F449101

General Info

Members Datasets Scaffolds Average Seq Length
463 208 926 247

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10024393|Ga0105247_100243937
Length 277
Sequence MLLPDAKSLAANSRFAFSIVQFVSLATFPMRYLILTDIHANLEALDSCLADARSRGYDRTLVLGDVVGYGADPNAVIERIQRLEPHAIVRGNHDKVSCGIEQADGFNSVARGAARWTLDVLTPEHRNWLAALPEGPNEVDDLLEICHGSPFDEDAYIFDELDAARALKATTRPLCLYGHTHYAAVFELLSEGSLDSASLTESIQNRVAIVEGSKHLINPGSVGQPRDGDPRAAYAIVDEATRQVELFRMNYPVAQAQAKIMKAGLPEVLAHRLALGR

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
144 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
145 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
146 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
147 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
148 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
149 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
150 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
154 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
155 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.67
Rhizosphere 96.33
Stem 0
Stem Tuber 0
Unclassified 7.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10024393 3300009101 Bacteria 3644
2 JGI24751J29686_10032245 3300002459 Bacteria 1086
3 Ga0065712_10085521 3300005290 Bacteria 2692
4 Ga0065715_10344503 3300005293 Bacteria 961
5 Ga0065707_10051220 3300005295 Bacteria 813
6 Ga0065707_10134382 3300005295 Bacteria 1866
7 Ga0070683_100353631 3300005329 Archaea 1399
8 Ga0070690_100010265 3300005330 Bacteria 5445
9 Ga0070690_100111663 3300005330 Bacteria 1825
10 Ga0070670_100672922 3300005331 Bacteria 929
11 Ga0070677_10197177 3300005333 Bacteria 969
12 Ga0068869_100565659 3300005334 Bacteria 957
13 Ga0070666_10003490 3300005335 Bacteria 9528
14 Ga0070666_10099024 3300005335 Unclassified 2008
15 Ga0070666_10142130 3300005335 Bacteria 1672
16 Ga0070666_10530575 3300005335 Bacteria 855
17 Ga0070680_100152881 3300005336 Bacteria 1938
18 Ga0070680_100408208 3300005336 Bacteria 1158
19 Ga0068868_100591049 3300005338 Unclassified 982
20 Ga0070689_100153365 3300005340 Bacteria 1859
21 Ga0070691_10004098 3300005341 Bacteria 6610
22 Ga0070687_100017924 3300005343 Bacteria 3266
23 Ga0070692_10203118 3300005345 Bacteria 1162
24 Ga0070668_100049260 3300005347 Bacteria 3241
25 Ga0070668_100064373 3300005347 Bacteria 2843
26 Ga0070669_100005838 3300005353 Bacteria 8876
27 Ga0070669_100251378 3300005353 Bacteria 1408
28 Ga0070671_100446152 3300005355 Bacteria 1110
29 Ga0070673_100271434 3300005364 Bacteria 1485
30 Ga0070673_100287949 3300005364 Bacteria 1443
31 Ga0070688_100092799 3300005365 Bacteria 1975
32 Ga0070688_100181877 3300005365 Bacteria 1459
33 Ga0070667_100345194 3300005367 Bacteria 1347
34 Ga0070714_100044763 3300005435 Bacteria 3748
35 Ga0070701_10003054 3300005438 Bacteria 6558
36 Ga0070705_100054859 3300005440 Bacteria 2340
37 Ga0070705_100203673 3300005440 Bacteria 1359
38 Ga0070700_100006054 3300005441 Bacteria 6442
39 Ga0070694_100037935 3300005444 Bacteria 3198
40 Ga0070694_100045671 3300005444 Bacteria 2937
41 Ga0070708_100005041 3300005445 Bacteria 10448
42 Ga0070708_100103093 3300005445 Bacteria 2615
43 Ga0070662_100217816 3300005457 Unclassified 1522
44 Ga0070662_100313717 3300005457 Bacteria 1277
45 Ga0070662_100801518 3300005457 Bacteria 801
46 Ga0068867_100044799 3300005459 Bacteria 3242
47 Ga0068867_100228510 3300005459 Bacteria 1503
48 Ga0068867_100278338 3300005459 Bacteria 1371
49 Ga0068867_100664131 3300005459 Bacteria 916
50 Ga0070685_10235310 3300005466 Bacteria 1207
51 Ga0070706_100115027 3300005467 Archaea 2505
52 Ga0070706_100488824 3300005467 Bacteria 1145
53 Ga0070706_100565360 3300005467 Bacteria 1057
54 Ga0070707_100004788 3300005468 Bacteria 12668
55 Ga0070707_100071465 3300005468 Bacteria 3343
56 Ga0070707_100089123 3300005468 Unclassified 2985
57 Ga0070707_100110252 3300005468 Unclassified 2669
58 Ga0070707_100181579 3300005468 Bacteria 2051
59 Ga0070698_100003713 3300005471 Bacteria 16761
60 Ga0070698_100024556 3300005471 Bacteria 6288
61 Ga0070698_100081128 3300005471 Bacteria 3239
62 Ga0070698_100305826 3300005471 Bacteria 1521
63 Ga0070698_100645128 3300005471 Unclassified 1000
64 Ga0070698_100688647 3300005471 Bacteria 964
65 Ga0070698_100746073 3300005471 Bacteria 922
66 Ga0070698_100891905 3300005471 Bacteria 835
67 Ga0070699_100025795 3300005518 Bacteria 5065
68 Ga0070699_100162852 3300005518 Bacteria 1975
69 Ga0070699_100337005 3300005518 Unclassified 1357
70 Ga0070699_100542700 3300005518 Bacteria 1058
71 Ga0070679_100004328 3300005530 Bacteria 13110
