F449108

General Info

Members Datasets Scaffolds Average Seq Length
463 192 461 158

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_11367307|Ga0105239_113673071
Length 178
Sequence MASKTLDGGCGCGAVRYRLNDEPILVNNCHCTLCQRQTGTGSAVNAFIEMDRLDHLSGELTEHEFKTGSGAAQIVVRCASCGTPVWSHYRLGRKAAAVRVGTLDNPSAVRPDAAIYVADKPEWAPLPEGVPQFEAYYNPAELLPPERFARLKARLEAEGLFAASRKRPLPAHPRAVGM

Samples

Sample ID Description Type Environment
1 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
2 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
145 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
146 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
147 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
171 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
172 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
188 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
189 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
190 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
191 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.22
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.3
Nodule 0
Rhizoplane 3.24
Rhizosphere 95.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10000144 3300001990 Bacteria 22021
2 JGI24737J22298_10012849 3300001990 Bacteria 2730
3 Ga0065165_1001810 3300005262 Bacteria 20963
4 Ga0070658_10050747 3300005327 Bacteria 3363
5 Ga0070658_10101436 3300005327 Bacteria 2379
6 Ga0070658_10194288 3300005327 Bacteria 1711
7 Ga0070658_10606417 3300005327 Bacteria 949
8 Ga0070658_10823188 3300005327 Bacteria 807
9 Ga0070676_10093173 3300005328 Bacteria 1849
10 Ga0070676_10304270 3300005328 Bacteria 1082
11 Ga0070676_10390151 3300005328 Bacteria 966
12 Ga0070683_100046510 3300005329 Bacteria 4009
13 Ga0070690_100056501 3300005330 Bacteria 2517
14 Ga0070690_100115995 3300005330 Bacteria 1792
15 Ga0070670_100128482 3300005331 Bacteria 2187
16 Ga0068869_101217259 3300005334 Bacteria 662
17 Ga0070666_10000381 3300005335 Bacteria 27905
18 Ga0070666_10035612 3300005335 Bacteria 3301
19 Ga0070666_10040320 3300005335 Bacteria 3116
20 Ga0070680_100004762 3300005336 Bacteria 10214
21 Ga0070680_100060896 3300005336 Bacteria 3089
22 Ga0070682_100025660 3300005337 Bacteria 3519
23 Ga0068868_100002486 3300005338 Bacteria 12791
24 Ga0068868_100012819 3300005338 Bacteria 6133
25 Ga0068868_100061996 3300005338 Bacteria 2963
26 Ga0068868_100467172 3300005338 Bacteria 1100
27 Ga0070660_100046290 3300005339 Bacteria 3334
28 Ga0070660_100073099 3300005339 Bacteria 2681
29 Ga0070660_100110814 3300005339 Bacteria 2183
30 Ga0070660_100202186 3300005339 Bacteria 1611
31 Ga0070660_100531370 3300005339 Bacteria 980
32 Ga0070660_100648569 3300005339 Bacteria 884
33 Ga0070689_100496229 3300005340 Bacteria 1045
34 Ga0070661_100008823 3300005344 Bacteria 6976
35 Ga0070661_100014619 3300005344 Bacteria 5534
36 Ga0070661_100022387 3300005344 Bacteria 4524
37 Ga0070661_100059054 3300005344 Bacteria 2811
38 Ga0070661_100303309 3300005344 Bacteria 1244
39 Ga0070669_100227785 3300005353 Bacteria 1476
40 Ga0070669_100655807 3300005353 Bacteria 883
41 Ga0070671_100005525 3300005355 Bacteria 10069
42 Ga0070671_100018113 3300005355 Bacteria 5718
43 Ga0070671_100842376 3300005355 Bacteria 800
44 Ga0070674_100022402 3300005356 Bacteria 4075
45 Ga0070674_100072023 3300005356 Bacteria 2446
46 Ga0070674_100102133 3300005356 Bacteria 2091
47 Ga0070674_100282972 3300005356 Bacteria 1315
48 Ga0070674_101025592 3300005356 Bacteria 725
49 Ga0070673_100022395 3300005364 Bacteria 4598
50 Ga0070673_100261591 3300005364 Bacteria 1512
51 Ga0070673_100593738 3300005364 Bacteria 1009
52 Ga0070659_100016142 3300005366 Bacteria 5603
53 Ga0070659_100019299 3300005366 Bacteria 5163
54 Ga0070659_100081110 3300005366 Bacteria 2591
55 Ga0070667_100000915 3300005367 Bacteria 27247
56 Ga0070667_100141190 3300005367 Bacteria 2109
57 Ga0070667_100692472 3300005367 Bacteria 943
58 Ga0070714_100520140 3300005435 Bacteria 1136
59 Ga0070714_100933556 3300005435 Bacteria 843
60 Ga0070713_100323058 3300005436 Bacteria 1426
61 Ga0070663_100001101 3300005455 Bacteria 14847
62 Ga0070663_100022927 3300005455 Bacteria 4179
63 Ga0070663_100224959 3300005455 Bacteria 1475
64 Ga0070678_100014296 3300005456 Bacteria 5002
65 Ga0070678_100061319 3300005456 Bacteria 2772
66 Ga0070678_100072775 3300005456 Bacteria 2578
67 Ga0070662_100034607 3300005457 Bacteria 3563
68 Ga0070662_100131953 3300005457 Bacteria 1927
69 Ga0070662_100221241 3300005457 Bacteria 1511
70 Ga0070681_10248312 3300005458 Bacteria 1692
71 Ga0068867_100378279 3300005459 Bacteria 1189
72 Ga0068867_100532467 3300005459 Bacteria 1015
73 Ga0070685_10479759 3300005466 Bacteria 876
74 Ga0070679_100093706 3300005530 Bacteria 2990
75 Ga0068853_100090534 3300005539 Bacteria 2689
76 Ga0068853_100231499 3300005539 Bacteria 1691
77 Ga0070672_100022583 3300005543 Bacteria 4624
78 Ga0070672_100242682 3300005543 Bacteria 1516
79 Ga0070686_100099037 3300005544 Bacteria 1966
80 Ga0070693_101110373 3300005547 Unclassified 603
81 Ga0070665_100147256 3300005548 Bacteria 2357
82 Ga0070665_100285389 3300005548 Bacteria 1653
83 Ga0068855_100009575 3300005563 Bacteria 11690
84 Ga0068855_100316105 3300005563 Unclassified 1727
85 Ga0068855_100545665 3300005563 Bacteria 1255
86 Ga0070664_100008493 3300005564 Bacteria 8304
87 Ga0070664_100101155 3300005564 Bacteria 2506
88 Ga0070664_100976797 3300005564 Bacteria 795
89 Ga0070664_101132389 3300005564 Bacteria 737
90 Ga0068857_100040921 3300005577 Bacteria 4108
91 Ga0068857_100140765 3300005577 Bacteria 2180
92 Ga0068857_101936253 3300005577 Unclassified 578
93 Ga0068854_100001637 3300005578 Bacteria 13623
94 Ga0068854_100063809 3300005578 Bacteria 2675
95 Ga0068854_100261207 3300005578 Bacteria 1386
96 Ga0068854_100396820 3300005578 Bacteria 1140
97 Ga0068856_100059987 3300005614 Bacteria 3758
98 Ga0068856_100060724 3300005614 Bacteria 3734
99 Ga0068852_100002847 3300005616 Bacteria 11997
100 Ga0068852_100022981 3300005616 Bacteria 5010
101 Ga0068852_100099856 3300005616 Bacteria 2617
102 Ga0068852_100103620 3300005616 Bacteria 2574
103 Ga0068852_100300507 3300005616 Bacteria 1553
104 Ga0068852_100350532 3300005616 Bacteria 1441
105 Ga0068852_100599741 3300005616 Bacteria 1105
106 Ga0068852_101583463 3300005616 Bacteria 677
107 Ga0068859_100188195 3300005617 Bacteria 2148
108 Ga0068864_100035565 3300005618 Bacteria 4240
109 Ga0068866_10018377 3300005718 Bacteria 3161
110 Ga0068866_10527764 3300005718 Bacteria 785
111 Ga0068861_101381505 3300005719 Bacteria 687
112 Ga0068851_10135823 3300005834 Bacteria 1333
