F449109

General Info

Members Datasets Scaffolds Average Seq Length
463 244 926 82

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_12704703|Ga0163162_127047031
Length 93
Sequence MLTSPPSRRTTMPLYLDVHNVKGGVSAKDVADAHMKDLKEQTHHGVNYIRYWVDEKAGKIFCLVDAPTKEAAHTVHREAHGLVADEIYEVQEG

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
191 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
233 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 1.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 9.5
Rhizosphere 88.55
Stem 0
Stem Tuber 0
Unclassified 14.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_12704703 3300013306 Bacteria 571
2 JGI24735J21928_10020853 3300002067 Unclassified 2005
3 Ga0058859_11270189 3300004798 Unclassified 537
4 Ga0058861_11710926 3300004800 Unclassified 633
5 Ga0058862_10008947 3300004803 Unclassified 545
6 Ga0065712_10283164 3300005290 Unclassified 891
7 Ga0065712_10573527 3300005290 Bacteria 605
8 Ga0065715_10164626 3300005293 Bacteria 1597
9 Ga0065707_10302798 3300005295 Bacteria 1001
10 Ga0070658_10096271 3300005327 Bacteria 2444
11 Ga0070658_10790553 3300005327 Bacteria 824
12 Ga0070658_10871368 3300005327 Bacteria 783
13 Ga0070676_10685634 3300005328 Unclassified 747
14 Ga0070683_100006027 3300005329 Bacteria 10160
15 Ga0070683_100010042 3300005329 Bacteria 8121
16 Ga0070683_100125463 3300005329 Bacteria 2427
17 Ga0070683_100212923 3300005329 Bacteria 1836
18 Ga0070683_100418567 3300005329 Bacteria 1278
19 Ga0070690_100126228 3300005330 Bacteria 1723
20 Ga0070690_100536832 3300005330 Unclassified 880
21 Ga0070670_100001650 3300005331 Bacteria 18076
22 Ga0068869_100001541 3300005334 Bacteria 13698
23 Ga0070666_10860857 3300005335 Unclassified 669
24 Ga0070680_100027097 3300005336 Bacteria 4588
25 Ga0070680_100104441 3300005336 Unclassified 2354
26 Ga0070680_100385897 3300005336 Bacteria 1193
27 Ga0070682_100003515 3300005337 Bacteria 8669
28 Ga0070682_100948978 3300005337 Unclassified 710
29 Ga0068868_100104297 3300005338 Bacteria 2298
30 Ga0068868_101279769 3300005338 Bacteria 680
31 Ga0070660_100024694 3300005339 Bacteria 4461
32 Ga0070660_100030166 3300005339 Bacteria 4067
33 Ga0070689_100117627 3300005340 Bacteria 2120
34 Ga0070689_100195876 3300005340 Unclassified 1647
35 Ga0070689_101458086 3300005340 Bacteria 619
36 Ga0070687_100053069 3300005343 Bacteria 2107
37 Ga0070687_100443944 3300005343 Unclassified 861
38 Ga0070687_100560294 3300005343 Bacteria 779
39 Ga0070687_100870100 3300005343 Unclassified 644
40 Ga0070661_100001319 3300005344 Bacteria 17390
41 Ga0070661_101735839 3300005344 Bacteria 529
42 Ga0070692_10010465 3300005345 Bacteria 4222
43 Ga0070692_10010486 3300005345 Bacteria 4219
44 Ga0070668_100166301 3300005347 Bacteria 1793
45 Ga0070668_100420497 3300005347 Bacteria 1144
46 Ga0070669_100126606 3300005353 Bacteria 1955
47 Ga0070675_100024459 3300005354 Bacteria 4836
48 Ga0070671_100345757 3300005355 Bacteria 1269
49 Ga0070671_100527772 3300005355 Unclassified 1017
50 Ga0070671_100645472 3300005355 Bacteria 916
51 Ga0070673_100025570 3300005364 Bacteria 4348
52 Ga0070673_101404938 3300005364 Unclassified 657
53 Ga0070688_100698786 3300005365 Unclassified 785
54 Ga0070659_100000532 3300005366 Bacteria 27819
55 Ga0070659_100835715 3300005366 Bacteria 802
56 Ga0070667_100145539 3300005367 Bacteria 2078
57 Ga0070703_10081147 3300005406 Bacteria 1105
58 Ga0070714_102287423 3300005435 Unclassified 526
59 Ga0070713_100216534 3300005436 Unclassified 1736
60 Ga0070713_101454880 3300005436 Bacteria 665
61 Ga0070713_102470691 3300005436 Bacteria 502
62 Ga0070701_10812704 3300005438 Bacteria 639
63 Ga0070701_11023423 3300005438 Bacteria 577
64 Ga0070705_100384600 3300005440 Unclassified 1034
65 Ga0070694_100066912 3300005444 Bacteria 2465
66 Ga0070708_101832105 3300005445 Bacteria 563
67 Ga0070708_102087704 3300005445 Bacteria 524
68 Ga0070663_100197312 3300005455 Bacteria 1569
69 Ga0070663_101448443 3300005455 Bacteria 609
70 Ga0070678_101174397 3300005456 Bacteria 711
71 Ga0070662_100044956 3300005457 Bacteria 3166
72 Ga0070662_101679896 3300005457 Unclassified 548
73 Ga0070681_10231694 3300005458 Bacteria 1761
74 Ga0068867_101486694 3300005459 Bacteria 630
75 Ga0070707_100222750 3300005468 Bacteria 1837
76 Ga0070707_100575524 3300005468 Unclassified 1088
77 Ga0070707_102293474 3300005468 Unclassified 507
78 Ga0070699_100407579 3300005518 Bacteria 1230
