F449053

General Info

Members Datasets Scaffolds Average Seq Length
463 207 926 214

Family's Representative Sequence

Representative Sequence 3300005343|Ga0070687_100041092|Ga0070687_1000410922
Length 260
Sequence MSGGGIGVGGTTVAAIGAEAHETVASARQNDRSRHAYIRGDDSILITRVMHRYIAIEGPIGVGKTALAMRLAARLDATTVLEETENPFLSDFYAGRAGSALQAQLFYLLNRHRQQMSLRQGNLFAQATVSDYLFDRDKIFAYLNLDDNELFIYQRLYDLLVKDVSTPDLVVYLQSPTDVLLRRQRERPKEIEDETPEPAADYLRELNEAYQHFFFHYTATPLLVVETSHLDLAAGDAVLDDLLKQIRGMGRGTQYYVPRA

Samples

Sample ID Description Type Environment
1 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
147 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
148 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
149 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
157 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
162 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
165 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
190 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
203 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.43
Rhizosphere 99.57
Stem 0
Stem Tuber 0
Unclassified 5.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070687_100041092 3300005343 Bacteria 2335
2 SwRhRL2b_contig_2077211 2162886007 Unclassified 1232
3 SwRhRL2b_contig_2771117 2162886007 Unclassified 1867
4 JGI24743J22301_10041684 3300001991 Unclassified 923
5 Ga0065714_10100363 3300005288 Bacteria 1666
6 Ga0065704_10003539 3300005289 Bacteria 4175
7 Ga0065704_10097436 3300005289 Bacteria 2394
8 Ga0065704_10203360 3300005289 Bacteria 1137
9 Ga0065712_10004042 3300005290 Bacteria 7055
10 Ga0065712_10120307 3300005290 Bacteria 1680
11 Ga0065712_10193734 3300005290 Bacteria 1137
12 Ga0065712_10416329 3300005290 Unclassified 716
13 Ga0065715_10007485 3300005293 Bacteria 6998
14 Ga0065715_10360882 3300005293 Bacteria 935
15 Ga0065707_10004683 3300005295 Bacteria 5829
16 Ga0065707_10088952 3300005295 Bacteria 4507
17 Ga0065707_10106017 3300005295 Bacteria 2617
18 Ga0070676_10019941 3300005328 Bacteria 3736
19 Ga0070683_100046940 3300005329 Bacteria 3991
20 Ga0070690_100011216 3300005330 Bacteria 5238
21 Ga0070670_100002273 3300005331 Bacteria 15812
22 Ga0070670_100002473 3300005331 Bacteria 15248
23 Ga0070670_100017996 3300005331 Bacteria 6064
24 Ga0070670_100365905 3300005331 Bacteria 1268
25 Ga0068869_100186718 3300005334 Bacteria 1628
26 Ga0068869_100191655 3300005334 Bacteria 1608
27 Ga0068869_100267818 3300005334 Bacteria 1370
28 Ga0070666_10026201 3300005335 Bacteria 3806
29 Ga0070682_100261857 3300005337 Bacteria 1252
30 Ga0070660_100644585 3300005339 Unclassified 887
31 Ga0070689_100009208 3300005340 Bacteria 6990
32 Ga0070689_100064855 3300005340 Bacteria 2844
33 Ga0070691_10311746 3300005341 Bacteria 863
34 Ga0070687_100029113 3300005343 Bacteria 2686
35 Ga0070687_100032769 3300005343 Bacteria 2559
36 Ga0070692_10017951 3300005345 Bacteria 3393
37 Ga0070668_101016122 3300005347 Unclassified 746
38 Ga0070669_100002969 3300005353 Bacteria 12225
39 Ga0070669_100033435 3300005353 Bacteria 3719
40 Ga0070669_100043436 3300005353 Bacteria 3273
41 Ga0070669_100093776 3300005353 Bacteria 2255
42 Ga0070669_100099289 3300005353 Bacteria 2194
43 Ga0070669_100383309 3300005353 Bacteria 1147
44 Ga0070669_100583738 3300005353 Bacteria 935
45 Ga0070675_100014196 3300005354 Bacteria 6279
46 Ga0070675_100018033 3300005354 Bacteria 5618
47 Ga0070675_100041503 3300005354 Bacteria 3758
48 Ga0070675_100079551 3300005354 Bacteria 2731
49 Ga0070675_100139630 3300005354 Bacteria 2070
50 Ga0070675_100226748 3300005354 Bacteria 1629
51 Ga0070671_100024138 3300005355 Bacteria 4977
52 Ga0070671_100124026 3300005355 Bacteria 2174
53 Ga0070671_100194988 3300005355 Bacteria 1717
54 Ga0070674_100019139 3300005356 Bacteria 4344