113 Ga0068851_10606539 3300005834 Unclassified 667
114 Ga0068863_100010147 3300005841 Bacteria 9160
115 Ga0068863_100224276 3300005841 Bacteria 1811
116 Ga0068858_100009318 3300005842 Bacteria 9374
117 Ga0068858_100256555 3300005842 Bacteria 1661
118 Ga0068858_100491797 3300005842 Bacteria 1185
119 Ga0068860_100183540 3300005843 Bacteria 2022
120 Ga0068860_100301326 3300005843 Bacteria 1570
121 Ga0081539_10018852 3300005985 Bacteria 4756
122 Ga0081539_10042585 3300005985 Bacteria 2642
123 Ga0097621_100086556 3300006237 Bacteria 2616
124 Ga0097621_100314677 3300006237 Bacteria 1385
125 Ga0068871_100020597 3300006358 Bacteria 5055
126 Ga0068871_100174178 3300006358 Bacteria 1846
127 Ga0068871_100408092 3300006358 Bacteria 1211
128 Ga0075428_100169109 3300006844 Bacteria 2370
129 Ga0068865_100131747 3300006881 Bacteria 1874
130 Ga0097620_100188180 3300006931 Bacteria 2148
131 Ga0105240_10007571 3300009093 Bacteria 15734
132 Ga0105240_10094481 3300009093 Bacteria 3647
133 Ga0105240_10265317 3300009093 Bacteria 1979
134 Ga0105245_10047843 3300009098 Bacteria 3824
135 Ga0105245_10138345 3300009098 Bacteria 2291
136 Ga0105247_10091863 3300009101 Bacteria 1928
137 Ga0114129_10212862 3300009147 Bacteria 2612
138 Ga0105243_10228121 3300009148 Bacteria 1650
139 Ga0105243_10804231 3300009148 Bacteria 927
140 Ga0105241_10578205 3300009174 Bacteria 1012
141 Ga0105242_10041050 3300009176 Bacteria 3730
142 Ga0105248_10000673 3300009177 Bacteria 38736
143 Ga0105248_10342047 3300009177 Bacteria 1684
144 Ga0105248_11026183 3300009177 Bacteria 932
145 Ga0105237_10803195 3300009545 Bacteria 948
146 Ga0105238_10064511 3300009551 Bacteria 3663
147 Ga0105238_10649883 3300009551 Bacteria 1064
148 Ga0105238_11831332 3300009551 Bacteria 639
149 Ga0105239_10107698 3300010375 Bacteria 3088
150 Ga0105239_10143409 3300010375 Bacteria 2662
151 Ga0105239_10198198 3300010375 Bacteria 2249
152 Ga0105239_11367307 3300010375 Bacteria 817
153 Ga0105246_10032313 3300011119 Bacteria 3470
154 Ga0157373_10096582 3300013100 Bacteria 2080
155 Ga0157373_10107055 3300013100 Bacteria 1966
156 Ga0157373_10134864 3300013100 Bacteria 1736
157 Ga0157373_10255868 3300013100 Bacteria 1239
158 Ga0157373_10480876 3300013100 Bacteria 896
159 Ga0157373_10531724 3300013100 Bacteria 851
160 Ga0157373_10600657 3300013100 Unclassified 801
161 Ga0157371_10001435 3300013102 Bacteria 24751
162 Ga0157371_10855660 3300013102 Bacteria 688
163 Ga0157371_11123510 3300013102 Bacteria 603
164 Ga0157370_10121442 3300013104 Bacteria 2439
165 Ga0157370_10132585 3300013104 Bacteria 2324
166 Ga0157370_10150980 3300013104 Bacteria 2162
167 Ga0157370_10249516 3300013104 Bacteria 1642
168 Ga0157370_10490961 3300013104 Bacteria 1128
169 Ga0157370_10624436 3300013104 Bacteria 986
170 Ga0157370_11426601 3300013104 Bacteria 623
171 Ga0157369_10001012 3300013105 Bacteria 35358
172 Ga0157369_10004172 3300013105 Bacteria 17121
173 Ga0157369_10062380 3300013105 Bacteria 4017
174 Ga0157369_10127823 3300013105 Bacteria 2693
175 Ga0157369_10200913 3300013105 Bacteria 2092
176 Ga0157369_10397111 3300013105 Bacteria 1431
177 Ga0157369_10397112 3300013105 Bacteria 1431
178 Ga0157369_10489157 3300013105 Bacteria 1273
179 Ga0157369_11550261 3300013105 Bacteria 674
180 Ga0157369_11773992 3300013105 Unclassified 627
181 Ga0157374_10009049 3300013296 Bacteria 8532
182 Ga0157374_10090064 3300013296 Bacteria 2924
183 Ga0157374_10373641 3300013296 Bacteria 1419
184 Ga0157378_10245844 3300013297 Bacteria 1711
185 Ga0157378_10308583 3300013297 Bacteria 1534
186 Ga0157378_10407210 3300013297 Bacteria 1342
187 Ga0157378_10468798 3300013297 Bacteria 1253
188 Ga0163162_10165733 3300013306 Bacteria 2333
189 Ga0163162_10507834 3300013306 Bacteria 1336
190 Ga0157372_10134336 3300013307 Bacteria 2848
191 Ga0157372_11681603 3300013307 Bacteria 730
192 Ga0157372_11805079 3300013307 Bacteria 703
193 Ga0157375_10093202 3300013308 Bacteria 3077
194 Ga0157375_10435314 3300013308 Bacteria 1477
195 Ga0157375_10569695 3300013308 Bacteria 1293
196 Ga0157375_11680984 3300013308 Bacteria 751
197 Ga0163163_10020664 3300014325 Bacteria 6205
198 Ga0157377_10048533 3300014745 Bacteria 2382
199 Ga0157377_10049358 3300014745 Bacteria 2365
200 Ga0157379_10130489 3300014968 Bacteria 2262
201 Ga0157379_10138892 3300014968 Bacteria 2190
202 Ga0157376_10006910 3300014969 Bacteria 8041
203 Ga0206356_10268529 3300020070 Bacteria 771
204 Ga0207656_10134133 3300025321 Bacteria 1162
205 Ga0207680_10000492 3300025903 Bacteria 18747
206 Ga0207680_10468645 3300025903 Bacteria 895
207 Ga0207647_10026542 3300025904 Bacteria 3788
208 Ga0207647_10079983 3300025904 Bacteria 1961
209 Ga0207647_10150911 3300025904 Bacteria 1358
210 Ga0207647_10215334 3300025904 Bacteria 1108
211 Ga0207645_10014996 3300025907 Bacteria 5165
212 Ga0207645_10113522 3300025907 Bacteria 1755
213 Ga0207705_10000003 3300025909 Bacteria 709270
214 Ga0207705_10345385 3300025909 Bacteria 1146
215 Ga0207705_10375516 3300025909 Bacteria 1098
216 Ga0207705_10402127 3300025909 Bacteria 1059
217 Ga0207707_10140757 3300025912 Bacteria 2110
218 Ga0207707_10348674 3300025912 Bacteria 1276
219 Ga0207695_10005303 3300025913 Bacteria 17175
220 Ga0207695_10005548 3300025913 Bacteria 16679
221 Ga0207695_10244973 3300025913 Bacteria 1693
222 Ga0207660_10000186 3300025917 Bacteria 39363
223 Ga0207660_10071570 3300025917 Bacteria 2523
224 Ga0207660_10253892 3300025917 Bacteria 1388
225 Ga0207657_10012677 3300025919 Bacteria 8308
226 Ga0207657_10050297 3300025919 Bacteria 3627
227 Ga0207657_10088302 3300025919 Bacteria 2592
228 Ga0207657_10142019 3300025919 Bacteria 1961
229 Ga0207657_10663291 3300025919 Bacteria 812
230 Ga0207649_10001220 3300025920 Bacteria 15471
231 Ga0207649_10010955 3300025920 Bacteria 4987
232 Ga0207649_10030809 3300025920 Bacteria 3181
233 Ga0207649_10179420 3300025920 Bacteria 1481
234 Ga0207649_11448937 3300025920 Unclassified 543
235 Ga0207652_10170405 3300025921 Bacteria 1953
236 Ga0207681_10257801 3300025923 Bacteria 1364
237 Ga0207694_10085599 3300025924 Bacteria 2481
238 Ga0207694_10164129 3300025924 Bacteria 1795
239 Ga0207650_10034633 3300025925 Bacteria 3663
240 Ga0207659_10123633 3300025926 Bacteria 1986
241 Ga0207687_10136802 3300025927 Bacteria 1854
242 Ga0207700_10034763 3300025928 Bacteria 3622
243 Ga0207664_10005541 3300025929 Bacteria 8643
244 Ga0207664_10214003 3300025929 Bacteria 1668
245 Ga0207664_10698572 3300025929 Bacteria 912
246 Ga0207664_10898365 3300025929 Bacteria 795
247 Ga0207644_10001877 3300025931 Bacteria 13683
248 Ga0207644_10005109 3300025931 Bacteria 8568
249 Ga0207644_10005626 3300025931 Bacteria 8163