79 Ga0070679_100033762 3300005530 Bacteria 5066
80 Ga0070679_101270041 3300005530 Bacteria 682
81 Ga0070679_101930706 3300005530 Bacteria 539
82 Ga0070684_100015201 3300005535 Bacteria 6260
83 Ga0070684_100127630 3300005535 Bacteria 2292
84 Ga0070684_100269590 3300005535 Bacteria 1558
85 Ga0070684_101745851 3300005535 Bacteria 587
86 Ga0070684_101982002 3300005535 Bacteria 549
87 Ga0070697_100209684 3300005536 Bacteria 1658
88 Ga0068853_100021271 3300005539 Bacteria 5406
89 Ga0070672_100004783 3300005543 Bacteria 8887
90 Ga0070672_101307427 3300005543 Unclassified 647
91 Ga0070686_100143040 3300005544 Unclassified 1667
92 Ga0070695_100105874 3300005545 Bacteria 1901
93 Ga0070695_100208732 3300005545 Bacteria 1400
94 Ga0070695_100285663 3300005545 Bacteria 1214
95 Ga0070695_100950792 3300005545 Bacteria 696
96 Ga0070693_100033249 3300005547 Bacteria 2844
97 Ga0070693_101193269 3300005547 Bacteria 584
98 Ga0070665_100153583 3300005548 Bacteria 2304
99 Ga0070665_100886242 3300005548 Bacteria 905
100 Ga0070704_100088542 3300005549 Bacteria 2300
101 Ga0070704_101652840 3300005549 Bacteria 591
102 Ga0068855_100152037 3300005563 Bacteria 2632
103 Ga0070664_100062862 3300005564 Bacteria 3165
104 Ga0070664_100072886 3300005564 Bacteria 2946
105 Ga0070664_100579538 3300005564 Bacteria 1039
106 Ga0068857_100239870 3300005577 Bacteria 1659
107 Ga0068854_101273800 3300005578 Bacteria 661
108 Ga0068856_100019110 3300005614 Bacteria 6651
109 Ga0070702_100087235 3300005615 Bacteria 1884
110 Ga0070702_101198728 3300005615 Bacteria 612
111 Ga0068852_100008867 3300005616 Bacteria 7440
112 Ga0068852_100370595 3300005616 Bacteria 1403
113 Ga0068859_100016601 3300005617 Bacteria 7392
114 Ga0068859_103050430 3300005617 Bacteria 511
115 Ga0068864_100006225 3300005618 Bacteria 9790
116 Ga0068864_100482376 3300005618 Bacteria 1190
117 Ga0068864_101587465 3300005618 Bacteria 658
118 Ga0068866_10106057 3300005718 Bacteria 1559
119 Ga0068861_100234415 3300005719 Bacteria 1558
120 Ga0068861_100765408 3300005719 Bacteria 903
121 Ga0068861_101476274 3300005719 Unclassified 666
122 Ga0068851_10021424 3300005834 Bacteria 3138
123 Ga0068870_10083571 3300005840 Bacteria 1770
124 Ga0068870_10169098 3300005840 Bacteria 1303
125 Ga0068863_100005505 3300005841 Bacteria 12455
126 Ga0068858_100094243 3300005842 Bacteria 2789
127 Ga0068858_100863394 3300005842 Bacteria 884
128 Ga0068860_100020654 3300005843 Bacteria 6380
129 Ga0068860_101227569 3300005843 Bacteria 770
130 Ga0068862_102556254 3300005844 Unclassified 522
131 Ga0075365_10098589 3300006038 Bacteria 1999
132 Ga0070716_100077342 3300006173 Bacteria 1975
133 Ga0070712_100529768 3300006175 Bacteria 990
134 Ga0097621_100193660 3300006237 Bacteria 1762
135 Ga0068871_100077085 3300006358 Bacteria 2754
136 Ga0075428_101903574 3300006844 Bacteria 618
137 Ga0075430_100470919 3300006846 Bacteria 1037
138 Ga0075433_11373984 3300006852 Bacteria 611
139 Ga0075434_100614040 3300006871 Bacteria 1106
140 Ga0075434_101918957 3300006871 Unclassified 598
141 Ga0068865_100225611 3300006881 Bacteria 1467
142 Ga0068865_100467022 3300006881 Bacteria 1046
143 Ga0097620_100016601 3300006931 Bacteria 7392
144 Ga0097620_103049100 3300006931 Bacteria 511
145 Ga0099794_10019928 3300007265 Bacteria 3030
146 Ga0111539_10051785 3300009094 Bacteria 4888
147 Ga0111539_10295965 3300009094 Bacteria 1883
148 Ga0105245_10004115 3300009098 Bacteria 12914
149 Ga0105245_10024248 3300009098 Bacteria 5327
150 Ga0105245_10059904 3300009098 Bacteria 3429
151 Ga0105245_10707108 3300009098 Unclassified 1041
152 Ga0105245_11043110 3300009098 Bacteria 863
153 Ga0105245_11186140 3300009098 Bacteria 811
154 Ga0105245_11876499 3300009098 Bacteria 652
155 Ga0105247_10153010 3300009101 Bacteria 1521
156 Ga0105247_10982794 3300009101 Bacteria 658
157 Ga0105247_11655946 3300009101 Unclassified 527
158 Ga0114129_10889677 3300009147 Unclassified 1129
159 Ga0105243_10023619 3300009148 Bacteria 4684
160 Ga0105241_10003107 3300009174 Bacteria 12355
161 Ga0105242_10026035 3300009176 Unclassified 4633
162 Ga0105242_10182527 3300009176 Bacteria 1852
163 Ga0105242_10192544 3300009176 Bacteria 1806
164 Ga0105242_10412234 3300009176 Bacteria 1264
165 Ga0105242_11745645 3300009176 Bacteria 660
166 Ga0105242_12102614 3300009176 Bacteria 608
167 Ga0105248_10109141 3300009177 Bacteria 3120
168 Ga0105248_10112991 3300009177 Bacteria 3063
169 Ga0105248_10133496 3300009177 Bacteria 2800