72 Ga0070679_100807853 3300005530 Bacteria 881
73 Ga0070697_100033754 3300005536 Bacteria 4123
74 Ga0070697_100178311 3300005536 Bacteria 1800
75 Ga0070697_100288981 3300005536 Bacteria 1408
76 Ga0070697_100401718 3300005536 Bacteria 1189
77 Ga0070697_100482537 3300005536 Bacteria 1082
78 Ga0070697_100487450 3300005536 Bacteria 1077
79 Ga0070697_100715715 3300005536 Bacteria 884
80 Ga0070686_100005500 3300005544 Bacteria 7013
81 Ga0070686_100171532 3300005544 Bacteria 1534
82 Ga0070686_100207377 3300005544 Bacteria 1409
83 Ga0070686_100366311 3300005544 Bacteria 1087
84 Ga0070686_100593964 3300005544 Bacteria 871
85 Ga0070695_100015039 3300005545 Bacteria 4670
86 Ga0070695_100131194 3300005545 Bacteria 1727
87 Ga0070695_100158409 3300005545 Bacteria 1587
88 Ga0070696_100001361 3300005546 Bacteria 15950
89 Ga0070696_100083458 3300005546 Bacteria 2266
90 Ga0070696_100091601 3300005546 Bacteria 2165
91 Ga0070696_100335688 3300005546 Bacteria 1167
92 Ga0070665_100004096 3300005548 Bacteria 15330
93 Ga0070665_100010345 3300005548 Bacteria 9437
94 Ga0070665_100011519 3300005548 Bacteria 8942
95 Ga0070665_100488838 3300005548 Bacteria 1242
96 Ga0070704_100002953 3300005549 Bacteria 9667
97 Ga0070704_100046270 3300005549 Bacteria 3033
98 Ga0070704_100102145 3300005549 Bacteria 2163
99 Ga0068855_100018161 3300005563 Bacteria 8450
100 Ga0068855_100616310 3300005563 Bacteria 1169
101 Ga0070664_100303160 3300005564 Bacteria 1444
102 Ga0068854_100006103 3300005578 Bacteria 7642
103 Ga0068854_100114013 3300005578 Bacteria 2043
104 Ga0068856_100151072 3300005614 Bacteria 2332
105 Ga0070702_100001099 3300005615 Bacteria 10833
106 Ga0068852_101063073 3300005616 Bacteria 829
107 Ga0068859_100364345 3300005617 Bacteria 1540
108 Ga0068859_100491725 3300005617 Bacteria 1322
109 Ga0068859_100792872 3300005617 Bacteria 1035
110 Ga0068864_100016872 3300005618 Bacteria 6086
111 Ga0068866_10012435 3300005718 Bacteria 3707
112 Ga0068866_10043658 3300005718 Bacteria 2238
113 Ga0068861_100080769 3300005719 Bacteria 2544
114 Ga0068861_100163772 3300005719 Bacteria 1837
115 Ga0068863_100002257 3300005841 Bacteria 19143
116 Ga0068863_100124394 3300005841 Bacteria 2460
117 Ga0068858_100001428 3300005842 Bacteria 24559
118 Ga0068858_100014942 3300005842 Bacteria 7305
119 Ga0068858_100073151 3300005842 Bacteria 3182
120 Ga0068858_100093951 3300005842 Bacteria 2792
121 Ga0068858_100137424 3300005842 Bacteria 2294
122 Ga0068858_100325774 3300005842 Bacteria 1469
123 Ga0068860_100050453 3300005843 Bacteria 3961
124 Ga0068860_100098940 3300005843 Bacteria 2782
125 Ga0068862_100005972 3300005844 Bacteria 10138
126 Ga0068862_100130029 3300005844 Bacteria 2226
127 Ga0068862_100950498 3300005844 Bacteria 847
128 Ga0081455_10177875 3300005937 Bacteria 1614
129 Ga0081539_10008987 3300005985 Bacteria 8496
130 Ga0070715_10045922 3300006163 Bacteria 1855
131 Ga0070716_100101878 3300006173 Bacteria 1762
132 Ga0097621_100010914 3300006237 Bacteria 6669
133 Ga0097621_100075013 3300006237 Bacteria 2802
134 Ga0097621_100224123 3300006237 Bacteria 1639
135 Ga0097621_100669532 3300006237 Unclassified 953
136 Ga0068871_100001956 3300006358 Bacteria 13947
137 Ga0068871_100012864 3300006358 Bacteria 6195
138 Ga0068871_100016255 3300006358 Bacteria 5598
139 Ga0075428_100075948 3300006844 Bacteria 3668
140 Ga0075428_100186927 3300006844 Bacteria 2241
141 Ga0075428_100749797 3300006844 Bacteria 1039
142 Ga0075430_100003696 3300006846 Bacteria 12853
143 Ga0075430_100251724 3300006846 Bacteria 1464
144 Ga0075431_100018461 3300006847 Bacteria 7104
145 Ga0075431_100131499 3300006847 Bacteria 2581
146 Ga0075433_10013088 3300006852 Bacteria 6731
147 Ga0075433_10024243 3300006852 Bacteria 5118
148 Ga0075433_10027252 3300006852 Bacteria 4844
149 Ga0075433_10134827 3300006852 Bacteria 2195
150 Ga0075433_10139667 3300006852 Bacteria 2153
151 Ga0075433_10150431 3300006852 Unclassified 2071
152 Ga0075433_10368728 3300006852 Bacteria 1268
153 Ga0075434_100001183 3300006871 Bacteria 21620
154 Ga0075434_100006581 3300006871 Bacteria 10658
155 Ga0075434_100011242 3300006871 Bacteria 8430
156 Ga0075434_100046396 3300006871 Bacteria 4312
157 Ga0075434_100251960 3300006871 Bacteria 1785
158 Ga0075434_100283221 3300006871 Bacteria 1677
159 Ga0075434_100308362 3300006871 Bacteria 1603
160 Ga0075429_100201209 3300006880 Bacteria 1745
161 Ga0075429_100439138 3300006880 Unclassified 1144
162 Ga0068865_100010622 3300006881 Bacteria 5737
163 Ga0075436_100005080 3300006914 Bacteria 9059
164 Ga0075436_100020657 3300006914 Bacteria 4519