250 Ga0207690_10000922 3300025932 Bacteria 18771
251 Ga0207690_10023844 3300025932 Bacteria 3825
252 Ga0207690_10035831 3300025932 Bacteria 3209
253 Ga0207690_10126432 3300025932 Bacteria 1865
254 Ga0207690_10241831 3300025932 Bacteria 1391
255 Ga0207706_10006809 3300025933 Bacteria 10568
256 Ga0207706_10020871 3300025933 Bacteria 5882
257 Ga0207706_10161170 3300025933 Bacteria 1972
258 Ga0207686_10032876 3300025934 Bacteria 3091
259 Ga0207709_10072557 3300025935 Bacteria 2190
260 Ga0207709_10696327 3300025935 Bacteria 813
261 Ga0207670_10483736 3300025936 Bacteria 1003
262 Ga0207669_10017120 3300025937 Bacteria 3708
263 Ga0207669_10017596 3300025937 Bacteria 3672
264 Ga0207669_10044761 3300025937 Bacteria 2603
265 Ga0207669_10389031 3300025937 Bacteria 1089
266 Ga0207669_10631778 3300025937 Unclassified 874
267 Ga0207691_10011944 3300025940 Bacteria 8332
268 Ga0207691_10110493 3300025940 Bacteria 2445
269 Ga0207711_10001646 3300025941 Bacteria 20609
270 Ga0207711_10200378 3300025941 Bacteria 1821
271 Ga0207711_10420388 3300025941 Bacteria 1243
272 Ga0207711_10422611 3300025941 Bacteria 1240
273 Ga0207679_10036640 3300025945 Bacteria 3480
274 Ga0207679_10069531 3300025945 Bacteria 2650
275 Ga0207679_11045729 3300025945 Bacteria 749
276 Ga0207667_10009692 3300025949 Bacteria 11328
277 Ga0207667_10059750 3300025949 Bacteria 3991
278 Ga0207667_10169597 3300025949 Bacteria 2243
279 Ga0207667_10280920 3300025949 Bacteria 1701
280 Ga0207667_10614763 3300025949 Bacteria 1095
281 Ga0207667_11462862 3300025949 Unclassified 655
282 Ga0207651_10008254 3300025960 Bacteria 5613
283 Ga0207651_10022903 3300025960 Bacteria 3831
284 Ga0207651_10909031 3300025960 Bacteria 784
285 Ga0207651_10981374 3300025960 Bacteria 754
286 Ga0207640_10000851 3300025981 Bacteria 17314
287 Ga0207640_10015163 3300025981 Bacteria 4455
288 Ga0207640_10064025 3300025981 Bacteria 2446
289 Ga0207640_10217631 3300025981 Bacteria 1460
290 Ga0207640_10265671 3300025981 Bacteria 1339
291 Ga0207640_10485901 3300025981 Bacteria 1025
292 Ga0207658_10000936 3300025986 Bacteria 24076
293 Ga0207658_10085660 3300025986 Bacteria 2427
294 Ga0207658_10235514 3300025986 Bacteria 1548
295 Ga0207677_10003694 3300026023 Bacteria 8118
296 Ga0207677_10026050 3300026023 Bacteria 3661
297 Ga0207677_10661318 3300026023 Bacteria 923
298 Ga0207677_10901165 3300026023 Bacteria 797
299 Ga0207703_10005275 3300026035 Bacteria 10418
300 Ga0207703_10214932 3300026035 Bacteria 1716
301 Ga0207703_10501632 3300026035 Bacteria 1139
302 Ga0207639_10111791 3300026041 Bacteria 2228
303 Ga0207639_10154611 3300026041 Bacteria 1925
304 Ga0207678_10003177 3300026067 Bacteria 14856
305 Ga0207678_10011197 3300026067 Bacteria 7877
306 Ga0207678_10019862 3300026067 Bacteria 5905
307 Ga0207702_10021703 3300026078 Bacteria 5316
308 Ga0207702_10195585 3300026078 Bacteria 1871
309 Ga0207702_10617327 3300026078 Bacteria 1065
310 Ga0207702_10639117 3300026078 Bacteria 1046
311 Ga0207702_10696850 3300026078 Bacteria 1001
312 Ga0207702_10712964 3300026078 Bacteria 989
313 Ga0207641_10006526 3300026088 Bacteria 9814
314 Ga0207641_10107710 3300026088 Bacteria 2465
315 Ga0207641_11885130 3300026088 Unclassified 599
316 Ga0207648_10044684 3300026089 Bacteria 3887
317 Ga0207676_10216983 3300026095 Bacteria 1701
318 Ga0207674_10001036 3300026116 Bacteria 36260
319 Ga0207674_10142743 3300026116 Bacteria 2354
320 Ga0207674_10573263 3300026116 Bacteria 1090
321 Ga0207683_10007992 3300026121 Bacteria 9046
322 Ga0207683_10026698 3300026121 Bacteria 4987
323 Ga0207683_10081749 3300026121 Bacteria 2868
324 Ga0207698_10000887 3300026142 Bacteria 17369
325 Ga0207698_10003206 3300026142 Bacteria 9824
326 Ga0207698_10245109 3300026142 Bacteria 1636
327 Ga0207698_10246784 3300026142 Bacteria 1631
328 Ga0207698_10486638 3300026142 Bacteria 1198
329 Ga0207698_10573256 3300026142 Bacteria 1109
330 Ga0207698_10845121 3300026142 Bacteria 920
331 Ga0207698_11051733 3300026142 Bacteria 826
332 Ga0207698_11393746 3300026142 Bacteria 716
333 Ga0268266_10214787 3300028379 Bacteria 1765
334 Ga0268266_10286469 3300028379 Bacteria 1533
335 Ga0268264_10266656 3300028381 Bacteria 1598
336 Ga0307408_100427940 3300031548 Bacteria 1143
337 Ga0307405_10938569 3300031731 Bacteria 734
338 Ga0307412_10098314 3300031911 Bacteria 2064
339 Ga0307416_100004801 3300032002 Bacteria 8213
340 Ga0307415_100035538 3300032126 Bacteria 3255
341 Ga0373946_0190077 3300035171 Bacteria 979
342 Ga0373946_0546674 3300035171 Unclassified 597
343 Ga0373961_0295745 3300035241 Unclassified 598
344 Ga0373931_0033030 3300035691 Bacteria 2680
345 Ga0373935_0409411 3300035692 Bacteria 975
346 Ga0373937_0831220 3300036401 Bacteria 872
347 Ga0395899_0002441 3300037312 Bacteria 15108
348 Ga0395899_0022102 3300037312 Bacteria 4823
349 Ga0395899_0412987 3300037312 Bacteria 891
350 Ga0395899_0602904 3300037312 Bacteria 699
351 Ga0395900_0024121 3300037418 Bacteria 6226
352 Ga0395900_0105776 3300037418 Bacteria 2891
353 Ga0395900_0130095 3300037418 Bacteria 2580
354 Ga0395900_0149447 3300037418 Bacteria 2387
355 Ga0395900_0182233 3300037418 Bacteria 2134
356 Ga0395900_0461838 3300037418 Bacteria 1224
357 Ga0395900_0848597 3300037418 Bacteria 839
358 Ga0395900_0855743 3300037418 Bacteria 835
359 Ga0395900_1569032 3300037418 Unclassified 570
360 Ga0395898_0018292 3300037466 Bacteria 7145
361 Ga0395898_0067055 3300037466 Bacteria 3476
362 Ga0395898_0530273 3300037466 Bacteria 1119
363 Ga0395898_0582291 3300037466 Bacteria 1061
364 Ga0395905_0003116 3300037471 Bacteria 17889
365 Ga0395905_0008044 3300037471 Bacteria 10417
366 Ga0395905_0037464 3300037471 Bacteria 4553
367 Ga0395905_0040653 3300037471 Bacteria 4362
368 Ga0395905_0083207 3300037471 Bacteria 2998
369 Ga0395905_0129295 3300037471 Bacteria 2375
370 Ga0395905_0159621 3300037471 Bacteria 2119
371 Ga0395905_0190034 3300037471 Bacteria 1926
372 Ga0395905_0191123 3300037471 Bacteria 1920
373 Ga0395905_0221727 3300037471 Bacteria 1770
374 Ga0395905_0259896 3300037471 Bacteria 1621
375 Ga0395905_0330313 3300037471 Bacteria 1415
376 Ga0395905_0427304 3300037471 Bacteria 1221
377 Ga0395905_0443071 3300037471 Bacteria 1196
378 Ga0395905_0862809 3300037471 Bacteria 808
379 Ga0395905_0989332 3300037471 Bacteria 744
380 Ga0395905_1130139 3300037471 Bacteria 687
381 Ga0395905_1204300 3300037471 Bacteria 661
382 Ga0395901_0024831 3300038443 Bacteria 6151
383 Ga0395901_0052514 3300038443 Bacteria 4236
384 Ga0395901_0181719 3300038443 Bacteria 2206
385 Ga0395901_0208692 3300038443 Bacteria 2045
386 Ga0395901_0496053 3300038443 Bacteria 1243