170 Ga0105237_11801493 3300009545 Bacteria 620
171 Ga0105238_10546128 3300009551 Unclassified 1163
172 Ga0105238_10655140 3300009551 Bacteria 1060
173 Ga0105238_10981744 3300009551 Bacteria 865
174 Ga0105249_11326207 3300009553 Bacteria 791
175 Ga0099796_10149206 3300010159 Bacteria 919
176 Ga0105239_10135725 3300010375 Bacteria 2739
177 Ga0105239_12029537 3300010375 Bacteria 668
178 Ga0105239_12253275 3300010375 Unclassified 634
179 Ga0105239_12501170 3300010375 Bacteria 602
180 Ga0105246_10003081 3300011119 Bacteria 10129
181 Ga0105246_10674076 3300011119 Bacteria 903
182 Ga0157373_10005183 3300013100 Bacteria 9793
183 Ga0157371_10050431 3300013102 Bacteria 2957
184 Ga0157371_10383737 3300013102 Bacteria 1026
185 Ga0157370_10713586 3300013104 Bacteria 915
186 Ga0157369_10185971 3300013105 Bacteria 2185
187 Ga0157369_10367956 3300013105 Bacteria 1492
188 Ga0157369_11862064 3300013105 Bacteria 611
189 Ga0157374_10004045 3300013296 Bacteria 12317
190 Ga0157374_10515331 3300013296 Bacteria 1201
191 Ga0157374_11582350 3300013296 Bacteria 679
192 Ga0157378_10290001 3300013297 Bacteria 1580
193 Ga0157378_10514767 3300013297 Unclassified 1197
194 Ga0157378_13065674 3300013297 Bacteria 519
195 Ga0157372_10147730 3300013307 Unclassified 2711
196 Ga0157372_10276433 3300013307 Bacteria 1952
197 Ga0157372_10545770 3300013307 Bacteria 1351
198 Ga0157372_10922269 3300013307 Bacteria 1013
199 Ga0157372_11521063 3300013307 Bacteria 771
200 Ga0157372_12083247 3300013307 Bacteria 652
201 Ga0157375_10789706 3300013308 Bacteria 1099
202 Ga0157375_11247769 3300013308 Bacteria 873
203 Ga0157375_13241110 3300013308 Bacteria 543
204 Ga0163163_10033845 3300014325 Bacteria 4946
205 Ga0163163_10077161 3300014325 Bacteria 3327
206 Ga0163163_10463226 3300014325 Bacteria 1328
207 Ga0157380_10031349 3300014326 Bacteria 4081
208 Ga0157380_10488473 3300014326 Bacteria 1193
209 Ga0182008_10145829 3300014497 Bacteria 1186
210 Ga0157377_10001379 3300014745 Bacteria 10459
211 Ga0157377_10005923 3300014745 Bacteria 5785
212 Ga0157379_10108566 3300014968 Bacteria 2492
213 Ga0157379_10755460 3300014968 Bacteria 916
214 Ga0157379_12488812 3300014968 Unclassified 517
215 Ga0157376_10090810 3300014969 Unclassified 2644
216 Ga0206356_10305594 3300020070 Unclassified 824
217 Ga0206356_11777551 3300020070 Bacteria 557
218 Ga0206354_10694300 3300020081 Unclassified 518
219 Ga0224712_10137691 3300022467 Bacteria 1072
220 Ga0207653_10325855 3300025885 Bacteria 598
221 Ga0207692_11010988 3300025898 Bacteria 549
222 Ga0207710_10324558 3300025900 Bacteria 781
223 Ga0207710_10723265 3300025900 Bacteria 522
224 Ga0207680_10154818 3300025903 Bacteria 1531
225 Ga0207647_10014246 3300025904 Bacteria 5486
226 Ga0207647_10237147 3300025904 Bacteria 1048
227 Ga0207647_10306306 3300025904 Unclassified 904
228 Ga0207647_10735700 3300025904 Bacteria 535
229 Ga0207643_10250473 3300025908 Unclassified 1091
230 Ga0207705_10077966 3300025909 Bacteria 2411
231 Ga0207705_10655266 3300025909 Bacteria 816
232 Ga0207705_11523967 3300025909 Bacteria 506
233 Ga0207684_10799532 3300025910 Bacteria 797
234 Ga0207684_10894660 3300025910 Bacteria 746
235 Ga0207654_10017080 3300025911 Bacteria 3789
236 Ga0207707_10342245 3300025912 Bacteria 1289
237 Ga0207707_10702520 3300025912 Unclassified 849
238 Ga0207707_10777443 3300025912 Bacteria 799
239 Ga0207693_10330823 3300025915 Bacteria 1193
240 Ga0207663_10431529 3300025916 Bacteria 1013
241 Ga0207663_10517678 3300025916 Bacteria 929
242 Ga0207660_10129897 3300025917 Bacteria 1916
243 Ga0207660_10856721 3300025917 Bacteria 742
244 Ga0207662_10009275 3300025918 Bacteria 5407
245 Ga0207662_10067775 3300025918 Unclassified 2153
246 Ga0207662_10235372 3300025918 Bacteria 1197
247 Ga0207662_10260948 3300025918 Unclassified 1140
248 Ga0207657_10035490 3300025919 Bacteria 4470
249 Ga0207657_10131841 3300025919 Unclassified 2048
250 Ga0207657_10225359 3300025919 Bacteria 1501
251 Ga0207649_10085363 3300025920 Bacteria 2054
252 Ga0207649_10465119 3300025920 Bacteria 957
253 Ga0207652_10005938 3300025921 Bacteria 9877
254 Ga0207646_10063512 3300025922 Bacteria 3297
255 Ga0207646_11846491 3300025922 Bacteria 516
256 Ga0207681_10115431 3300025923 Bacteria 1960
257 Ga0207681_11011635 3300025923 Bacteria 697
258 Ga0207694_10319655 3300025924 Bacteria 1281
259 Ga0207650_10006914 3300025925 Bacteria 7734
260 Ga0207659_10012675 3300025926 Bacteria 5376
