0496118_0098457_398_1144 242
312 3300048922 Ga0496119_0002490 Ga0496119_0002490_15074_15820 242
313 3300048922 Ga0496119_0006823 Ga0496119_0006823_5432_6196 242
314 3300048922 Ga0496119_0011987 Ga0496119_0011987_2557_3303 242
315 3300048922 Ga0496119_0015108 Ga0496119_0015108_828_1574 242
316 3300048922 Ga0496119_0019797 Ga0496119_0019797_176_922 242
317 3300048922 Ga0496119_0033780 Ga0496119_0033780_765_1511 242
318 3300048922 Ga0496119_0052975 Ga0496119_0052975_470_1219 242
319 3300048922 Ga0496119_0197807 Ga0496119_0197807_23_769 242
320 3300048922 Ga0496119_0263972 Ga0496119_0263972_97_843 242
321 3300048923 Ga0496120_0000553 Ga0496120_0000553_10669_11415 242
322 3300048923 Ga0496120_0000809 Ga0496120_0000809_42144_42890 242
323 3300048923 Ga0496120_0002169 Ga0496120_0002169_18161_18907 242
324 3300048923 Ga0496120_0028722 Ga0496120_0028722_868_1614 242
325 3300048925 Ga0496122_0000036 Ga0496122_0000036_26677_27423 242
326 3300048925 Ga0496122_0000055 Ga0496122_0000055_208498_209244 242
327 3300048925 Ga0496122_0002530 Ga0496122_0002530_16080_16829 242
328 3300048925 Ga0496122_0012349 Ga0496122_0012349_5262_6011 242
329 3300048925 Ga0496122_0017586 Ga0496122_0017586_3569_4315 242
330 3300048925 Ga0496122_0059043 Ga0496122_0059043_1053_1799 242
331 3300048925 Ga0496122_0061337 Ga0496122_0061337_796_1542 242
332 3300048925 Ga0496122_0073563 Ga0496122_0073563_509_1255 242
333 3300048925 Ga0496122_0132419 Ga0496122_0132419_47_793 242
334 3300048926 Ga0496123_0000003 Ga0496123_0000003_825323_826069 242
335 3300048926 Ga0496123_0000011 Ga0496123_0000011_26753_27499 242
336 3300048926 Ga0496123_0002201 Ga0496123_0002201_19951_20700 242
337 3300048926 Ga0496123_0006381 Ga0496123_0006381_10372_11118 242
338 3300048926 Ga0496123_0016558 Ga0496123_0016558_817_1563 242
339 3300048926 Ga0496123_0022170 Ga0496123_0022170_3840_4586 242
340 3300048927 Ga0496124_0003142 Ga0496124_0003142_12520_13266 242
341 3300048927 Ga0496124_0003169 Ga0496124_0003169_3686_4432 242
342 3300048927 Ga0496124_0003796 Ga0496124_0003796_5892_6638 242
343 3300048927 Ga0496124_0010149 Ga0496124_0010149_1684_2430 242
344 3300048927 Ga0496124_0025041 Ga0496124_0025041_2428_3174 242
345 3300048927 Ga0496124_0044534 Ga0496124_0044534_1500_2282 242
346 3300048927 Ga0496124_0095398 Ga0496124_0095398_861_1607 242
347 3300048927 Ga0496124_0204182 Ga0496124_0204182_517_1263 242
348 3300048928 Ga0496125_0000473 Ga0496125_0000473_34124_34870 242
349 3300048928 Ga0496125_0001414 Ga0496125_0001414_4509_5255 242
350 3300048928 Ga0496125_0003322 Ga0496125_0003322_8617_9363 242
351 3300048928 Ga0496125_0006023 Ga0496125_0006023_12352_13098 242
352 3300048928 Ga0496125_0007780 Ga0496125_0007780_246_995 242
353 3300048928 Ga0496125_0032231 Ga0496125_0032231_1659_2405 242
354 3300048928 Ga0496125_0054853 Ga0496125_0054853_311_1057 242
355 3300048928 Ga0496125_0200409 Ga0496125_0200409_37_783 242
356 3300048928 Ga0496125_0204211 Ga0496125_0204211_95_841 242
357 3300048929 Ga0496126_0003639 Ga0496126_0003639_14411_15157 242
358 3300048929 Ga0496126_0007023 Ga0496126_0007023_11253_11999 242
359 3300048929 Ga0496126_0010550 Ga0496126_0010550_762_1508 242
360 3300048929 Ga0496126_0042568 Ga0496126_0042568_507_1256 242
361 3300048929 Ga0496126_0128492 Ga0496126_0128492_962_1708 242
362 3300048929 Ga0496126_0217570 Ga0496126_0217570_405_1151 242
363 3300049569 Ga0501032_0059844 Ga0501032_0059844_1291_2040 242
364 3300049569 Ga0501032_0096078 Ga0501032_0096078_243_992 242
365 3300049570 Ga0501033_0010214 Ga0501033_0010214_770_1519 242
366 3300049570 Ga0501033_0022405 Ga0501033_0022405_2476_3222 242
367 3300049571 Ga0501034_0000699 Ga0501034_0000699_28448_29194 242
368 3300049571 Ga0501034_0005600 Ga0501034_0005600_2956_3705 242
369 3300049571 Ga0501034_0010917 Ga0501034_0010917_6606_7352 242
370 3300049571 Ga0501034_0032570 Ga0501034_0032570_82_831 242