165 Ga0075436_100059183 3300006914 Bacteria 2646
166 Ga0075436_100206814 3300006914 Bacteria 1391
167 Ga0075436_100362999 3300006914 Bacteria 1045
168 Ga0097620_100364356 3300006931 Bacteria 1540
169 Ga0097620_100491743 3300006931 Bacteria 1322
170 Ga0097620_100793005 3300006931 Bacteria 1035
171 Ga0075435_100000008 3300007076 Bacteria 115376
172 Ga0075435_100001910 3300007076 Bacteria 13570
173 Ga0075435_100011368 3300007076 Bacteria 6545
174 Ga0075435_100011981 3300007076 Bacteria 6405
175 Ga0075435_100068971 3300007076 Bacteria 2882
176 Ga0075435_100199146 3300007076 Bacteria 1697
177 Ga0105240_10038302 3300009093 Bacteria 6151
178 Ga0105240_10340464 3300009093 Unclassified 1704
179 Ga0111539_10003450 3300009094 Bacteria 20823
180 Ga0111539_10006587 3300009094 Bacteria 14967
181 Ga0111539_10043126 3300009094 Bacteria 5410
182 Ga0111539_11007720 3300009094 Bacteria 968
183 Ga0105245_10003782 3300009098 Bacteria 13463
184 Ga0105245_10020965 3300009098 Bacteria 5730
185 Ga0105247_10064380 3300009101 Bacteria 2277
186 Ga0114129_10006542 3300009147 Bacteria 16534
187 Ga0114129_10009350 3300009147 Bacteria 13978
188 Ga0114129_10011319 3300009147 Bacteria 12708
189 Ga0114129_10012599 3300009147 Bacteria 12038
190 Ga0114129_10034494 3300009147 Bacteria 7147
191 Ga0114129_10184578 3300009147 Bacteria 2836
192 Ga0114129_10227777 3300009147 Unclassified 2511
193 Ga0114129_10245922 3300009147 Bacteria 2403
194 Ga0114129_11107450 3300009147 Unclassified 991
195 Ga0105243_10096575 3300009148 Bacteria 2445
196 Ga0105241_10067820 3300009174 Bacteria 2762
197 Ga0105242_10004014 3300009176 Bacteria 11443
198 Ga0105242_10046496 3300009176 Bacteria 3521
199 Ga0105242_10139795 3300009176 Bacteria 2100
200 Ga0105242_10228035 3300009176 Bacteria 1668
201 Ga0105242_10432576 3300009176 Bacteria 1236
202 Ga0105248_10006611 3300009177 Bacteria 12704
203 Ga0105248_10007428 3300009177 Bacteria 12026
204 Ga0105248_10046497 3300009177 Bacteria 4865
205 Ga0105248_10056344 3300009177 Bacteria 4410
206 Ga0105248_10079020 3300009177 Unclassified 3697
207 Ga0105248_10128811 3300009177 Unclassified 2855
208 Ga0105248_10185603 3300009177 Bacteria 2343
209 Ga0105248_10750377 3300009177 Unclassified 1101
210 Ga0105248_10795735 3300009177 Bacteria 1067
211 Ga0105237_10749194 3300009545 Unclassified 983
212 Ga0105238_10773499 3300009551 Bacteria 975
213 Ga0105238_11119158 3300009551 Bacteria 810
214 Ga0105249_10545613 3300009553 Bacteria 1209
215 Ga0105249_10890556 3300009553 Bacteria 957
216 Ga0157370_10520466 3300013104 Bacteria 1092
217 Ga0157370_10617370 3300013104 Bacteria 992
218 Ga0157369_10019498 3300013105 Bacteria 7589
219 Ga0157374_10027250 3300013296 Bacteria 5151
220 Ga0163162_10241169 3300013306 Bacteria 1939
221 Ga0157372_10054097 3300013307 Bacteria 4476
222 Ga0157372_10065379 3300013307 Unclassified 4083
223 Ga0157375_10204260 3300013308 Bacteria 2132
224 Ga0163163_10027265 3300014325 Bacteria 5471
225 Ga0163163_10058119 3300014325 Bacteria 3824
226 Ga0163163_10134151 3300014325 Bacteria 2516
227 Ga0157380_10369559 3300014326 Bacteria 1349
228 Ga0157380_11091923 3300014326 Bacteria 836
229 Ga0157379_10027097 3300014968 Bacteria 5101
230 Ga0157379_10032645 3300014968 Bacteria 4642
231 Ga0157379_10045663 3300014968 Bacteria 3910
232 Ga0157379_10167112 3300014968 Bacteria 1986
233 Ga0157376_10016216 3300014969 Bacteria 5649
234 Ga0157376_10237213 3300014969 Bacteria 1697
235 Ga0157376_10598373 3300014969 Unclassified 1097
236 Ga0207653_10125004 3300025885 Bacteria 929
237 Ga0207682_10230185 3300025893 Bacteria 859
238 Ga0207642_10163938 3300025899 Bacteria 1196
239 Ga0207642_10279200 3300025899 Bacteria 960
240 Ga0207710_10015338 3300025900 Bacteria 3235
241 Ga0207710_10037267 3300025900 Bacteria 2147
242 Ga0207680_10011112 3300025903 Bacteria 4535
243 Ga0207680_10276266 3300025903 Unclassified 1166
244 Ga0207680_10521562 3300025903 Bacteria 847
245 Ga0207699_10391727 3300025906 Bacteria 988
246 Ga0207645_10250156 3300025907 Bacteria 1172
247 Ga0207684_10062169 3300025910 Bacteria 3170
248 Ga0207684_10364470 3300025910 Bacteria 1243
249 Ga0207654_10088801 3300025911 Bacteria 1879
250 Ga0207695_10000001 3300025913 Bacteria 2888630
251 Ga0207695_10461104 3300025913 Archaea 1154
252 Ga0207662_10026316 3300025918 Bacteria 3355
253 Ga0207657_10003677 3300025919 Bacteria 16315
254 Ga0207649_10155571 3300025920 Bacteria 1579
255 Ga0207652_10022714 3300025921 Bacteria 5194
256 Ga0207646_10001551 3300025922 Bacteria 28141
257 Ga0207646_10009882 3300025922 Bacteria 9386
258 Ga0207646_10014317 3300025922 Bacteria 7537