387 Ga0395901_0501601 3300038443 Bacteria 1235
388 Ga0395901_0556855 3300038443 Bacteria 1161
389 Ga0395901_0808974 3300038443 Bacteria 925
390 Ga0439448_0060502 3300042005 Bacteria 1252
391 Ga0439455_0021264 3300042012 Bacteria 1545
392 Ga0439458_0001847 3300042157 Bacteria 5265
393 Ga0439458_0035912 3300042157 Bacteria 1192
394 Ga0439458_0075280 3300042157 Bacteria 856
395 Ga0466969_0005115 3300044656 Bacteria 6973
396 Ga0466969_0442389 3300044656 Viruses 591
397 Ga0466972_0218065 3300044658 Bacteria 893
398 Ga0466972_0300624 3300044658 Bacteria 750
399 Ga0466965_0108711 3300044683 Bacteria 1424
400 Ga0466966_0000001 3300044684 Bacteria 410376
401 Ga0466966_0023711 3300044684 Bacteria 4015
402 Ga0466961_0405585 3300044693 Bacteria 827
403 Ga0466963_0027895 3300044694 Bacteria 3619
404 Ga0466963_0056161 3300044694 Bacteria 2619
405 Ga0466963_0133890 3300044694 Bacteria 1714
406 Ga0466964_0260968 3300044706 Bacteria 858
407 Ga0466971_0063895 3300044719 Bacteria 1666
408 Ga0466971_0237124 3300044719 Bacteria 867
409 Ga0466971_0248450 3300044719 Bacteria 847
410 Ga0466970_0030134 3300044765 Bacteria 2860
411 Ga0466957_0001445 3300044842 Bacteria 12423
412 Ga0466957_0132006 3300044842 Bacteria 1601
413 Ga0466957_0222029 3300044842 Bacteria 1248
414 Ga0466957_0329798 3300044842 Bacteria 1031
415 Ga0466959_0026026 3300045049 Bacteria 4338
416 Ga0466959_0046437 3300045049 Bacteria 3195
417 Ga0466958_0000112 3300045836 Bacteria 26021
418 Ga0466967_0142517 3300045976 Bacteria 2233
419 Ga0466967_0251480 3300045976 Bacteria 1688
420 Ga0466967_0448217 3300045976 Bacteria 1261
421 Ga0466967_0538725 3300045976 Bacteria 1148
422 Ga0466967_1021617 3300045976 Bacteria 823
423 Ga0495627_021553 3300046453 Bacteria 2135
424 Ga0495638_0000033 3300046460 Bacteria 288195
425 Ga0495583_0002769 3300046506 Bacteria 14466
426 Ga0495632_0002505 3300046519 Bacteria 13925
427 Ga0495648_0000014 3300046524 Bacteria 288365
428 Ga0495621_0001056 3300046539 Bacteria 7053
429 Ga0495633_0055842 3300046558 Bacteria 1856
430 Ga0495633_0079630 3300046558 Bacteria 1525
431 Ga0495656_0146253 3300046615 Bacteria 1138
432 Ga0495625_0303862 3300046660 Bacteria 1020
433 Ga0495670_0002211 3300046691 Bacteria 9613
434 Ga0495671_0000019 3300046692 Bacteria 288186
435 Ga0495673_0000042 3300047469 Bacteria 288018
436 Ga0495681_0081212 3300047470 Bacteria 1447
437 Ga0496100_0023756 3300048903 Bacteria 3730
438 Ga0496101_0010717 3300048904 Bacteria 6060
439 Ga0496102_0431685 3300048905 Bacteria 1237
440 Ga0496102_0446515 3300048905 Bacteria 1213
441 Ga0496104_0291980 3300048907 Bacteria 1543
442 Ga0496105_0056741 3300048908 Bacteria 3233
443 Ga0496107_0180917 3300048910 Bacteria 1565
444 Ga0496109_0115400 3300048912 Bacteria 2498
445 Ga0496109_0858328 3300048912 Bacteria 846
446 Ga0496110_0110987 3300048913 Bacteria 2464
447 Ga0496111_0009406 3300048914 Bacteria 6520
448 Ga0496112_0156129 3300048915 Bacteria 2249
449 Ga0496112_0283177 3300048915 Bacteria 1604
450 Ga0496113_0151439 3300048916 Bacteria 1830
451 Ga0496113_0167037 3300048916 Bacteria 1741
452 Ga0501241_055794 3300049758 Bacteria 787
453 nmdc:mga05p37_491172_c1 3300050507 Bacteria 1411
454 nmdc:mga09592_468588_c1 3300050508 Bacteria 1086
455 Ga0500643_018974 3300053087 Bacteria 2272
456 Ga0500644_0038526 3300053088 Bacteria 1570
457 Ga0500566_0001700 3300053094 Bacteria 12915
458 Ga0500658_0082615 3300053134 Bacteria 1376
459 Ga0500604_0098602 3300053151 Bacteria 961
460 Ga0466962_0111374 3300061719 Bacteria 1318
461 Ga0466962_0294730 3300061719 Bacteria 802

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025937 Ga0207669_10631778 Ga0207669_106317782 144
2 iso_pu_bacteria 2512564014 2512641943 150
3 3300006844 Ga0075428_100169109 Ga0075428_1001691093 152
4 3300009148 Ga0105243_10228121 Ga0105243_102281213 152
5 3300013100 Ga0157373_10531724 Ga0157373_105317242 152
6 iso_pu_bacteria 2919138771 2919141371 152
7 3300046460 Ga0495638_0000033 Ga0495638_0000033_11092_11574 154
8 3300046506 Ga0495583_0002769 Ga0495583_0002769_2919_3401 154
9 3300046519 Ga0495632_0002505 Ga0495632_0002505_2352_2834 154
10 3300046524 Ga0495648_0000014 Ga0495648_0000014_276792_277274 154
11 3300046558 Ga0495633_0055842 Ga0495633_0055842_615_1097 154
12 3300046692 Ga0495671_0000019 Ga0495671_0000019_11311_11793 154
13 3300047469 Ga0495673_0000042 Ga0495673_0000042_11084_11566 154
14 3300050508 nmdc:mga09592_468588_c1 nmdc:mga09592_468588_c1_197_679 154
15 3300053088 Ga0500644_0038526 Ga0500644_0038526_251_733 154
16 3300005985 Ga0081539_10018852 Ga0081539_100188526 155
17 3300037471 Ga0395905_0443071 Ga0395905_0443071_104_610 155
18 3300013104 Ga0157370_10132585 Ga0157370_101325854 156
19 3300037418 Ga0395900_0182233 Ga0395900_0182233_191_661 156
20 3300037471 Ga0395905_0129295 Ga0395905_0129295_46_516 156
21 3300037471 Ga0395905_0190034 Ga0395905_0190034_745_1215 156
22 3300037471 Ga0395905_0191123 Ga0395905_0191123_1121_1591 156
23 3300037471 Ga0395905_1204300 Ga0395905_1204300_42_515 156
24 3300038443 Ga0395901_0181719 Ga0395901_0181719_729_1199 156
25 3300044658 Ga0466972_0218065 Ga0466972_0218065_384_860 156
26 3300046453 Ga0495627_021553 Ga0495627_021553_302_808 156
27 3300046660 Ga0495625_0303862 Ga0495625_0303862_139_645 156
28 3300047470 Ga0495681_0081212 Ga0495681_0081212_468_974 156
29 3300053087 Ga0500643_018974 Ga0500643_018974_1717_2223 156
30 3300053134 Ga0500658_0082615 Ga0500658_0082615_258_764 156
31 3300053151 Ga0500604_0098602 Ga0500604_0098602_338_844 156
32 3300001990 JGI24737J22298_10000144 JGI24737J22298_1000014412 157
33 3300001990 JGI24737J22298_10012849 JGI24737J22298_100128493 157
34 3300005262 Ga0065165_1001810 Ga0065165_100181012 157
35 3300005327 Ga0070658_10050747 Ga0070658_100507472 157
36 3300005327 Ga0070658_10101436 Ga0070658_101014363 157
37 3300005327 Ga0070658_10194288 Ga0070658_101942882 157
38 3300005327 Ga0070658_10606417 Ga0070658_106064171 157
39 3300005327 Ga0070658_10823188 Ga0070658_108231882 157
40 3300005328 Ga0070676_10093173 Ga0070676_100931732 157
41 3300005328 Ga0070676_10304270 Ga0070676_103042702 157
42 3300005328 Ga0070676_10390151 Ga0070676_103901512 157
43 3300005329 Ga0070683_100046510 Ga0070683_1000465106 157
44 3300005330 Ga0070690_100056501 Ga0070690_1000565013 157
45 3300005330 Ga0070690_100115995 Ga0070690_1001159952 157
46 3300005331 Ga0070670_100128482 Ga0070670_1001284822 157
47 3300005334 Ga0068869_101217259 Ga0068869_1012172592 157
48 3300005335 Ga0070666_10000381 Ga0070666_1000038114 157
49 3300005335 Ga0070666_10035612 Ga0070666_100356123 157
50 3300005335 Ga0070666_10040320 Ga0070666_100403203 157