371 3300049571 Ga0501034_0032981 Ga0501034_0032981_2745_3494 242
372 3300049571 Ga0501034_0079856 Ga0501034_0079856_1004_1753 242
373 3300049571 Ga0501034_0104108 Ga0501034_0104108_506_1255 242
374 3300049571 Ga0501034_0107252 Ga0501034_0107252_1074_1820 242
375 3300049571 Ga0501034_0118651 Ga0501034_0118651_685_1434 242
376 3300049571 Ga0501034_0140557 Ga0501034_0140557_664_1413 242
377 3300049571 Ga0501034_0143769 Ga0501034_0143769_1274_2023 242
378 3300049572 Ga0501036_0186145 Ga0501036_0186145_338_1087 242
379 3300049573 Ga0501037_0097226 Ga0501037_0097226_827_1576 242
380 3300049574 Ga0501038_0021753 Ga0501038_0021753_1878_2627 242
381 3300049574 Ga0501038_0094493 Ga0501038_0094493_752_1501 242
382 3300049575 Ga0501039_0033838 Ga0501039_0033838_1650_2399 242
383 3300049575 Ga0501039_0172397 Ga0501039_0172397_41_790 242
384 3300049575 Ga0501039_0172939 Ga0501039_0172939_162_908 242
385 3300049578 Ga0501042_0003829 Ga0501042_0003829_2926_3672 242
386 3300049579 Ga0501043_0022996 Ga0501043_0022996_1286_2032 242
387 3300049579 Ga0501043_0035485 Ga0501043_0035485_1967_2716 242
388 3300049579 Ga0501043_0084109 Ga0501043_0084109_513_1259 242
389 3300049580 Ga0501046_0006653 Ga0501046_0006653_6020_6766 242
390 3300049581 Ga0501047_0014678 Ga0501047_0014678_3716_4462 242
391 3300049581 Ga0501047_0087772 Ga0501047_0087772_1056_1805 242
392 3300049581 Ga0501047_0202860 Ga0501047_0202860_660_1409 242
393 3300049581 Ga0501047_0330879 Ga0501047_0330879_287_1033 242
394 3300049584 Ga0501068_0136618 Ga0501068_0136618_397_1146 242
395 3300049584 Ga0501068_0174087 Ga0501068_0174087_257_1006 242
396 3300049586 Ga0501070_0000150 Ga0501070_0000150_11680_12426 242
397 3300049586 Ga0501070_0001815 Ga0501070_0001815_6963_7709 242
398 3300049586 Ga0501070_0005356 Ga0501070_0005356_4948_5697 242
399 3300049586 Ga0501070_0025075 Ga0501070_0025075_3062_3811 242
400 3300049586 Ga0501070_0035763 Ga0501070_0035763_2104_2850 242
401 3300049586 Ga0501070_0040339 Ga0501070_0040339_1892_2638 242
402 3300049586 Ga0501070_0154781 Ga0501070_0154781_85_834 242
403 3300049587 Ga0501071_0000061 Ga0501071_0000061_26391_27137 242
404 3300049587 Ga0501071_0337920 Ga0501071_0337920_144_893 242
405 3300049588 Ga0501072_0169500 Ga0501072_0169500_87_836 242
406 3300049588 Ga0501072_0260998 Ga0501072_0260998_413_1162 242
407 3300049589 Ga0501073_0000024 Ga0501073_0000024_31139_31888 242
408 3300049589 Ga0501073_0077982 Ga0501073_0077982_1399_2148 242
409 3300049589 Ga0501073_0159365 Ga0501073_0159365_243_992 242
410 3300049589 Ga0501073_0286138 Ga0501073_0286138_123_872 242
411 3300049742 Ga0501080_0000058 Ga0501080_0000058_7785_8534 242
412 3300049742 Ga0501080_0056542 Ga0501080_0056542_897_1646 242
413 3300049744 Ga0501083_0000056 Ga0501083_0000056_59355_60101 242
414 3300049744 Ga0501083_0006666 Ga0501083_0006666_6258_7007 242
415 3300049744 Ga0501083_0039348 Ga0501083_0039348_2017_2763 242
416 3300049822 Ga0501035_0019411 Ga0501035_0019411_1486_2232 242
417 3300049822 Ga0501035_0050407 Ga0501035_0050407_2004_2750 242
418 3300049822 Ga0501035_0053302 Ga0501035_0053302_838_1584 242
419 3300049823 Ga0501044_0005435 Ga0501044_0005435_3304_4050 242
420 3300049823 Ga0501044_0015675 Ga0501044_0015675_1611_2357 242
421 3300049823 Ga0501044_0711604 Ga0501044_0711604_53_802 242
422 3300050490 nmdc:mga03n38_127055_c1 nmdc:mga03n38_127055_c1_211_957 242
423 3300050491 nmdc:mga00v17_128995_c1 nmdc:mga00v17_128995_c1_418_1212 242
424 3300050491 nmdc:mga00v17_33519_c1 nmdc:mga00v17_33519_c1_1685_2434 242
425 3300050492 nmdc:mga0yw44_138077_c1 nmdc:mga0yw44_138077_c1_445_1194 242
426 3300050492 nmdc:mga0yw44_180378_c1 nmdc:mga0yw44_180378_c1_208_954 242
427 3300050492 nmdc:mga0yw44_21477_c1 nmdc:mga0yw44_21477_c1_1430_2179 242
428 3300050492 nmdc:mga0yw44_40546_c1 nmdc:mga0yw44_40546_c1_815_1564 242
429 3300050492 nmdc:mga0yw44_59711_c1 nmdc:mga0yw44_59711_c1_496_1242 242