259 Ga0207646_10035864 3300025922 Bacteria 4477
260 Ga0207646_10113402 3300025922 Unclassified 2434
261 Ga0207681_10017964 3300025923 Bacteria 4448
262 Ga0207681_10116855 3300025923 Unclassified 1949
263 Ga0207681_10234963 3300025923 Bacteria 1424
264 Ga0207681_10310008 3300025923 Bacteria 1251
265 Ga0207659_10019572 3300025926 Bacteria 4459
266 Ga0207687_10081706 3300025927 Bacteria 2336
267 Ga0207687_10156089 3300025927 Bacteria 1746
268 Ga0207687_10248582 3300025927 Unclassified 1413
269 Ga0207687_10351436 3300025927 Bacteria 1201
270 Ga0207687_10380838 3300025927 Bacteria 1156
271 Ga0207664_10325243 3300025929 Unclassified 1357
272 Ga0207706_10100553 3300025933 Bacteria 2544
273 Ga0207706_10130674 3300025933 Bacteria 2209
274 Ga0207706_10194864 3300025933 Bacteria 1777
275 Ga0207706_10496201 3300025933 Bacteria 1054
276 Ga0207686_10086694 3300025934 Bacteria 2057
277 Ga0207686_10240536 3300025934 Bacteria 1317
278 Ga0207686_10331049 3300025934 Bacteria 1141
279 Ga0207709_10229828 3300025935 Bacteria 1343
280 Ga0207669_10235358 3300025937 Bacteria 1354
281 Ga0207704_10006485 3300025938 Bacteria 5460
282 Ga0207704_10014235 3300025938 Bacteria 4011
283 Ga0207665_10199779 3300025939 Bacteria 1456
284 Ga0207691_10004926 3300025940 Bacteria 12887
285 Ga0207691_10112539 3300025940 Bacteria 2419
286 Ga0207711_10020073 3300025941 Bacteria 5569
287 Ga0207711_10025916 3300025941 Bacteria 4917
288 Ga0207711_10123013 3300025941 Bacteria 2318
289 Ga0207711_10181527 3300025941 Bacteria 1914
290 Ga0207711_10351786 3300025941 Bacteria 1364
291 Ga0207679_10423939 3300025945 Bacteria 1175
292 Ga0207667_10022641 3300025949 Bacteria 6933
293 Ga0207667_10453054 3300025949 Bacteria 1304
294 Ga0207667_10661095 3300025949 Bacteria 1050
295 Ga0207651_10037515 3300025960 Bacteria 3176
296 Ga0207651_10262602 3300025960 Bacteria 1418
297 Ga0207712_10323852 3300025961 Bacteria 1273
298 Ga0207668_10028688 3300025972 Bacteria 3642
299 Ga0207668_10356496 3300025972 Bacteria 1224
300 Ga0207640_10164570 3300025981 Bacteria 1645
301 Ga0207658_10088509 3300025986 Bacteria 2394
302 Ga0207658_10499453 3300025986 Bacteria 1083
303 Ga0207703_10051723 3300026035 Bacteria 3331
304 Ga0207703_10057287 3300026035 Bacteria 3177
305 Ga0207703_10126904 3300026035 Bacteria 2198
306 Ga0207703_10283592 3300026035 Bacteria 1505
307 Ga0207639_10179108 3300026041 Bacteria 1802
308 Ga0207708_10001521 3300026075 Bacteria 17284
309 Ga0207708_10147910 3300026075 Bacteria 1847
310 Ga0207708_10180456 3300026075 Bacteria 1676
311 Ga0207708_10610435 3300026075 Bacteria 925
312 Ga0207641_10007977 3300026088 Bacteria 8774
313 Ga0207641_10325144 3300026088 Bacteria 1459
314 Ga0207648_10023142 3300026089 Bacteria 5572
315 Ga0207648_10191075 3300026089 Bacteria 1814
316 Ga0207648_10192258 3300026089 Bacteria 1809
317 Ga0207648_10415567 3300026089 Bacteria 1221
318 Ga0207676_10029446 3300026095 Bacteria 4112
319 Ga0207676_10075636 3300026095 Bacteria 2717
320 Ga0207675_100001331 3300026118 Bacteria 24758
321 Ga0207675_100005581 3300026118 Bacteria 12044
322 Ga0207675_100055336 3300026118 Bacteria 3701
323 Ga0207675_100138954 3300026118 Bacteria 2307
324 Ga0207675_100172076 3300026118 Bacteria 2070
325 Ga0207675_100260299 3300026118 Bacteria 1681
326 Ga0207675_100625168 3300026118 Bacteria 1081
327 Ga0207683_10231526 3300026121 Bacteria 1685
328 Ga0207698_10477319 3300026142 Bacteria 1209
329 Ga0207428_10030736 3300027907 Bacteria 4438
330 Ga0268266_10029439 3300028379 Bacteria 4668
331 Ga0268266_10039082 3300028379 Bacteria 4041
332 Ga0268266_10365808 3300028379 Unclassified 1358
333 Ga0268266_10421695 3300028379 Unclassified 1264
334 Ga0268265_10008531 3300028380 Bacteria 6928
335 Ga0268265_10052294 3300028380 Bacteria 3088
336 Ga0268265_10330379 3300028380 Bacteria 1384
337 Ga0268265_10464163 3300028380 Bacteria 1185
338 Ga0268265_10513476 3300028380 Bacteria 1131
339 Ga0268264_10064622 3300028381 Bacteria 3080
340 Ga0268264_10277715 3300028381 Unclassified 1568
341 Ga0268264_10785448 3300028381 Bacteria 950
342 Ga0265314_10033627 3300031711 Bacteria 3756
343 Ga0373930_0017791 3300034816 Bacteria 1359
344 Ga0373938_0009333 3300034957 Bacteria 1775
345 Ga0373928_0009312 3300035084 Bacteria 1917
346 Ga0373929_0000502 3300035085 Bacteria 7465
347 Ga0373940_0000645 3300035088 Bacteria 5586
348 Ga0373949_0000399 3300035090 Bacteria 15152
349 Ga0373949_0032570 3300035090 Bacteria 1249
350 Ga0373951_0001040 3300035091 Bacteria 7458
351 Ga0373952_0000331 3300035092 Bacteria 7976
352 Ga0373932_0000231 3300035112 Bacteria 16798