261 Ga0207687_10017026 3300025927 Bacteria 4778
262 Ga0207687_10120777 3300025927 Bacteria 1959
263 Ga0207687_10136486 3300025927 Bacteria 1856
264 Ga0207687_10153968 3300025927 Bacteria 1757
265 Ga0207687_10537403 3300025927 Bacteria 979
266 Ga0207687_10817308 3300025927 Bacteria 795
267 Ga0207687_11012708 3300025927 Bacteria 712
268 Ga0207687_11136137 3300025927 Bacteria 671
269 Ga0207700_11808037 3300025928 Bacteria 537
270 Ga0207644_10349095 3300025931 Bacteria 1201
271 Ga0207644_10391078 3300025931 Bacteria 1135
272 Ga0207644_10950460 3300025931 Bacteria 721
273 Ga0207690_10007108 3300025932 Bacteria 6651
274 Ga0207690_11566030 3300025932 Bacteria 551
275 Ga0207706_10005278 3300025933 Bacteria 12049
276 Ga0207706_10256218 3300025933 Bacteria 1528
277 Ga0207706_10891628 3300025933 Bacteria 752
278 Ga0207686_10116726 3300025934 Bacteria 1810
279 Ga0207686_10178716 3300025934 Bacteria 1503
280 Ga0207686_10229578 3300025934 Unclassified 1345
281 Ga0207686_10243367 3300025934 Bacteria 1310
282 Ga0207709_10381464 3300025935 Bacteria 1073
283 Ga0207670_10116550 3300025936 Bacteria 1934
284 Ga0207670_10580867 3300025936 Bacteria 918
285 Ga0207669_10968472 3300025937 Bacteria 714
286 Ga0207704_10401581 3300025938 Bacteria 1082
287 Ga0207665_10218127 3300025939 Bacteria 1397
288 Ga0207691_10003012 3300025940 Bacteria 16442
289 Ga0207691_10482991 3300025940 Bacteria 1053
290 Ga0207711_10037950 3300025941 Bacteria 4096
291 Ga0207711_11017783 3300025941 Unclassified 768
292 Ga0207689_10002837 3300025942 Bacteria 15987
293 Ga0207689_10518060 3300025942 Bacteria 1000
294 Ga0207661_10009529 3300025944 Bacteria 6971
295 Ga0207661_10441350 3300025944 Bacteria 1185
296 Ga0207661_10462200 3300025944 Bacteria 1157
297 Ga0207661_10486911 3300025944 Bacteria 1126
298 Ga0207661_10571705 3300025944 Bacteria 1036
299 Ga0207679_10002036 3300025945 Bacteria 12538
300 Ga0207679_10107844 3300025945 Bacteria 2192
301 Ga0207679_10368465 3300025945 Bacteria 1257
302 Ga0207679_11437631 3300025945 Unclassified 633
303 Ga0207667_10068360 3300025949 Bacteria 3700
304 Ga0207651_10296696 3300025960 Unclassified 1342
305 Ga0207712_10448771 3300025961 Bacteria 1093
306 Ga0207640_11113850 3300025981 Bacteria 699
307 Ga0207658_10029329 3300025986 Unclassified 3885
308 Ga0207677_10053071 3300026023 Bacteria 2757
309 Ga0207677_10854379 3300026023 Bacteria 818
310 Ga0207703_10063221 3300026035 Bacteria 3034
311 Ga0207703_11055235 3300026035 Unclassified 780
312 Ga0207639_10395211 3300026041 Bacteria 1244
313 Ga0207639_11270305 3300026041 Unclassified 691
314 Ga0207678_10228934 3300026067 Bacteria 1592
315 Ga0207678_10399308 3300026067 Bacteria 1190
316 Ga0207708_10001216 3300026075 Bacteria 19447
317 Ga0207702_10019900 3300026078 Bacteria 5560
318 Ga0207702_12085338 3300026078 Unclassified 557
319 Ga0207641_10029996 3300026088 Bacteria 4501
320 Ga0207641_10861065 3300026088 Bacteria 899
321 Ga0207676_10010699 3300026095 Bacteria 6541
322 Ga0207676_10085360 3300026095 Bacteria 2576
323 Ga0207676_10739396 3300026095 Bacteria 956
324 Ga0207676_11795107 3300026095 Bacteria 612
325 Ga0207674_10003606 3300026116 Bacteria 18875
326 Ga0207674_10636536 3300026116 Bacteria 1030
327 Ga0207674_11000647 3300026116 Bacteria 805
328 Ga0207675_100038790 3300026118 Bacteria 4445
329 Ga0207675_100468887 3300026118 Bacteria 1250
330 Ga0207675_100863643 3300026118 Bacteria 920
331 Ga0207683_10298219 3300026121 Bacteria 1475
332 Ga0207698_10016763 3300026142 Bacteria 4950
333 Ga0207698_10391197 3300026142 Bacteria 1326
334 Ga0207698_10673310 3300026142 Bacteria 1027
335 Ga0210000_1026640 3300027462 Bacteria 897
336 Ga0209999_1117244 3300027543 Bacteria 521
337 Ga0209983_1168717 3300027665 Unclassified 502
338 Ga0209588_1101975 3300027671 Bacteria 923
339 Ga0207428_10231124 3300027907 Bacteria 1384
340 Ga0207428_10558762 3300027907 Bacteria 827
341 Ga0268266_10091701 3300028379 Bacteria 2665
342 Ga0268266_11063302 3300028379 Bacteria 783
343 Ga0268265_11166937 3300028380 Bacteria 767
344 Ga0268264_10026611 3300028381 Unclassified 4727
345 Ga0307413_11057233 3300031824 Bacteria 699
346 Ga0307410_10442054 3300031852 Bacteria 1059
347 Ga0307407_10151600 3300031903 Bacteria 1507
348 Ga0307409_100147958 3300031995 Bacteria 2034
349 Ga0307416_100039737 3300032002 Bacteria 3647
350 Ga0307415_100027089 3300032126 Bacteria 3627
351 Ga0373961_0314845 3300035241 Unclassified 582