430 3300050516 nmdc:mga0sz30_19925_c1 nmdc:mga0sz30_19925_c1_1354_2103 242
431 3300053080 Ga0500635_0000039 Ga0500635_0000039_78318_79064 242
432 3300053098 Ga0500650_0002152 Ga0500650_0002152_3686_4435 242
433 3300053104 Ga0500556_0000062 Ga0500556_0000062_84349_85098 242
434 3300053104 Ga0500556_0001014 Ga0500556_0001014_8165_8914 242
435 3300053108 Ga0500562_000346 Ga0500562_000346_5816_6565 242
436 3300053108 Ga0500562_087924 Ga0500562_087924_13_759 242
437 3300053117 Ga0500593_000363 Ga0500593_000363_8295_9044 242
438 3300053133 Ga0500655_001024 Ga0500655_001024_1744_2493 242
439 3300053136 Ga0500559_0000496 Ga0500559_0000496_23065_23814 242
440 3300053136 Ga0500559_0001158 Ga0500559_0001158_4706_5455 242
441 3300053139 Ga0500568_0000060 Ga0500568_0000060_85314_86063 242
442 3300053139 Ga0500568_0000075 Ga0500568_0000075_61084_61833 242
443 3300053139 Ga0500568_0000151 Ga0500568_0000151_12937_13686 242
444 3300053139 Ga0500568_0003966 Ga0500568_0003966_1893_2642 242
445 3300053139 Ga0500568_0019144 Ga0500568_0019144_1418_2167 242
446 3300053140 Ga0500573_0006182 Ga0500573_0006182_3646_4398 242
447 3300053140 Ga0500573_0031312 Ga0500573_0031312_856_1605 242
448 3300053140 Ga0500573_0044916 Ga0500573_0044916_1249_1998 242
449 3300053140 Ga0500573_0065572 Ga0500573_0065572_103_852 242
450 3300053140 Ga0500573_0141644 Ga0500573_0141644_114_863 242
451 3300053142 Ga0500577_0030923 Ga0500577_0030923_300_1049 242
452 3300053146 Ga0500588_0049157 Ga0500588_0049157_281_1030 242
453 3300053153 Ga0500616_0000071 Ga0500616_0000071_25083_25829 242
454 3300053153 Ga0500616_0000781 Ga0500616_0000781_6214_6972 242
455 3300053153 Ga0500616_0001401 Ga0500616_0001401_16987_17736 242
456 3300053153 Ga0500616_0031943 Ga0500616_0031943_1513_2262 242
457 3300054114 Ga0501084_0190913 Ga0501084_0190913_415_1164 242
458 3300060353 Ga0501082_0060608 Ga0501082_0060608_588_1334 242
459 3300060353 Ga0501082_0378903 Ga0501082_0378903_189_938 242
460 3300060353 Ga0501082_0702187 Ga0501082_0702187_96_845 242
461 3300061719 Ga0466962_0026411 Ga0466962_0026411_698_1444 242
462 iso_pu_bacteria 2928090899 2928092479 242
463 iso_pu_bacteria 2984580707 2984580747 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

27

255

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4x9s-assembly1.cif.gz_A crystal structure of hisap from streptomyces sp. mg1 0.9406 9 242
2vep-assembly1.cif.gz_A crystal structure of the full length bifunctional enzyme pria 0.9381 9 240
3zs4-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase with bound prfar 0.9359 9 242
1vzw-assembly1.cif.gz_A crystal structure of the bifunctional protein pria 0.9351 9 240
4tx9-assembly1.cif.gz_A crystal structure of hisap from streptomyces sviceus with degraded profar 0.9349 5 242
ID Description Score Start End Superfamily
4x2rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9262 9 241 3.20.20.70
4x2rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8891 9 241 3.20.20.70
af_P10371_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8872 11 239 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8765 10 242 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.859 10 242 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6N9YAZ4-F1-model_v4 deleted 0.971 77 240
AF-A0A2G7BRR1-F1-model_v4 deleted 0.969 78 240
AF-A0A7K0SNI1-F1-model_v4 Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) 0.9596 30 242 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737
AF-A0A6I2XYG1-F1-model_v4 Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) 0.9592 116 240 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737
AF-A0A3C1FHI2-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) 0.9587 8 242 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737

Feature Viewer

pLDDT pTM Quality
85.94 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map