353 Ga0373939_0036089 3300035114 Bacteria 1460
354 Ga0373941_0054787 3300035115 Bacteria 1279
355 Ga0373941_0118997 3300035115 Bacteria 940
356 Ga0373960_0000360 3300035121 Bacteria 8779
357 Ga0373962_0002778 3300035242 Bacteria 4173
358 Ga0373931_0023627 3300035691 Bacteria 3105
359 Ga0373935_0168809 3300035692 Bacteria 1496
360 Ga0373947_0264315 3300035725 Bacteria 1141
361 Ga0373937_0347030 3300036401 Bacteria 1406
362 Ga0395900_0039648 3300037418 Bacteria 4853
363 Ga0395905_0234890 3300037471 Bacteria 1714
364 Ga0395901_0086292 3300038443 Bacteria 3282
365 Ga0466963_0123660 3300044694 Bacteria 1782
366 Ga0451576_0018648 3300045051 Bacteria 7592
367 Ga0451576_0043286 3300045051 Bacteria 4752
368 Ga0451576_0144354 3300045051 Bacteria 2482
369 Ga0466967_0625966 3300045976 Unclassified 1063
370 Ga0495603_0123427 3300046455 Bacteria 1509
371 Ga0495651_0109353 3300046462 Bacteria 2046
372 Ga0495582_0220184 3300046473 Bacteria 1086
373 Ga0495662_0155160 3300046476 Bacteria 1128
374 Ga0495628_0235516 3300046516 Bacteria 1371
375 Ga0495628_0361101 3300046516 Bacteria 1066
376 Ga0495642_0214571 3300046528 Bacteria 840
377 Ga0495645_0001226 3300046543 Bacteria 17513
378 Ga0495645_0027182 3300046543 Bacteria 4155
379 Ga0495599_0025207 3300046678 Bacteria 3722
380 Ga0495599_0149018 3300046678 Unclassified 1450
381 Ga0495658_0058731 3300046683 Bacteria 2201
382 Ga0495658_0381096 3300046683 Bacteria 898
383 Ga0495684_0171481 3300047471 Bacteria 1613
384 Ga0495684_0347025 3300047471 Bacteria 1055
385 Ga0495602_0415181 3300048088 Bacteria 957
386 Ga0496102_0067322 3300048905 Bacteria 3285
387 Ga0496104_0076790 3300048907 Bacteria 3182
388 Ga0496104_0276011 3300048907 Unclassified 1594
389 Ga0496105_0293386 3300048908 Unclassified 1309
390 Ga0496106_0376089 3300048909 Unclassified 1142
391 Ga0496107_0155927 3300048910 Bacteria 1691
392 Ga0496109_0066075 3300048912 Bacteria 3311
393 Ga0496109_0747674 3300048912 Bacteria 916
394 Ga0496112_0027457 3300048915 Bacteria 5488
395 Ga0496112_0038425 3300048915 Bacteria 4673
396 Ga0496112_0691832 3300048915 Bacteria 948
397 Ga0496113_0035755 3300048916 Bacteria 3635
398 Ga0496113_0464119 3300048916 Bacteria 1017
399 Ga0496114_0021164 3300048917 Bacteria 5289
400 Ga0496114_0063177 3300048917 Bacteria 3100
401 Ga0496114_0259317 3300048917 Bacteria 1530
402 Ga0496115_0451740 3300048918 Bacteria 1038
403 Ga0501042_0055265 3300049578 Bacteria 2833
404 Ga0501075_0018331 3300049591 Bacteria 5065
405 Ga0501075_0134461 3300049591 Bacteria 1884
406 Ga0501077_0119376 3300049593 Unclassified 1671
407 Ga0501079_0377558 3300049741 Bacteria 1111
408 Ga0501081_0013751 3300049743 Bacteria 5324
409 Ga0501083_0013003 3300049744 Bacteria 5817
410 Ga0501035_0603965 3300049822 Archaea 894
411 Ga0501045_0100777 3300049824 Bacteria 2138
412 nmdc:mga05p37_102324_c1 3300050507 Bacteria 3528
413 nmdc:mga05p37_103752_c1 3300050507 Archaea 3499
414 nmdc:mga05p37_111353_c1 3300050507 Bacteria 3367
415 nmdc:mga05p37_122258_c1 3300050507 Bacteria 3197
416 nmdc:mga05p37_13937_c1 3300050507 Bacteria 9638
417 nmdc:mga05p37_186975_c1 3300050507 Bacteria 2518
418 nmdc:mga05p37_26091_c1 3300050507 Bacteria 7105
419 nmdc:mga05p37_387866_c1 3300050507 Unclassified 1634
420 nmdc:mga05p37_44993_c1 3300050507 Bacteria 5431
421 nmdc:mga05p37_9112_c1 3300050507 Bacteria 11730
422 nmdc:mga09592_497920_c1 3300050508 Bacteria 1049
423 nmdc:mga0qj67_225056_c1 3300050509 Bacteria 1523
424 nmdc:mga06r32_40444_c1 3300050510 Bacteria 4427
425 nmdc:mga06r32_89526_c1 3300050510 Bacteria 3005
426 nmdc:mga08y16_115909_c2 3300050511 Bacteria 1747
427 nmdc:mga08y16_5173_c1 3300050511 Bacteria 13621
428 nmdc:mga08y16_9793_c1 3300050511 Bacteria 10058
429 nmdc:mga0n895_118516_c1 3300050512 Archaea 2667
430 nmdc:mga0n895_182006_c1 3300050512 Bacteria 2133
431 nmdc:mga0n895_29201_c1 3300050512 Bacteria 5256
432 nmdc:mga0n895_313381_c1 3300050512 Bacteria 1590
433 nmdc:mga0n895_348_c1 3300050512 Bacteria 31051
434 nmdc:mga0n895_45459_c1 3300050512 Bacteria 4285
435 nmdc:mga0n895_800523_c1 3300050512 Archaea 933
436 nmdc:mga0rr50_18756_c1 3300050513 Bacteria 4655
437 nmdc:mga0rr50_27081_c1 3300050513 Bacteria 4009
438 nmdc:mga0rr50_2792_c1 3300050513 Bacteria 9928
439 nmdc:mga0rr50_294597_c1 3300050513 Archaea 1356
440 nmdc:mga0rr50_32601_c1 3300050513 Bacteria 3714
441 nmdc:mga0rr50_3_c1 3300050513 Bacteria 353622
442 nmdc:mga0rr50_42898_c1 3300050513 Bacteria 3307
443 nmdc:mga0rr50_4306_c1 3300050513 Bacteria 8339
444 nmdc:mga08x19_133_c1 3300050514 Bacteria 66107