352 Ga0373931_0210256 3300035691 Bacteria 1166
353 Ga0373937_0942645 3300036401 Unclassified 812
354 Ga0436365_0762781 3300039437 Bacteria 2419
355 Ga0436363_0411944 3300039450 Bacteria 804
356 Ga0451847_0640495 3300041503 Bacteria 550
357 Ga0451855_0900340 3300041511 Bacteria 915
358 Ga0451577_1108488 3300042876 Bacteria 708
359 Ga0466961_0195414 3300044693 Bacteria 1253
360 Ga0466961_0481660 3300044693 Bacteria 750
361 Ga0466963_0056055 3300044694 Bacteria 2622
362 Ga0466963_0131814 3300044694 Bacteria 1727
363 Ga0466963_0154006 3300044694 Bacteria 1597
364 Ga0466963_0228733 3300044694 Bacteria 1303
365 Ga0466963_0368016 3300044694 Bacteria 1013
366 Ga0466963_0728938 3300044694 Unclassified 699
367 Ga0466963_1103694 3300044694 Bacteria 558
368 Ga0466964_0688428 3300044706 Bacteria 569
369 Ga0466971_0027958 3300044719 Bacteria 2525
370 Ga0466971_0215362 3300044719 Bacteria 909
371 Ga0466970_0573257 3300044765 Bacteria 653
372 Ga0466957_0207807 3300044842 Bacteria 1288
373 Ga0466957_0362452 3300044842 Bacteria 985
374 Ga0466957_0417689 3300044842 Bacteria 920
375 Ga0466960_0019883 3300044901 Bacteria 2965
376 Ga0466960_0039445 3300044901 Bacteria 2228
377 Ga0466959_0381482 3300045049 Bacteria 959
378 Ga0451576_1026596 3300045051 Bacteria 864
379 Ga0466958_0247466 3300045836 Bacteria 1140
380 Ga0466958_0857545 3300045836 Bacteria 592
381 Ga0466967_0004734 3300045976 Bacteria 9255
382 Ga0466967_0044906 3300045976 Bacteria 3837
383 Ga0466967_0055716 3300045976 Bacteria 3483
384 Ga0466967_0322681 3300045976 Bacteria 1489
385 Ga0466967_0537579 3300045976 Bacteria 1149
386 Ga0466967_0899096 3300045976 Bacteria 880
387 Ga0466967_0974869 3300045976 Bacteria 844
388 Ga0466967_1029901 3300045976 Bacteria 820
389 Ga0495629_0019837 3300046459 Bacteria 4798
390 Ga0495582_0008895 3300046473 Bacteria 5541
391 Ga0495665_0062028 3300046531 Unclassified 1974
392 Ga0495586_0623299 3300046535 Bacteria 623
393 Ga0495645_0691426 3300046543 Bacteria 620
394 Ga0495635_0239686 3300046663 Bacteria 1224
395 Ga0495658_0116357 3300046683 Unclassified 1612
396 Ga0495581_0004249 3300047315 Bacteria 8260
397 Ga0495674_0923142 3300047319 Bacteria 673
398 Ga0495674_1189858 3300047319 Unclassified 576
399 Ga0495675_0183509 3300047444 Bacteria 1280
400 Ga0496100_0274382 3300048903 Bacteria 1255
401 Ga0496101_0127200 3300048904 Bacteria 1932
402 Ga0496102_0165675 3300048905 Bacteria 2080
403 Ga0496102_0203386 3300048905 Bacteria 1867
404 Ga0496102_0283992 3300048905 Bacteria 1560
405 Ga0496102_0497497 3300048905 Bacteria 1141
406 Ga0496102_0762835 3300048905 Unclassified 890
407 Ga0496102_1442849 3300048905 Bacteria 607
408 Ga0496104_0279981 3300048907 Bacteria 1581
409 Ga0496104_0616102 3300048907 Bacteria 995
410 Ga0496105_0341959 3300048908 Bacteria 1196
411 Ga0496105_0365114 3300048908 Bacteria 1151
412 Ga0496105_1332281 3300048908 Bacteria 523
413 Ga0496107_0458971 3300048910 Bacteria 946
414 Ga0496107_1120467 3300048910 Bacteria 568
415 Ga0496108_0006084 3300048911 Bacteria 9758
416 Ga0496108_0124717 3300048911 Bacteria 2210
417 Ga0496108_0248811 3300048911 Bacteria 1546
418 Ga0496108_0291037 3300048911 Bacteria 1422
419 Ga0496108_0794833 3300048911 Bacteria 816
420 Ga0496109_0062932 3300048912 Bacteria 3393
421 Ga0496109_0130287 3300048912 Unclassified 2347
422 Ga0496109_0284600 3300048912 Bacteria 1558
423 Ga0496109_0434408 3300048912 Bacteria 1240
424 Ga0496110_0017171 3300048913 Bacteria 6051
425 Ga0496110_0251604 3300048913 Bacteria 1608
426 Ga0496110_0554433 3300048913 Bacteria 1044
427 Ga0496111_0033505 3300048914 Bacteria 3664
428 Ga0496111_0040213 3300048914 Unclassified 3354
429 Ga0496111_0510515 3300048914 Bacteria 884
430 Ga0496111_0853531 3300048914 Bacteria 657
431 Ga0496112_0044862 3300048915 Bacteria 4332
432 Ga0496112_0273918 3300048915 Bacteria 1636
433 Ga0496113_0016808 3300048916 Bacteria 5062
434 Ga0496113_0110795 3300048916 Bacteria 2136
435 Ga0496113_0628591 3300048916 Bacteria 859
436 Ga0496114_0010259 3300048917 Bacteria 7454
437 Ga0496114_0073710 3300048917 Bacteria 2873
438 Ga0496114_0099235 3300048917 Bacteria 2484
439 Ga0496114_0117167 3300048917 Bacteria 2288
440 Ga0496114_0144883 3300048917 Bacteria 2059
441 Ga0496114_0673670 3300048917 Bacteria 908
442 Ga0496115_0037682 3300048918 Bacteria 3832
443 Ga0496115_0718693 3300048918 Bacteria 784
444 Ga0496121_0486599 3300048924 Unclassified 787
445 Ga0496126_0705106 3300048929 Bacteria 784