51 3300005336 Ga0070680_100004762 Ga0070680_10000476212 157
52 3300005336 Ga0070680_100060896 Ga0070680_1000608965 157
53 3300005337 Ga0070682_100025660 Ga0070682_1000256602 157
54 3300005338 Ga0068868_100002486 Ga0068868_10000248614 157
55 3300005338 Ga0068868_100012819 Ga0068868_1000128192 157
56 3300005338 Ga0068868_100061996 Ga0068868_1000619963 157
57 3300005338 Ga0068868_100467172 Ga0068868_1004671722 157
58 3300005339 Ga0070660_100046290 Ga0070660_1000462903 157
59 3300005339 Ga0070660_100073099 Ga0070660_1000730993 157
60 3300005339 Ga0070660_100110814 Ga0070660_1001108142 157
61 3300005339 Ga0070660_100202186 Ga0070660_1002021862 157
62 3300005339 Ga0070660_100531370 Ga0070660_1005313702 157
63 3300005339 Ga0070660_100648569 Ga0070660_1006485692 157
64 3300005340 Ga0070689_100496229 Ga0070689_1004962292 157
65 3300005344 Ga0070661_100008823 Ga0070661_1000088238 157
66 3300005344 Ga0070661_100014619 Ga0070661_1000146192 157
67 3300005344 Ga0070661_100022387 Ga0070661_1000223877 157
68 3300005344 Ga0070661_100059054 Ga0070661_1000590543 157
69 3300005344 Ga0070661_100303309 Ga0070661_1003033092 157
70 3300005353 Ga0070669_100227785 Ga0070669_1002277852 157
71 3300005353 Ga0070669_100655807 Ga0070669_1006558072 157
72 3300005355 Ga0070671_100005525 Ga0070671_1000055254 157
73 3300005355 Ga0070671_100018113 Ga0070671_1000181135 157
74 3300005355 Ga0070671_100842376 Ga0070671_1008423762 157
75 3300005356 Ga0070674_100022402 Ga0070674_1000224024 157
76 3300005356 Ga0070674_100072023 Ga0070674_1000720232 157
77 3300005356 Ga0070674_100102133 Ga0070674_1001021332 157
78 3300005356 Ga0070674_100282972 Ga0070674_1002829721 157
79 3300005356 Ga0070674_101025592 Ga0070674_1010255922 157
80 3300005364 Ga0070673_100022395 Ga0070673_1000223957 157
81 3300005364 Ga0070673_100261591 Ga0070673_1002615912 157
82 3300005364 Ga0070673_100593738 Ga0070673_1005937382 157
83 3300005366 Ga0070659_100016142 Ga0070659_1000161427 157
84 3300005366 Ga0070659_100019299 Ga0070659_1000192994 157
85 3300005366 Ga0070659_100081110 Ga0070659_1000811103 157
86 3300005367 Ga0070667_100000915 Ga0070667_10000091510 157
87 3300005367 Ga0070667_100141190 Ga0070667_1001411903 157
88 3300005367 Ga0070667_100692472 Ga0070667_1006924722 157
89 3300005435 Ga0070714_100520140 Ga0070714_1005201402 157
90 3300005435 Ga0070714_100933556 Ga0070714_1009335562 157
91 3300005436 Ga0070713_100323058 Ga0070713_1003230583 157
92 3300005455 Ga0070663_100001101 Ga0070663_1000011013 157
93 3300005455 Ga0070663_100022927 Ga0070663_1000229275 157
94 3300005455 Ga0070663_100224959 Ga0070663_1002249592 157
95 3300005456 Ga0070678_100014296 Ga0070678_1000142964 157
96 3300005456 Ga0070678_100061319 Ga0070678_1000613194 157
97 3300005456 Ga0070678_100072775 Ga0070678_1000727754 157
98 3300005457 Ga0070662_100034607 Ga0070662_1000346074 157
99 3300005457 Ga0070662_100131953 Ga0070662_1001319532 157
100 3300005457 Ga0070662_100221241 Ga0070662_1002212412 157
101 3300005458 Ga0070681_10248312 Ga0070681_102483122 157
102 3300005459 Ga0068867_100378279 Ga0068867_1003782792 157
103 3300005459 Ga0068867_100532467 Ga0068867_1005324672 157
104 3300005466 Ga0070685_10479759 Ga0070685_104797592 157
105 3300005530 Ga0070679_100093706 Ga0070679_1000937064 157
106 3300005539 Ga0068853_100090534 Ga0068853_1000905342 157
107 3300005539 Ga0068853_100231499 Ga0068853_1002314992 157
108 3300005543 Ga0070672_100022583 Ga0070672_1000225834 157
109 3300005543 Ga0070672_100242682 Ga0070672_1002426822 157
110 3300005544 Ga0070686_100099037 Ga0070686_1000990372 157
111 3300005547 Ga0070693_101110373 Ga0070693_1011103731 157
112 3300005548 Ga0070665_100147256 Ga0070665_1001472563 157
113 3300005548 Ga0070665_100285389 Ga0070665_1002853892 157
114 3300005563 Ga0068855_100009575 Ga0068855_1000095755 157
115 3300005563 Ga0068855_100316105 Ga0068855_1003161052 157
116 3300005563 Ga0068855_100545665 Ga0068855_1005456652 157
117 3300005564 Ga0070664_100008493 Ga0070664_1000084938 157
118 3300005564 Ga0070664_100101155 Ga0070664_1001011552 157
119 3300005564 Ga0070664_100976797 Ga0070664_1009767972 157
120 3300005564 Ga0070664_101132389 Ga0070664_1011323892 157
121 3300005577 Ga0068857_100040921 Ga0068857_1000409211 157
122 3300005577 Ga0068857_100140765 Ga0068857_1001407653 157
123 3300005577 Ga0068857_101936253 Ga0068857_1019362531 157
124 3300005578 Ga0068854_100001637 Ga0068854_10000163715 157
125 3300005578 Ga0068854_100063809 Ga0068854_1000638094 157
126 3300005578 Ga0068854_100261207 Ga0068854_1002612072 157
127 3300005578 Ga0068854_100396820 Ga0068854_1003968202 157
128 3300005614 Ga0068856_100059987 Ga0068856_1000599873 157
129 3300005614 Ga0068856_100060724 Ga0068856_1000607242 157
130 3300005616 Ga0068852_100002847 Ga0068852_1000028474 157
131 3300005616 Ga0068852_100022981 Ga0068852_1000229812 157
132 3300005616 Ga0068852_100099856 Ga0068852_1000998562 157
133 3300005616 Ga0068852_100103620 Ga0068852_1001036204 157
134 3300005616 Ga0068852_100300507 Ga0068852_1003005072 157
135 3300005616 Ga0068852_100350532 Ga0068852_1003505323 157
136 3300005616 Ga0068852_100599741 Ga0068852_1005997412 157
137 3300005616 Ga0068852_101583463 Ga0068852_1015834632 157
138 3300005617 Ga0068859_100188195 Ga0068859_1001881952 157
139 3300005618 Ga0068864_100035565 Ga0068864_1000355653 157
140 3300005718 Ga0068866_10018377 Ga0068866_100183773 157
141 3300005718 Ga0068866_10527764 Ga0068866_105277642 157
142 3300005719 Ga0068861_101381505 Ga0068861_1013815052 157
143 3300005834 Ga0068851_10135823 Ga0068851_101358232 157
144 3300005834 Ga0068851_10606539 Ga0068851_106065392 157
145 3300005841 Ga0068863_100010147 Ga0068863_1000101477 157
146 3300005841 Ga0068863_100224276 Ga0068863_1002242762 157
147 3300005842 Ga0068858_100009318 Ga0068858_1000093184 157
148 3300005842 Ga0068858_100256555 Ga0068858_1002565552 157
149 3300005842 Ga0068858_100491797 Ga0068858_1004917972 157
150 3300005843 Ga0068860_100183540 Ga0068860_1001835402 157
151 3300005843 Ga0068860_100301326 Ga0068860_1003013262 157
152 3300005985 Ga0081539_10042585 Ga0081539_100425853 157
153 3300006237 Ga0097621_100086556 Ga0097621_1000865563 157
154 3300006237 Ga0097621_100314677 Ga0097621_1003146772 157
155 3300006358 Ga0068871_100020597 Ga0068871_1000205974 157
156 3300006358 Ga0068871_100174178 Ga0068871_1001741783 157
157 3300006358 Ga0068871_100408092 Ga0068871_1004080922 157
158 3300006881 Ga0068865_100131747 Ga0068865_1001317472 157
159 3300006931 Ga0097620_100188180 Ga0097620_1001881802 157
160 3300009093 Ga0105240_10007571 Ga0105240_100075718 157