445 nmdc:mga08x19_16032_c1 3300050514 Bacteria 4566
446 nmdc:mga08x19_16201_c1 3300050514 Bacteria 4544
447 nmdc:mga08x19_340410_c1 3300050514 Bacteria 1046
448 nmdc:mga08x19_392290_c1 3300050514 Bacteria 973
449 nmdc:mga08x19_42997_c1 3300050514 Bacteria 2882
450 nmdc:mga08x19_580430_c1 3300050514 Bacteria 794
451 nmdc:mga0a205_207890_c1 3300050515 Bacteria 1846
452 nmdc:mga0a205_225235_c1 3300050515 Unclassified 1760
453 nmdc:mga0a205_226562_c1 3300050515 Bacteria 1754
454 nmdc:mga0a205_23780_c1 3300050515 Bacteria 5815
455 nmdc:mga0a205_44048_c1 3300050515 Bacteria 4301
456 Ga0495601_0042251 3300053077 Bacteria 2860
457 Ga0495595_0046787 3300053084 Bacteria 1994
458 Ga0495619_0035954 3300053085 Bacteria 3224
459 Ga0495619_0107865 3300053085 Bacteria 1900
460 Ga0501082_0017226 3300060353 Bacteria 6225
461 Ga0501082_0074048 3300060353 Bacteria 2933
462 Ga0501082_0489358 3300060353 Bacteria 1075
463 Ga0530510_0069805 3300061734 Archaea 2550
464 Ga0105247_10024393
465 JGI24751J29686_10032245
466 Ga0065712_10085521
467 Ga0065715_10344503
468 Ga0065707_10051220
469 Ga0065707_10134382
470 Ga0070683_100353631
471 Ga0070690_100010265
472 Ga0070690_100111663
473 Ga0070670_100672922
474 Ga0070677_10197177
475 Ga0068869_100565659
476 Ga0070666_10003490
477 Ga0070666_10099024
478 Ga0070666_10142130
479 Ga0070666_10530575
480 Ga0070680_100152881
481 Ga0070680_100408208
482 Ga0068868_100591049
483 Ga0070689_100153365
484 Ga0070691_10004098
485 Ga0070687_100017924
486 Ga0070692_10203118
487 Ga0070668_100049260
488 Ga0070668_100064373
489 Ga0070669_100005838
490 Ga0070669_100251378
491 Ga0070671_100446152
492 Ga0070673_100271434
493 Ga0070673_100287949
494 Ga0070688_100092799
495 Ga0070688_100181877
496 Ga0070667_100345194
497 Ga0070714_100044763
498 Ga0070701_10003054
499 Ga0070705_100054859
500 Ga0070705_100203673
501 Ga0070700_100006054
502 Ga0070694_100037935
503 Ga0070694_100045671
504 Ga0070708_100005041
505 Ga0070708_100103093
506 Ga0070662_100217816
507 Ga0070662_100313717
508 Ga0070662_100801518
509 Ga0068867_100044799
510 Ga0068867_100228510
511 Ga0068867_100278338
512 Ga0068867_100664131
513 Ga0070685_10235310
514 Ga0070706_100115027
515 Ga0070706_100488824
516 Ga0070706_100565360
517 Ga0070707_100004788
518 Ga0070707_100071465
519 Ga0070707_100089123
520 Ga0070707_100110252
521 Ga0070707_100181579
522 Ga0070698_100003713
523 Ga0070698_100024556
524 Ga0070698_100081128
525 Ga0070698_100305826
526 Ga0070698_100645128
527 Ga0070698_100688647
528 Ga0070698_100746073
529 Ga0070698_100891905
530 Ga0070699_100025795
531 Ga0070699_100162852
532 Ga0070699_100337005
533 Ga0070699_100542700
534 Ga0070679_100004328
535 Ga0070679_100807853
536 Ga0070697_100033754
537 Ga0070697_100178311
538 Ga0070697_100288981
539 Ga0070697_100401718
540 Ga0070697_100482537
541 Ga0070697_100487450
542 Ga0070697_100715715
543 Ga0070686_100005500
544 Ga0070686_100171532
545 Ga0070686_100207377
546 Ga0070686_100366311
547 Ga0070686_100593964
548 Ga0070695_100015039
549 Ga0070695_100131194
550 Ga0070695_100158409
551 Ga0070696_100001361
552 Ga0070696_100083458
553 Ga0070696_100091601
554 Ga0070696_100335688
555 Ga0070665_100004096
556 Ga0070665_100010345
557 Ga0070665_100011519
558 Ga0070665_100488838
559 Ga0070704_100002953
560 Ga0070704_100046270
561 Ga0070704_100102145
562 Ga0068855_100018161
563 Ga0068855_100616310
564 Ga0070664_100303160
565 Ga0068854_100006103
566 Ga0068854_100114013
567 Ga0068856_100151072
568 Ga0070702_100001099
569 Ga0068852_101063073
570 Ga0068859_100364345
571 Ga0068859_100491725
572 Ga0068859_100792872
573 Ga0068864_100016872
574 Ga0068866_10012435
575 Ga0068866_10043658
576 Ga0068861_100080769
577 Ga0068861_100163772
578 Ga0068863_100002257
579 Ga0068863_100124394
580 Ga0068858_100001428
581 Ga0068858_100014942
582 Ga0068858_100073151
583 Ga0068858_100093951
584 Ga0068858_100137424
585 Ga0068858_100325774
586 Ga0068860_100050453
587 Ga0068860_100098940
588 Ga0068862_100005972
589 Ga0068862_100130029
590 Ga0068862_100950498
591 Ga0081455_10177875
592 Ga0081539_10008987
593 Ga0070715_10045922
594 Ga0070716_100101878
595 Ga0097621_100010914
596 Ga0097621_100075013
597 Ga0097621_100224123
598 Ga0097621_100669532
599 Ga0068871_100001956
600 Ga0068871_100012864
601 Ga0068871_100016255
602 Ga0075428_100075948
603 Ga0075428_100186927
604 Ga0075428_100749797
605 Ga0075430_100003696
606 Ga0075430_100251724
607 Ga0075431_100018461
608 Ga0075431_100131499
609 Ga0075433_10013088
610 Ga0075433_10024243
611 Ga0075433_10027252
612 Ga0075433_10134827
613 Ga0075433_10139667
614 Ga0075433_10150431