446 Ga0501031_0925851 3300049568 Bacteria 558
447 Ga0501076_0044089 3300049592 Bacteria 3517
448 Ga0501076_0294114 3300049592 Bacteria 1331
449 Ga0501227_066426 3300049665 Bacteria 931
450 Ga0501239_070017 3300049672 Bacteria 544
451 Ga0501035_0394759 3300049822 Unclassified 1152
452 nmdc:mga00v17_833742_c1 3300050491 Bacteria 586
453 nmdc:mga05p37_1091226_c1 3300050507 Bacteria 837
454 nmdc:mga05p37_1620837_c1 3300050507 Bacteria 636
455 nmdc:mga09592_1000153_c1 3300050508 Unclassified 699
456 nmdc:mga0qj67_672588_c1 3300050509 Bacteria 825
457 nmdc:mga08y16_100833_c1 3300050511 Bacteria 3006
458 nmdc:mga08y16_813146_c1 3300050511 Bacteria 927
459 Ga0495601_0134447 3300053077 Bacteria 1612
460 Ga0495595_0737134 3300053084 Bacteria 505
461 Ga0495619_0922335 3300053085 Bacteria 587
462 Ga0501084_0776806 3300054114 Unclassified 807
463 Ga0590075_116437 3300059424 Bacteria 699
464 Ga0163162_12704703
465 JGI24735J21928_10020853
466 Ga0058859_11270189
467 Ga0058861_11710926
468 Ga0058862_10008947
469 Ga0065712_10283164
470 Ga0065712_10573527
471 Ga0065715_10164626
472 Ga0065707_10302798
473 Ga0070658_10096271
474 Ga0070658_10790553
475 Ga0070658_10871368
476 Ga0070676_10685634
477 Ga0070683_100006027
478 Ga0070683_100010042
479 Ga0070683_100125463
480 Ga0070683_100212923
481 Ga0070683_100418567
482 Ga0070690_100126228
483 Ga0070690_100536832
484 Ga0070670_100001650
485 Ga0068869_100001541
486 Ga0070666_10860857
487 Ga0070680_100027097
488 Ga0070680_100104441
489 Ga0070680_100385897
490 Ga0070682_100003515
491 Ga0070682_100948978
492 Ga0068868_100104297
493 Ga0068868_101279769
494 Ga0070660_100024694
495 Ga0070660_100030166
496 Ga0070689_100117627
497 Ga0070689_100195876
498 Ga0070689_101458086
499 Ga0070687_100053069
500 Ga0070687_100443944
501 Ga0070687_100560294
502 Ga0070687_100870100
503 Ga0070661_100001319
504 Ga0070661_101735839
505 Ga0070692_10010465
506 Ga0070692_10010486
507 Ga0070668_100166301
508 Ga0070668_100420497
509 Ga0070669_100126606
510 Ga0070675_100024459
511 Ga0070671_100345757
512 Ga0070671_100527772
513 Ga0070671_100645472
514 Ga0070673_100025570
515 Ga0070673_101404938
516 Ga0070688_100698786
517 Ga0070659_100000532
518 Ga0070659_100835715
519 Ga0070667_100145539
520 Ga0070703_10081147
521 Ga0070714_102287423
522 Ga0070713_100216534
523 Ga0070713_101454880
524 Ga0070713_102470691
525 Ga0070701_10812704
526 Ga0070701_11023423
527 Ga0070705_100384600
528 Ga0070694_100066912
529 Ga0070708_101832105
530 Ga0070708_102087704
531 Ga0070663_100197312
532 Ga0070663_101448443
533 Ga0070678_101174397
534 Ga0070662_100044956
535 Ga0070662_101679896
536 Ga0070681_10231694
537 Ga0068867_101486694
538 Ga0070707_100222750
539 Ga0070707_100575524
540 Ga0070707_102293474
541 Ga0070699_100407579
542 Ga0070679_100033762
543 Ga0070679_101270041
544 Ga0070679_101930706
545 Ga0070684_100015201
546 Ga0070684_100127630
547 Ga0070684_100269590
548 Ga0070684_101745851
549 Ga0070684_101982002
550 Ga0070697_100209684
551 Ga0068853_100021271
552 Ga0070672_100004783
553 Ga0070672_101307427
554 Ga0070686_100143040
555 Ga0070695_100105874
556 Ga0070695_100208732
557 Ga0070695_100285663
558 Ga0070695_100950792
559 Ga0070693_100033249
560 Ga0070693_101193269
561 Ga0070665_100153583
562 Ga0070665_100886242
563 Ga0070704_100088542
564 Ga0070704_101652840
565 Ga0068855_100152037
566 Ga0070664_100062862
567 Ga0070664_100072886
568 Ga0070664_100579538
569 Ga0068857_100239870
570 Ga0068854_101273800
571 Ga0068856_100019110
572 Ga0070702_100087235
573 Ga0070702_101198728
574 Ga0068852_100008867
575 Ga0068852_100370595
576 Ga0068859_100016601
577 Ga0068859_103050430
578 Ga0068864_100006225
579 Ga0068864_100482376
580 Ga0068864_101587465
581 Ga0068866_10106057
582 Ga0068861_100234415
583 Ga0068861_100765408
584 Ga0068861_101476274
585 Ga0068851_10021424
586 Ga0068870_10083571
587 Ga0068870_10169098
588 Ga0068863_100005505
589 Ga0068858_100094243
590 Ga0068858_100863394
591 Ga0068860_100020654
592 Ga0068860_101227569
593 Ga0068862_102556254
594 Ga0075365_10098589
595 Ga0070716_100077342
596 Ga0070712_100529768
597 Ga0097621_100193660
598 Ga0068871_100077085
599 Ga0075428_101903574
600 Ga0075430_100470919
601 Ga0075433_11373984
602 Ga0075434_100614040
603 Ga0075434_101918957
604 Ga0068865_100225611
605 Ga0068865_100467022
606 Ga0097620_100016601
607 Ga0097620_103049100
608 Ga0099794_10019928
609 Ga0111539_10051785
610 Ga0111539_10295965