161 3300009093 Ga0105240_10094481 Ga0105240_100944813 157
162 3300009093 Ga0105240_10265317 Ga0105240_102653172 157
163 3300009098 Ga0105245_10047843 Ga0105245_100478432 157
164 3300009098 Ga0105245_10138345 Ga0105245_101383453 157
165 3300009101 Ga0105247_10091863 Ga0105247_100918632 157
166 3300009147 Ga0114129_10212862 Ga0114129_102128624 157
167 3300009148 Ga0105243_10804231 Ga0105243_108042312 157
168 3300009174 Ga0105241_10578205 Ga0105241_105782052 157
169 3300009176 Ga0105242_10041050 Ga0105242_100410504 157
170 3300009177 Ga0105248_10000673 Ga0105248_1000067337 157
171 3300009177 Ga0105248_10342047 Ga0105248_103420472 157
172 3300009177 Ga0105248_11026183 Ga0105248_110261832 157
173 3300009545 Ga0105237_10803195 Ga0105237_108031952 157
174 3300009551 Ga0105238_10064511 Ga0105238_100645114 157
175 3300009551 Ga0105238_10649883 Ga0105238_106498832 157
176 3300009551 Ga0105238_11831332 Ga0105238_118313322 157
177 3300010375 Ga0105239_10107698 Ga0105239_101076983 157
178 3300010375 Ga0105239_10143409 Ga0105239_101434092 157
179 3300010375 Ga0105239_10198198 Ga0105239_101981983 157
180 3300010375 Ga0105239_11367307 Ga0105239_113673071 157
181 3300011119 Ga0105246_10032313 Ga0105246_100323134 157
182 3300013100 Ga0157373_10096582 Ga0157373_100965823 157
183 3300013100 Ga0157373_10107055 Ga0157373_101070553 157
184 3300013100 Ga0157373_10134864 Ga0157373_101348642 157
185 3300013100 Ga0157373_10255868 Ga0157373_102558682 157
186 3300013100 Ga0157373_10480876 Ga0157373_104808762 157
187 3300013100 Ga0157373_10600657 Ga0157373_106006572 157
188 3300013102 Ga0157371_10001435 Ga0157371_1000143511 157
189 3300013102 Ga0157371_10855660 Ga0157371_108556602 157
190 3300013102 Ga0157371_11123510 Ga0157371_111235102 157
191 3300013104 Ga0157370_10121442 Ga0157370_101214422 157
192 3300013104 Ga0157370_10150980 Ga0157370_101509803 157
193 3300013104 Ga0157370_10249516 Ga0157370_102495162 157
194 3300013104 Ga0157370_10490961 Ga0157370_104909612 157
195 3300013104 Ga0157370_10624436 Ga0157370_106244362 157
196 3300013104 Ga0157370_11426601 Ga0157370_114266012 157
197 3300013105 Ga0157369_10001012 Ga0157369_100010125 157
198 3300013105 Ga0157369_10004172 Ga0157369_100041725 157
199 3300013105 Ga0157369_10062380 Ga0157369_100623805 157
200 3300013105 Ga0157369_10127823 Ga0157369_101278232 157
201 3300013105 Ga0157369_10200913 Ga0157369_102009132 157
202 3300013105 Ga0157369_10397111 Ga0157369_103971112 157
203 3300013105 Ga0157369_10397112 Ga0157369_103971122 157
204 3300013105 Ga0157369_10489157 Ga0157369_104891572 157
205 3300013105 Ga0157369_11550261 Ga0157369_115502612 157
206 3300013105 Ga0157369_11773992 Ga0157369_117739922 157
207 3300013296 Ga0157374_10009049 Ga0157374_100090495 157
208 3300013296 Ga0157374_10090064 Ga0157374_100900642 157
209 3300013296 Ga0157374_10373641 Ga0157374_103736412 157
210 3300013297 Ga0157378_10245844 Ga0157378_102458442 157
211 3300013297 Ga0157378_10308583 Ga0157378_103085832 157
212 3300013297 Ga0157378_10407210 Ga0157378_104072102 157
213 3300013297 Ga0157378_10468798 Ga0157378_104687982 157
214 3300013306 Ga0163162_10165733 Ga0163162_101657333 157
215 3300013306 Ga0163162_10507834 Ga0163162_105078342 157
216 3300013307 Ga0157372_10134336 Ga0157372_101343366 157
217 3300013307 Ga0157372_11681603 Ga0157372_116816032 157
218 3300013307 Ga0157372_11805079 Ga0157372_118050792 157
219 3300013308 Ga0157375_10093202 Ga0157375_100932022 157
220 3300013308 Ga0157375_10435314 Ga0157375_104353141 157
221 3300013308 Ga0157375_10569695 Ga0157375_105696952 157
222 3300013308 Ga0157375_11680984 Ga0157375_116809842 157
223 3300014325 Ga0163163_10020664 Ga0163163_100206642 157
224 3300014745 Ga0157377_10048533 Ga0157377_100485333 157
225 3300014745 Ga0157377_10049358 Ga0157377_100493583 157
226 3300014968 Ga0157379_10130489 Ga0157379_101304893 157
227 3300014968 Ga0157379_10138892 Ga0157379_101388922 157
228 3300014969 Ga0157376_10006910 Ga0157376_100069109 157
229 3300020070 Ga0206356_10268529 Ga0206356_102685292 157
230 3300025321 Ga0207656_10134133 Ga0207656_101341332 157
231 3300025903 Ga0207680_10000492 Ga0207680_1000049217 157
232 3300025903 Ga0207680_10468645 Ga0207680_104686452 157
233 3300025904 Ga0207647_10026542 Ga0207647_100265423 157
234 3300025904 Ga0207647_10079983 Ga0207647_100799832 157
235 3300025904 Ga0207647_10150911 Ga0207647_101509112 157
236 3300025904 Ga0207647_10215334 Ga0207647_102153341 157
237 3300025907 Ga0207645_10014996 Ga0207645_100149962 157
238 3300025907 Ga0207645_10113522 Ga0207645_101135222 157
239 3300025909 Ga0207705_10000003 Ga0207705_10000003537 157
240 3300025909 Ga0207705_10345385 Ga0207705_103453852 157
241 3300025909 Ga0207705_10375516 Ga0207705_103755162 157
242 3300025909 Ga0207705_10402127 Ga0207705_104021272 157
243 3300025912 Ga0207707_10140757 Ga0207707_101407573 157
244 3300025912 Ga0207707_10348674 Ga0207707_103486741 157
245 3300025913 Ga0207695_10005303 Ga0207695_1000530315 157
246 3300025913 Ga0207695_10005548 Ga0207695_100055488 157
247 3300025913 Ga0207695_10244973 Ga0207695_102449734 157
248 3300025917 Ga0207660_10000186 Ga0207660_1000018630 157
249 3300025917 Ga0207660_10071570 Ga0207660_100715705 157
250 3300025917 Ga0207660_10253892 Ga0207660_102538922 157
251 3300025919 Ga0207657_10012677 Ga0207657_1001267710 157
252 3300025919 Ga0207657_10050297 Ga0207657_100502973 157
253 3300025919 Ga0207657_10088302 Ga0207657_100883022 157
254 3300025919 Ga0207657_10142019 Ga0207657_101420193 157
255 3300025919 Ga0207657_10663291 Ga0207657_106632912 157
256 3300025920 Ga0207649_10001220 Ga0207649_1000122016 157
257 3300025920 Ga0207649_10010955 Ga0207649_100109558 157
258 3300025920 Ga0207649_10030809 Ga0207649_100308095 157
259 3300025920 Ga0207649_10179420 Ga0207649_101794202 157
260 3300025920 Ga0207649_11448937 Ga0207649_114489371 157
261 3300025921 Ga0207652_10170405 Ga0207652_101704052 157
262 3300025923 Ga0207681_10257801 Ga0207681_102578012 157
263 3300025924 Ga0207694_10085599 Ga0207694_100855994 157
264 3300025924 Ga0207694_10164129 Ga0207694_101641292 157
265 3300025925 Ga0207650_10034633 Ga0207650_100346334 157
266 3300025926 Ga0207659_10123633 Ga0207659_101236332 157
267 3300025927 Ga0207687_10136802 Ga0207687_101368022 157
268 3300025928 Ga0207700_10034763 Ga0207700_100347634 157
269 3300025929 Ga0207664_10005541 Ga0207664_100055419 157
270 3300025929 Ga0207664_10214003 Ga0207664_102140032 157
271 3300025929 Ga0207664_10698572 Ga0207664_106985722 157
272 3300025929 Ga0207664_10898365 Ga0207664_108983652 157
273 3300025931 Ga0207644_10001877 Ga0207644_100018778 157