615 Ga0075433_10368728
616 Ga0075434_100001183
617 Ga0075434_100006581
618 Ga0075434_100011242
619 Ga0075434_100046396
620 Ga0075434_100251960
621 Ga0075434_100283221
622 Ga0075434_100308362
623 Ga0075429_100201209
624 Ga0075429_100439138
625 Ga0068865_100010622
626 Ga0075436_100005080
627 Ga0075436_100020657
628 Ga0075436_100059183
629 Ga0075436_100206814
630 Ga0075436_100362999
631 Ga0097620_100364356
632 Ga0097620_100491743
633 Ga0097620_100793005
634 Ga0075435_100000008
635 Ga0075435_100001910
636 Ga0075435_100011368
637 Ga0075435_100011981
638 Ga0075435_100068971
639 Ga0075435_100199146
640 Ga0105240_10038302
641 Ga0105240_10340464
642 Ga0111539_10003450
643 Ga0111539_10006587
644 Ga0111539_10043126
645 Ga0111539_11007720
646 Ga0105245_10003782
647 Ga0105245_10020965
648 Ga0105247_10064380
649 Ga0114129_10006542
650 Ga0114129_10009350
651 Ga0114129_10011319
652 Ga0114129_10012599
653 Ga0114129_10034494
654 Ga0114129_10184578
655 Ga0114129_10227777
656 Ga0114129_10245922
657 Ga0114129_11107450
658 Ga0105243_10096575
659 Ga0105241_10067820
660 Ga0105242_10004014
661 Ga0105242_10046496
662 Ga0105242_10139795
663 Ga0105242_10228035
664 Ga0105242_10432576
665 Ga0105248_10006611
666 Ga0105248_10007428
667 Ga0105248_10046497
668 Ga0105248_10056344
669 Ga0105248_10079020
670 Ga0105248_10128811
671 Ga0105248_10185603
672 Ga0105248_10750377
673 Ga0105248_10795735
674 Ga0105237_10749194
675 Ga0105238_10773499
676 Ga0105238_11119158
677 Ga0105249_10545613
678 Ga0105249_10890556
679 Ga0157370_10520466
680 Ga0157370_10617370
681 Ga0157369_10019498
682 Ga0157374_10027250
683 Ga0163162_10241169
684 Ga0157372_10054097
685 Ga0157372_10065379
686 Ga0157375_10204260
687 Ga0163163_10027265
688 Ga0163163_10058119
689 Ga0163163_10134151
690 Ga0157380_10369559
691 Ga0157380_11091923
692 Ga0157379_10027097
693 Ga0157379_10032645
694 Ga0157379_10045663
695 Ga0157379_10167112
696 Ga0157376_10016216
697 Ga0157376_10237213
698 Ga0157376_10598373
699 Ga0207653_10125004
700 Ga0207682_10230185
701 Ga0207642_10163938
702 Ga0207642_10279200
703 Ga0207710_10015338
704 Ga0207710_10037267
705 Ga0207680_10011112
706 Ga0207680_10276266
707 Ga0207680_10521562
708 Ga0207699_10391727
709 Ga0207645_10250156
710 Ga0207684_10062169
711 Ga0207684_10364470
712 Ga0207654_10088801
713 Ga0207695_10000001
714 Ga0207695_10461104
715 Ga0207662_10026316
716 Ga0207657_10003677
717 Ga0207649_10155571
718 Ga0207652_10022714
719 Ga0207646_10001551
720 Ga0207646_10009882
721 Ga0207646_10014317
722 Ga0207646_10035864
723 Ga0207646_10113402
724 Ga0207681_10017964
725 Ga0207681_10116855
726 Ga0207681_10234963
727 Ga0207681_10310008
728 Ga0207659_10019572
729 Ga0207687_10081706
730 Ga0207687_10156089
731 Ga0207687_10248582
732 Ga0207687_10351436
733 Ga0207687_10380838
734 Ga0207664_10325243
735 Ga0207706_10100553
736 Ga0207706_10130674
737 Ga0207706_10194864
738 Ga0207706_10496201
739 Ga0207686_10086694
740 Ga0207686_10240536
741 Ga0207686_10331049
742 Ga0207709_10229828
743 Ga0207669_10235358
744 Ga0207704_10006485
745 Ga0207704_10014235
746 Ga0207665_10199779
747 Ga0207691_10004926
748 Ga0207691_10112539
749 Ga0207711_10020073
750 Ga0207711_10025916
751 Ga0207711_10123013
752 Ga0207711_10181527
753 Ga0207711_10351786
754 Ga0207679_10423939
755 Ga0207667_10022641
756 Ga0207667_10453054
757 Ga0207667_10661095
758 Ga0207651_10037515
759 Ga0207651_10262602
760 Ga0207712_10323852
761 Ga0207668_10028688
762 Ga0207668_10356496
763 Ga0207640_10164570
764 Ga0207658_10088509
765 Ga0207658_10499453
766 Ga0207703_10051723
767 Ga0207703_10057287
768 Ga0207703_10126904
769 Ga0207703_10283592
770 Ga0207639_10179108
771 Ga0207708_10001521
772 Ga0207708_10147910
773 Ga0207708_10180456
774 Ga0207708_10610435
775 Ga0207641_10007977
776 Ga0207641_10325144
777 Ga0207648_10023142
778 Ga0207648_10191075
779 Ga0207648_10192258
780 Ga0207648_10415567
781 Ga0207676_10029446
782 Ga0207676_10075636
783 Ga0207675_100001331
784 Ga0207675_100005581
785 Ga0207675_100055336
786 Ga0207675_100138954
787 Ga0207675_100172076
788 Ga0207675_100260299
789 Ga0207675_100625168
790 Ga0207683_10231526
791 Ga0207698_10477319
792 Ga0207428_10030736
793 Ga0268266_10029439
794 Ga0268266_10039082
795 Ga0268266_10365808
796 Ga0268266_10421695
797 Ga0268265_10008531
798 Ga0268265_10052294
799 Ga0268265_10330379
800 Ga0268265_10464163
801 Ga0268265_10513476
802 Ga0268264_10064622
803 Ga0268264_10277715
804 Ga0268264_10785448
805 Ga0265314_10033627
806 Ga0373930_0017791
807 Ga0373938_0009333
808 Ga0373928_0009312
809 Ga0373929_0000502
810 Ga0373940_0000645
811 Ga0373949_0000399