611 Ga0105245_10004115
612 Ga0105245_10024248
613 Ga0105245_10059904
614 Ga0105245_10707108
615 Ga0105245_11043110
616 Ga0105245_11186140
617 Ga0105245_11876499
618 Ga0105247_10153010
619 Ga0105247_10982794
620 Ga0105247_11655946
621 Ga0114129_10889677
622 Ga0105243_10023619
623 Ga0105241_10003107
624 Ga0105242_10026035
625 Ga0105242_10182527
626 Ga0105242_10192544
627 Ga0105242_10412234
628 Ga0105242_11745645
629 Ga0105242_12102614
630 Ga0105248_10109141
631 Ga0105248_10112991
632 Ga0105248_10133496
633 Ga0105237_11801493
634 Ga0105238_10546128
635 Ga0105238_10655140
636 Ga0105238_10981744
637 Ga0105249_11326207
638 Ga0099796_10149206
639 Ga0105239_10135725
640 Ga0105239_12029537
641 Ga0105239_12253275
642 Ga0105239_12501170
643 Ga0105246_10003081
644 Ga0105246_10674076
645 Ga0157373_10005183
646 Ga0157371_10050431
647 Ga0157371_10383737
648 Ga0157370_10713586
649 Ga0157369_10185971
650 Ga0157369_10367956
651 Ga0157369_11862064
652 Ga0157374_10004045
653 Ga0157374_10515331
654 Ga0157374_11582350
655 Ga0157378_10290001
656 Ga0157378_10514767
657 Ga0157378_13065674
658 Ga0157372_10147730
659 Ga0157372_10276433
660 Ga0157372_10545770
661 Ga0157372_10922269
662 Ga0157372_11521063
663 Ga0157372_12083247
664 Ga0157375_10789706
665 Ga0157375_11247769
666 Ga0157375_13241110
667 Ga0163163_10033845
668 Ga0163163_10077161
669 Ga0163163_10463226
670 Ga0157380_10031349
671 Ga0157380_10488473
672 Ga0182008_10145829
673 Ga0157377_10001379
674 Ga0157377_10005923
675 Ga0157379_10108566
676 Ga0157379_10755460
677 Ga0157379_12488812
678 Ga0157376_10090810
679 Ga0206356_10305594
680 Ga0206356_11777551
681 Ga0206354_10694300
682 Ga0224712_10137691
683 Ga0207653_10325855
684 Ga0207692_11010988
685 Ga0207710_10324558
686 Ga0207710_10723265
687 Ga0207680_10154818
688 Ga0207647_10014246
689 Ga0207647_10237147
690 Ga0207647_10306306
691 Ga0207647_10735700
692 Ga0207643_10250473
693 Ga0207705_10077966
694 Ga0207705_10655266
695 Ga0207705_11523967
696 Ga0207684_10799532
697 Ga0207684_10894660
698 Ga0207654_10017080
699 Ga0207707_10342245
700 Ga0207707_10702520
701 Ga0207707_10777443
702 Ga0207693_10330823
703 Ga0207663_10431529
704 Ga0207663_10517678
705 Ga0207660_10129897
706 Ga0207660_10856721
707 Ga0207662_10009275
708 Ga0207662_10067775
709 Ga0207662_10235372
710 Ga0207662_10260948
711 Ga0207657_10035490
712 Ga0207657_10131841
713 Ga0207657_10225359
714 Ga0207649_10085363
715 Ga0207649_10465119
716 Ga0207652_10005938
717 Ga0207646_10063512
718 Ga0207646_11846491
719 Ga0207681_10115431
720 Ga0207681_11011635
721 Ga0207694_10319655
722 Ga0207650_10006914
723 Ga0207659_10012675
724 Ga0207687_10017026
725 Ga0207687_10120777
726 Ga0207687_10136486
727 Ga0207687_10153968
728 Ga0207687_10537403
729 Ga0207687_10817308
730 Ga0207687_11012708
731 Ga0207687_11136137
732 Ga0207700_11808037
733 Ga0207644_10349095
734 Ga0207644_10391078
735 Ga0207644_10950460
736 Ga0207690_10007108
737 Ga0207690_11566030
738 Ga0207706_10005278
739 Ga0207706_10256218
740 Ga0207706_10891628
741 Ga0207686_10116726
742 Ga0207686_10178716
743 Ga0207686_10229578
744 Ga0207686_10243367
745 Ga0207709_10381464
746 Ga0207670_10116550
747 Ga0207670_10580867
748 Ga0207669_10968472
749 Ga0207704_10401581
750 Ga0207665_10218127
751 Ga0207691_10003012
752 Ga0207691_10482991
753 Ga0207711_10037950
754 Ga0207711_11017783
755 Ga0207689_10002837
756 Ga0207689_10518060
757 Ga0207661_10009529
758 Ga0207661_10441350
759 Ga0207661_10462200
760 Ga0207661_10486911
761 Ga0207661_10571705
762 Ga0207679_10002036
763 Ga0207679_10107844
764 Ga0207679_10368465
765 Ga0207679_11437631
766 Ga0207667_10068360
767 Ga0207651_10296696
768 Ga0207712_10448771
769 Ga0207640_11113850
770 Ga0207658_10029329
771 Ga0207677_10053071
772 Ga0207677_10854379
773 Ga0207703_10063221
774 Ga0207703_11055235
775 Ga0207639_10395211
776 Ga0207639_11270305
777 Ga0207678_10228934
778 Ga0207678_10399308
779 Ga0207708_10001216
780 Ga0207702_10019900
781 Ga0207702_12085338
782 Ga0207641_10029996
783 Ga0207641_10861065
784 Ga0207676_10010699
785 Ga0207676_10085360
786 Ga0207676_10739396
787 Ga0207676_11795107
788 Ga0207674_10003606
789 Ga0207674_10636536
790 Ga0207674_11000647
791 Ga0207675_100038790
792 Ga0207675_100468887
793 Ga0207675_100863643
794 Ga0207683_10298219
795 Ga0207698_10016763
796 Ga0207698_10391197
797 Ga0207698_10673310
798 Ga0210000_1026640
799 Ga0209999_1117244
800 Ga0209983_1168717
801 Ga0209588_1101975
802 Ga0207428_10231124