274 3300025931 Ga0207644_10005109 Ga0207644_100051096 157
275 3300025931 Ga0207644_10005626 Ga0207644_100056265 157
276 3300025932 Ga0207690_10000922 Ga0207690_100009225 157
277 3300025932 Ga0207690_10023844 Ga0207690_100238442 157
278 3300025932 Ga0207690_10035831 Ga0207690_100358312 157
279 3300025932 Ga0207690_10126432 Ga0207690_101264323 157
280 3300025932 Ga0207690_10241831 Ga0207690_102418312 157
281 3300025933 Ga0207706_10006809 Ga0207706_100068094 157
282 3300025933 Ga0207706_10020871 Ga0207706_100208714 157
283 3300025933 Ga0207706_10161170 Ga0207706_101611702 157
284 3300025934 Ga0207686_10032876 Ga0207686_100328762 157
285 3300025935 Ga0207709_10072557 Ga0207709_100725572 157
286 3300025935 Ga0207709_10696327 Ga0207709_106963272 157
287 3300025936 Ga0207670_10483736 Ga0207670_104837362 157
288 3300025937 Ga0207669_10017120 Ga0207669_100171204 157
289 3300025937 Ga0207669_10017596 Ga0207669_100175963 157
290 3300025937 Ga0207669_10044761 Ga0207669_100447613 157
291 3300025937 Ga0207669_10389031 Ga0207669_103890311 157
292 3300025940 Ga0207691_10011944 Ga0207691_100119444 157
293 3300025940 Ga0207691_10110493 Ga0207691_101104934 157
294 3300025941 Ga0207711_10001646 Ga0207711_100016463 157
295 3300025941 Ga0207711_10200378 Ga0207711_102003782 157
296 3300025941 Ga0207711_10420388 Ga0207711_104203882 157
297 3300025941 Ga0207711_10422611 Ga0207711_104226112 157
298 3300025945 Ga0207679_10036640 Ga0207679_100366405 157
299 3300025945 Ga0207679_10069531 Ga0207679_100695313 157
300 3300025945 Ga0207679_11045729 Ga0207679_110457292 157
301 3300025949 Ga0207667_10009692 Ga0207667_1000969213 157
302 3300025949 Ga0207667_10059750 Ga0207667_100597504 157
303 3300025949 Ga0207667_10169597 Ga0207667_101695974 157
304 3300025949 Ga0207667_10280920 Ga0207667_102809201 157
305 3300025949 Ga0207667_10614763 Ga0207667_106147632 157
306 3300025949 Ga0207667_11462862 Ga0207667_114628621 157
307 3300025960 Ga0207651_10008254 Ga0207651_100082547 157
308 3300025960 Ga0207651_10022903 Ga0207651_100229034 157
309 3300025960 Ga0207651_10909031 Ga0207651_109090312 157
310 3300025960 Ga0207651_10981374 Ga0207651_109813742 157
311 3300025981 Ga0207640_10000851 Ga0207640_100008516 157
312 3300025981 Ga0207640_10015163 Ga0207640_100151636 157
313 3300025981 Ga0207640_10064025 Ga0207640_100640253 157
314 3300025981 Ga0207640_10217631 Ga0207640_102176312 157
315 3300025981 Ga0207640_10265671 Ga0207640_102656712 157
316 3300025981 Ga0207640_10485901 Ga0207640_104859012 157
317 3300025986 Ga0207658_10000936 Ga0207658_100009364 157
318 3300025986 Ga0207658_10085660 Ga0207658_100856603 157
319 3300025986 Ga0207658_10235514 Ga0207658_102355142 157
320 3300026023 Ga0207677_10003694 Ga0207677_100036949 157
321 3300026023 Ga0207677_10026050 Ga0207677_100260502 157
322 3300026023 Ga0207677_10661318 Ga0207677_106613182 157
323 3300026023 Ga0207677_10901165 Ga0207677_109011652 157
324 3300026035 Ga0207703_10005275 Ga0207703_100052753 157
325 3300026035 Ga0207703_10214932 Ga0207703_102149322 157
326 3300026035 Ga0207703_10501632 Ga0207703_105016322 157
327 3300026041 Ga0207639_10111791 Ga0207639_101117914 157
328 3300026041 Ga0207639_10154611 Ga0207639_101546112 157
329 3300026067 Ga0207678_10003177 Ga0207678_100031773 157
330 3300026067 Ga0207678_10011197 Ga0207678_100111973 157
331 3300026067 Ga0207678_10019862 Ga0207678_100198622 157
332 3300026078 Ga0207702_10021703 Ga0207702_100217033 157
333 3300026078 Ga0207702_10195585 Ga0207702_101955852 157
334 3300026078 Ga0207702_10617327 Ga0207702_106173272 157
335 3300026078 Ga0207702_10639117 Ga0207702_106391172 157
336 3300026078 Ga0207702_10696850 Ga0207702_106968502 157
337 3300026078 Ga0207702_10712964 Ga0207702_107129642 157
338 3300026088 Ga0207641_10006526 Ga0207641_100065262 157
339 3300026088 Ga0207641_10107710 Ga0207641_101077103 157
340 3300026088 Ga0207641_11885130 Ga0207641_118851301 157
341 3300026089 Ga0207648_10044684 Ga0207648_100446842 157
342 3300026095 Ga0207676_10216983 Ga0207676_102169832 157
343 3300026116 Ga0207674_10001036 Ga0207674_1000103624 157
344 3300026116 Ga0207674_10142743 Ga0207674_101427434 157
345 3300026116 Ga0207674_10573263 Ga0207674_105732632 157
346 3300026121 Ga0207683_10007992 Ga0207683_1000799210 157
347 3300026121 Ga0207683_10026698 Ga0207683_100266984 157
348 3300026121 Ga0207683_10081749 Ga0207683_100817494 157
349 3300026142 Ga0207698_10000887 Ga0207698_1000088722 157
350 3300026142 Ga0207698_10003206 Ga0207698_100032062 157
351 3300026142 Ga0207698_10245109 Ga0207698_102451092 157
352 3300026142 Ga0207698_10246784 Ga0207698_102467842 157
353 3300026142 Ga0207698_10486638 Ga0207698_104866382 157
354 3300026142 Ga0207698_10573256 Ga0207698_105732562 157
355 3300026142 Ga0207698_10845121 Ga0207698_108451212 157
356 3300026142 Ga0207698_11051733 Ga0207698_110517331 157
357 3300026142 Ga0207698_11393746 Ga0207698_113937462 157
358 3300028379 Ga0268266_10214787 Ga0268266_102147872 157
359 3300028379 Ga0268266_10286469 Ga0268266_102864691 157
360 3300028381 Ga0268264_10266656 Ga0268264_102666562 157
361 3300031548 Ga0307408_100427940 Ga0307408_1004279402 157
362 3300031731 Ga0307405_10938569 Ga0307405_109385691 157
363 3300031911 Ga0307412_10098314 Ga0307412_100983142 157
364 3300032002 Ga0307416_100004801 Ga0307416_1000048018 157
365 3300032126 Ga0307415_100035538 Ga0307415_1000355384 157
366 3300035171 Ga0373946_0190077 Ga0373946_0190077_296_769 157
367 3300035171 Ga0373946_0546674 Ga0373946_0546674_37_510 157
368 3300035241 Ga0373961_0295745 Ga0373961_0295745_14_487 157
369 3300035691 Ga0373931_0033030 Ga0373931_0033030_1813_2286 157
370 3300035692 Ga0373935_0409411 Ga0373935_0409411_460_933 157
371 3300036401 Ga0373937_0831220 Ga0373937_0831220_328_801 157
372 3300037312 Ga0395899_0002441 Ga0395899_0002441_3109_3585 157
373 3300037312 Ga0395899_0022102 Ga0395899_0022102_17_493 157
374 3300037312 Ga0395899_0412987 Ga0395899_0412987_114_587 157
375 3300037312 Ga0395899_0602904 Ga0395899_0602904_24_497 157
376 3300037418 Ga0395900_0024121 Ga0395900_0024121_4232_4708 157
377 3300037418 Ga0395900_0105776 Ga0395900_0105776_1932_2405 157
378 3300037418 Ga0395900_0130095 Ga0395900_0130095_1266_1742 157
379 3300037418 Ga0395900_0149447 Ga0395900_0149447_1339_1812 157
380 3300037418 Ga0395900_0461838 Ga0395900_0461838_512_985 157
381 3300037418 Ga0395900_0848597 Ga0395900_0848597_257_733 157
382 3300037418 Ga0395900_0855743 Ga0395900_0855743_138_614 157
383 3300037418 Ga0395900_1569032 Ga0395900_1569032_32_505 157
384 3300037466 Ga0395898_0018292 Ga0395898_0018292_5320_5796 157
385 3300037466 Ga0395898_0067055 Ga0395898_0067055_1944_2417 157