812 Ga0373949_0032570
813 Ga0373951_0001040
814 Ga0373952_0000331
815 Ga0373932_0000231
816 Ga0373939_0036089
817 Ga0373941_0054787
818 Ga0373941_0118997
819 Ga0373960_0000360
820 Ga0373962_0002778
821 Ga0373931_0023627
822 Ga0373935_0168809
823 Ga0373947_0264315
824 Ga0373937_0347030
825 Ga0395900_0039648
826 Ga0395905_0234890
827 Ga0395901_0086292
828 Ga0466963_0123660
829 Ga0451576_0018648
830 Ga0451576_0043286
831 Ga0451576_0144354
832 Ga0466967_0625966
833 Ga0495603_0123427
834 Ga0495651_0109353
835 Ga0495582_0220184
836 Ga0495662_0155160
837 Ga0495628_0235516
838 Ga0495628_0361101
839 Ga0495642_0214571
840 Ga0495645_0001226
841 Ga0495645_0027182
842 Ga0495599_0025207
843 Ga0495599_0149018
844 Ga0495658_0058731
845 Ga0495658_0381096
846 Ga0495684_0171481
847 Ga0495684_0347025
848 Ga0495602_0415181
849 Ga0496102_0067322
850 Ga0496104_0076790
851 Ga0496104_0276011
852 Ga0496105_0293386
853 Ga0496106_0376089
854 Ga0496107_0155927
855 Ga0496109_0066075
856 Ga0496109_0747674
857 Ga0496112_0027457
858 Ga0496112_0038425
859 Ga0496112_0691832
860 Ga0496113_0035755
861 Ga0496113_0464119
862 Ga0496114_0021164
863 Ga0496114_0063177
864 Ga0496114_0259317
865 Ga0496115_0451740
866 Ga0501042_0055265
867 Ga0501075_0018331
868 Ga0501075_0134461
869 Ga0501077_0119376
870 Ga0501079_0377558
871 Ga0501081_0013751
872 Ga0501083_0013003
873 Ga0501035_0603965
874 Ga0501045_0100777
875 nmdc:mga05p37_102324_c1
876 nmdc:mga05p37_103752_c1
877 nmdc:mga05p37_111353_c1
878 nmdc:mga05p37_122258_c1
879 nmdc:mga05p37_13937_c1
880 nmdc:mga05p37_186975_c1
881 nmdc:mga05p37_26091_c1
882 nmdc:mga05p37_387866_c1
883 nmdc:mga05p37_44993_c1
884 nmdc:mga05p37_9112_c1
885 nmdc:mga09592_497920_c1
886 nmdc:mga0qj67_225056_c1
887 nmdc:mga06r32_40444_c1
888 nmdc:mga06r32_89526_c1
889 nmdc:mga08y16_115909_c2
890 nmdc:mga08y16_5173_c1
891 nmdc:mga08y16_9793_c1
892 nmdc:mga0n895_118516_c1
893 nmdc:mga0n895_182006_c1
894 nmdc:mga0n895_29201_c1
895 nmdc:mga0n895_313381_c1
896 nmdc:mga0n895_348_c1
897 nmdc:mga0n895_45459_c1
898 nmdc:mga0n895_800523_c1
899 nmdc:mga0rr50_18756_c1
900 nmdc:mga0rr50_27081_c1
901 nmdc:mga0rr50_2792_c1
902 nmdc:mga0rr50_294597_c1
903 nmdc:mga0rr50_32601_c1
904 nmdc:mga0rr50_3_c1
905 nmdc:mga0rr50_42898_c1
906 nmdc:mga0rr50_4306_c1
907 nmdc:mga08x19_133_c1
908 nmdc:mga08x19_16032_c1
909 nmdc:mga08x19_16201_c1
910 nmdc:mga08x19_340410_c1
911 nmdc:mga08x19_392290_c1
912 nmdc:mga08x19_42997_c1
913 nmdc:mga08x19_580430_c1
914 nmdc:mga0a205_207890_c1
915 nmdc:mga0a205_225235_c1
916 nmdc:mga0a205_226562_c1
917 nmdc:mga0a205_23780_c1
918 nmdc:mga0a205_44048_c1
919 Ga0495601_0042251
920 Ga0495595_0046787
921 Ga0495619_0035954
922 Ga0495619_0107865
923 Ga0501082_0017226
924 Ga0501082_0074048
925 Ga0501082_0489358
926 Ga0530510_0069805

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

30

183

0.77

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

30

242

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rqz-assembly2.cif.gz_B crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.8945 1 247
3rqz-assembly2.cif.gz_B crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.8909 1 247
3rqz-assembly1.cif.gz_A crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.8854 1 247
3rqz-assembly3.cif.gz_C crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.8788 1 247
3rqz-assembly1.cif.gz_A crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.8758 1 247
ID Description Score Start End Superfamily
af_I1LEN3_3_193_3.40.1000.50 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Repressor of RNA polymerase III transcription 0.9123 202 216 3.40.1000.50
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9026 3 247 3.60.21.10
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8953 3 247 3.60.21.10
3rqzB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8927 3 247 3.60.21.10
af_Q4CUW1_3_206_3.40.1000.50 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Repressor of RNA polymerase III transcription 0.8912 201 216 3.40.1000.50
ID Description Score Start End GO Terms
AF-A0A2V8BH16-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9964 1 247 GO:0005737
GO:0016791
AF-A0A2V8BH16-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9924 1 247 GO:0005737
GO:0016791
AF-A0A1E3YP79-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9849 1 247 GO:0005737
GO:0016791
AF-A0A2V8GZE8-F1-model_v4 shikimate kinase (EC 2.7.1.71) 0.9835 1 152 GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0016787
AF-A0A800DN93-F1-model_v4 Metallophosphoesterase 0.9817 1 247 GO:0005737
GO:0016791

Map