803 Ga0207428_10558762
804 Ga0268266_10091701
805 Ga0268266_11063302
806 Ga0268265_11166937
807 Ga0268264_10026611
808 Ga0307413_11057233
809 Ga0307410_10442054
810 Ga0307407_10151600
811 Ga0307409_100147958
812 Ga0307416_100039737
813 Ga0307415_100027089
814 Ga0373961_0314845
815 Ga0373931_0210256
816 Ga0373937_0942645
817 Ga0436365_0762781
818 Ga0436363_0411944
819 Ga0451847_0640495
820 Ga0451855_0900340
821 Ga0451577_1108488
822 Ga0466961_0195414
823 Ga0466961_0481660
824 Ga0466963_0056055
825 Ga0466963_0131814
826 Ga0466963_0154006
827 Ga0466963_0228733
828 Ga0466963_0368016
829 Ga0466963_0728938
830 Ga0466963_1103694
831 Ga0466964_0688428
832 Ga0466971_0027958
833 Ga0466971_0215362
834 Ga0466970_0573257
835 Ga0466957_0207807
836 Ga0466957_0362452
837 Ga0466957_0417689
838 Ga0466960_0019883
839 Ga0466960_0039445
840 Ga0466959_0381482
841 Ga0451576_1026596
842 Ga0466958_0247466
843 Ga0466958_0857545
844 Ga0466967_0004734
845 Ga0466967_0044906
846 Ga0466967_0055716
847 Ga0466967_0322681
848 Ga0466967_0537579
849 Ga0466967_0899096
850 Ga0466967_0974869
851 Ga0466967_1029901
852 Ga0495629_0019837
853 Ga0495582_0008895
854 Ga0495665_0062028
855 Ga0495586_0623299
856 Ga0495645_0691426
857 Ga0495635_0239686
858 Ga0495658_0116357
859 Ga0495581_0004249
860 Ga0495674_0923142
861 Ga0495674_1189858
862 Ga0495675_0183509
863 Ga0496100_0274382
864 Ga0496101_0127200
865 Ga0496102_0165675
866 Ga0496102_0203386
867 Ga0496102_0283992
868 Ga0496102_0497497
869 Ga0496102_0762835
870 Ga0496102_1442849
871 Ga0496104_0279981
872 Ga0496104_0616102
873 Ga0496105_0341959
874 Ga0496105_0365114
875 Ga0496105_1332281
876 Ga0496107_0458971
877 Ga0496107_1120467
878 Ga0496108_0006084
879 Ga0496108_0124717
880 Ga0496108_0248811
881 Ga0496108_0291037
882 Ga0496108_0794833
883 Ga0496109_0062932
884 Ga0496109_0130287
885 Ga0496109_0284600
886 Ga0496109_0434408
887 Ga0496110_0017171
888 Ga0496110_0251604
889 Ga0496110_0554433
890 Ga0496111_0033505
891 Ga0496111_0040213
892 Ga0496111_0510515
893 Ga0496111_0853531
894 Ga0496112_0044862
895 Ga0496112_0273918
896 Ga0496113_0016808
897 Ga0496113_0110795
898 Ga0496113_0628591
899 Ga0496114_0010259
900 Ga0496114_0073710
901 Ga0496114_0099235
902 Ga0496114_0117167
903 Ga0496114_0144883
904 Ga0496114_0673670
905 Ga0496115_0037682
906 Ga0496115_0718693
907 Ga0496121_0486599
908 Ga0496126_0705106
909 Ga0501031_0925851
910 Ga0501076_0044089
911 Ga0501076_0294114
912 Ga0501227_066426
913 Ga0501239_070017
914 Ga0501035_0394759
915 nmdc:mga00v17_833742_c1
916 nmdc:mga05p37_1091226_c1
917 nmdc:mga05p37_1620837_c1
918 nmdc:mga09592_1000153_c1
919 nmdc:mga0qj67_672588_c1
920 nmdc:mga08y16_100833_c1
921 nmdc:mga08y16_813146_c1
922 Ga0495601_0134447
923 Ga0495595_0737134
924 Ga0495619_0922335
925 Ga0501084_0776806
926 Ga0590075_116437

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14026

SCO4226-like

Nickel responsive protein SCO4226-like

15

90

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.9265 3 82
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.905 3 82
3rhu-assembly1.cif.gz_A epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.7936 34 54
1v4p-assembly3.cif.gz_C crystal structure of alanyl-trna synthetase from pyrococcus horikoshii ot3 0.7575 34 56
2a6o-assembly1.cif.gz_A crystal structure of the ishp608 transposase in complex with stem-loop dna 0.681 2 81
ID Description Score Start End Superfamily
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.925 4 82 3.30.70.3090
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.9031 4 82 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7694 1 78 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7313 1 78 3.30.70.3090
af_Q1ZXR2_492_809_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.7257 5 53 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A1Q4F204-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9987 1 79 GO:0003700
GO:0043565
AF-A0A428K041-F1-model_v4 DUF4242 domain-containing protein 0.9973 1 79 GO:0003700
GO:0043565
AF-A0A537JU00-F1-model_v4 DUF4242 domain-containing protein 0.9971 1 79 GO:0003700
GO:0004016
GO:0009190
GO:0035556
GO:0043565
AF-A0A110B1H8-F1-model_v4 AraC-like DNA-binding protein (Transcriptional activator FtrA) 0.9968 1 79 GO:0003700
GO:0004016
GO:0009190
GO:0035556
GO:0043565
AF-A0A317IU28-F1-model_v4 Guanylate cyclase domain-containing protein 0.9954 1 79 GO:0004016
GO:0009190
GO:0035556

Map