386 3300037466 Ga0395898_0530273 Ga0395898_0530273_494_967 157
387 3300037466 Ga0395898_0582291 Ga0395898_0582291_80_556 157
388 3300037471 Ga0395905_0003116 Ga0395905_0003116_7895_8368 157
389 3300037471 Ga0395905_0008044 Ga0395905_0008044_495_968 157
390 3300037471 Ga0395905_0037464 Ga0395905_0037464_4029_4502 157
391 3300037471 Ga0395905_0040653 Ga0395905_0040653_813_1286 157
392 3300037471 Ga0395905_0083207 Ga0395905_0083207_2062_2535 157
393 3300037471 Ga0395905_0159621 Ga0395905_0159621_650_1126 157
394 3300037471 Ga0395905_0221727 Ga0395905_0221727_363_839 157
395 3300037471 Ga0395905_0259896 Ga0395905_0259896_707_1183 157
396 3300037471 Ga0395905_0330313 Ga0395905_0330313_30_503 157
397 3300037471 Ga0395905_0427304 Ga0395905_0427304_492_965 157
398 3300037471 Ga0395905_0862809 Ga0395905_0862809_86_559 157
399 3300037471 Ga0395905_0989332 Ga0395905_0989332_41_517 157
400 3300037471 Ga0395905_1130139 Ga0395905_1130139_152_625 157
401 3300038443 Ga0395901_0024831 Ga0395901_0024831_4919_5395 157
402 3300038443 Ga0395901_0052514 Ga0395901_0052514_2068_2544 157
403 3300038443 Ga0395901_0208692 Ga0395901_0208692_486_959 157
404 3300038443 Ga0395901_0496053 Ga0395901_0496053_429_902 157
405 3300038443 Ga0395901_0501601 Ga0395901_0501601_461_934 157
406 3300038443 Ga0395901_0556855 Ga0395901_0556855_435_908 157
407 3300038443 Ga0395901_0808974 Ga0395901_0808974_244_720 157
408 3300042005 Ga0439448_0060502 Ga0439448_0060502_199_672 157
409 3300042012 Ga0439455_0021264 Ga0439455_0021264_171_644 157
410 3300042157 Ga0439458_0001847 Ga0439458_0001847_2677_3150 157
411 3300042157 Ga0439458_0035912 Ga0439458_0035912_404_877 157
412 3300042157 Ga0439458_0075280 Ga0439458_0075280_364_837 157
413 3300044656 Ga0466969_0005115 Ga0466969_0005115_5843_6319 157
414 3300044656 Ga0466969_0442389 Ga0466969_0442389_55_543 157
415 3300044658 Ga0466972_0300624 Ga0466972_0300624_227_703 157
416 3300044683 Ga0466965_0108711 Ga0466965_0108711_878_1357 157
417 3300044684 Ga0466966_0000001 Ga0466966_0000001_354494_354970 157
418 3300044684 Ga0466966_0023711 Ga0466966_0023711_3049_3525 157
419 3300044693 Ga0466961_0405585 Ga0466961_0405585_85_561 157
420 3300044694 Ga0466963_0027895 Ga0466963_0027895_740_1228 157
421 3300044694 Ga0466963_0056161 Ga0466963_0056161_982_1458 157
422 3300044694 Ga0466963_0133890 Ga0466963_0133890_237_713 157
423 3300044706 Ga0466964_0260968 Ga0466964_0260968_265_741 157
424 3300044719 Ga0466971_0063895 Ga0466971_0063895_1136_1612 157
425 3300044719 Ga0466971_0237124 Ga0466971_0237124_55_531 157
426 3300044719 Ga0466971_0248450 Ga0466971_0248450_145_621 157
427 3300044765 Ga0466970_0030134 Ga0466970_0030134_1881_2357 157
428 3300044842 Ga0466957_0001445 Ga0466957_0001445_1421_1897 157
429 3300044842 Ga0466957_0132006 Ga0466957_0132006_771_1247 157
430 3300044842 Ga0466957_0222029 Ga0466957_0222029_35_511 157
431 3300044842 Ga0466957_0329798 Ga0466957_0329798_118_594 157
432 3300045049 Ga0466959_0026026 Ga0466959_0026026_744_1220 157
433 3300045049 Ga0466959_0046437 Ga0466959_0046437_175_651 157
434 3300045836 Ga0466958_0000112 Ga0466958_0000112_20009_20485 157
435 3300045976 Ga0466967_0142517 Ga0466967_0142517_380_856 157
436 3300045976 Ga0466967_0251480 Ga0466967_0251480_392_868 157
437 3300045976 Ga0466967_0448217 Ga0466967_0448217_466_942 157
438 3300045976 Ga0466967_0538725 Ga0466967_0538725_620_1096 157
439 3300045976 Ga0466967_1021617 Ga0466967_1021617_311_787 157
440 3300046539 Ga0495621_0001056 Ga0495621_0001056_1619_2092 157
441 3300046558 Ga0495633_0079630 Ga0495633_0079630_284_757 157
442 3300046615 Ga0495656_0146253 Ga0495656_0146253_424_948 157
443 3300046691 Ga0495670_0002211 Ga0495670_0002211_3383_3856 157
444 3300048903 Ga0496100_0023756 Ga0496100_0023756_1230_1703 157
445 3300048904 Ga0496101_0010717 Ga0496101_0010717_946_1419 157
446 3300048905 Ga0496102_0431685 Ga0496102_0431685_423_899 157
447 3300048905 Ga0496102_0446515 Ga0496102_0446515_336_809 157
448 3300048907 Ga0496104_0291980 Ga0496104_0291980_807_1280 157
449 3300048908 Ga0496105_0056741 Ga0496105_0056741_2139_2612 157
450 3300048910 Ga0496107_0180917 Ga0496107_0180917_575_1048 157
451 3300048912 Ga0496109_0115400 Ga0496109_0115400_1803_2276 157
452 3300048912 Ga0496109_0858328 Ga0496109_0858328_202_678 157
453 3300048913 Ga0496110_0110987 Ga0496110_0110987_1448_1921 157
454 3300048914 Ga0496111_0009406 Ga0496111_0009406_4232_4705 157
455 3300048915 Ga0496112_0156129 Ga0496112_0156129_1610_2083 157
456 3300048915 Ga0496112_0283177 Ga0496112_0283177_229_702 157
457 3300048916 Ga0496113_0151439 Ga0496113_0151439_305_778 157
458 3300048916 Ga0496113_0167037 Ga0496113_0167037_359_832 157
459 3300049758 Ga0501241_055794 Ga0501241_055794_215_724 157
460 3300050507 nmdc:mga05p37_491172_c1 nmdc:mga05p37_491172_c1_229_705 157
461 3300053094 Ga0500566_0001700 Ga0500566_0001700_11943_12452 157
462 3300061719 Ga0466962_0111374 Ga0466962_0111374_71_547 157
463 3300061719 Ga0466962_0294730 Ga0466962_0294730_142_618 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

27

119

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8999 4 138
1giu-assembly1.cif.gz_A a trichosanthin(tcs) mutant(e85r) complex structure with adenine 0.8419 60 88
2vs6-assembly1.cif.gz_A k173a, r174a, k177a-trichosanthin 0.8396 60 87
2jjr-assembly1.cif.gz_A v232k, n236d-trichosanthin 0.8317 60 91
1j1r-assembly1.cif.gz_A structure of pokeweed antiviral protein from seeds (pap-s1) complexed with adenine 0.8317 60 87
ID Description Score Start End Superfamily
1j1qA01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.838 60 87 3.40.420.10
4z8sA01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8185 60 88 3.40.420.10
3i8bA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8097 58 88 3.30.420.40
af_A0A1D6EGE5_12_199_3.40.420.10 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8072 59 92 3.40.420.10
3ku0B01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8052 60 90 3.40.420.10
ID Description Score Start End GO Terms
AF-A0A840YTG0-F1-model_v4 CENP-V/GFA domain-containing protein 0.9853 2 154 GO:0016846
GO:0046872
AF-A0A7C7X5B5-F1-model_v4 GFA family protein 0.9731 4 87 GO:0016846
GO:0046872
AF-A0A6L8CWT2-F1-model_v4 GFA family protein 0.9704 6 138 GO:0016846
GO:0046872
AF-A0A7W5QQL3-F1-model_v4 CENP-V/GFA domain-containing protein 0.9669 6 157 GO:0016846
GO:0046872
AF-A0A1Z8V7M3-F1-model_v4 CENP-V/GFA domain-containing protein 0.9624 5 153 GO:0016846
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.2 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map