55 Ga0070674_100490203 3300005356 Bacteria 1022
56 Ga0070673_100021722 3300005364 Bacteria 4660
57 Ga0070673_100069028 3300005364 Bacteria 2832
58 Ga0070673_100165749 3300005364 Bacteria 1882
59 Ga0070688_100228694 3300005365 Bacteria 1315
60 Ga0070667_100234485 3300005367 Bacteria 1637
61 Ga0070667_100344616 3300005367 Bacteria 1348
62 Ga0070713_100094707 3300005436 Bacteria 2575
63 Ga0070701_10084149 3300005438 Bacteria 1729
64 Ga0070701_10238071 3300005438 Unclassified 1093
65 Ga0070701_10243574 3300005438 Bacteria 1082
66 Ga0070701_10251292 3300005438 Bacteria 1068
67 Ga0070705_100373032 3300005440 Bacteria 1048
68 Ga0070700_100138275 3300005441 Unclassified 1652
69 Ga0070700_100379593 3300005441 Bacteria 1056
70 Ga0070700_100860941 3300005441 Bacteria 735
71 Ga0070694_100000817 3300005444 Bacteria 17467
72 Ga0070694_100119259 3300005444 Bacteria 1891
73 Ga0070708_100061754 3300005445 Bacteria 3349
74 Ga0070708_100152879 3300005445 Unclassified 2147
75 Ga0070708_100329283 3300005445 Bacteria 1439
76 Ga0070678_100008019 3300005456 Bacteria 6297
77 Ga0070678_100019881 3300005456 Bacteria 4392
78 Ga0070678_100035918 3300005456 Bacteria 3465
79 Ga0070678_100044093 3300005456 Bacteria 3183
80 Ga0070678_100214287 3300005456 Bacteria 1598
81 Ga0070662_100116272 3300005457 Bacteria 2044
82 Ga0070662_100171932 3300005457 Bacteria 1702
83 Ga0068867_100140662 3300005459 Bacteria 1886
84 Ga0068867_100239523 3300005459 Bacteria 1471
85 Ga0068867_100382223 3300005459 Bacteria 1183
86 Ga0070685_10061336 3300005466 Bacteria 2202
87 Ga0070685_10110960 3300005466 Bacteria 1689
88 Ga0070706_100131438 3300005467 Bacteria 2336
89 Ga0070707_100073488 3300005468 Bacteria 3297
90 Ga0070707_100140883 3300005468 Bacteria 2347
91 Ga0070707_100178501 3300005468 Bacteria 2070
92 Ga0070698_100034339 3300005471 Bacteria 5250
93 Ga0070698_100313831 3300005471 Bacteria 1498
94 Ga0070698_100355954 3300005471 Bacteria 1396
95 Ga0070699_100000422 3300005518 Bacteria 40663
96 Ga0070699_100017029 3300005518 Bacteria 6241
97 Ga0070699_100072300 3300005518 Bacteria 3000
98 Ga0070699_100380078 3300005518 Bacteria 1275
99 Ga0070684_100034500 3300005535 Bacteria 4326
100 Ga0070684_100685180 3300005535 Bacteria 955
101 Ga0070672_100033402 3300005543 Bacteria 3896
102 Ga0070672_100062410 3300005543 Bacteria 2941
103 Ga0070672_100228391 3300005543 Bacteria 1563
104 Ga0070686_100752407 3300005544 Bacteria 782
105 Ga0070695_100103756 3300005545 Unclassified 1919
106 Ga0070695_100211106 3300005545 Bacteria 1393
107 Ga0070696_100004124 3300005546 Bacteria 9685
108 Ga0070696_100108107 3300005546 Bacteria 2001
109 Ga0070693_100111993 3300005547 Bacteria 1680
110 Ga0070665_100363808 3300005548 Bacteria 1453
111 Ga0070704_100003354 3300005549 Bacteria 9173
112 Ga0070704_100054507 3300005549 Bacteria 2829
113 Ga0070704_100292870 3300005549 Unclassified 1353
114 Ga0070664_100062979 3300005564 Bacteria 3162
115 Ga0070664_100084913 3300005564 Bacteria 2734
116 Ga0070664_100088606 3300005564 Bacteria 2676
117 Ga0068857_100027237 3300005577 Bacteria 5041
118 Ga0068857_100567047 3300005577 Bacteria 1071
119 Ga0068859_100002911 3300005617 Bacteria 17381
120 Ga0068859_100023917 3300005617 Bacteria 6130
121 Ga0068859_100055265 3300005617 Bacteria 3995
122 Ga0068859_100215435 3300005617 Bacteria 2007
123 Ga0068864_100301741 3300005618 Bacteria 1499
124 Ga0068864_100515738 3300005618 Bacteria 1152
125 Ga0068864_100675778 3300005618 Bacteria 1007
126 Ga0068866_10222354 3300005718 Bacteria 1140
127 Ga0068861_100006139 3300005719 Bacteria 8175
128 Ga0068861_100109315 3300005719 Bacteria 2213
129 Ga0068861_100169423 3300005719 Bacteria 1809
130 Ga0068861_100352948 3300005719 Bacteria 1291
131 Ga0068870_10007802 3300005840 Bacteria 4787
132 Ga0068870_10064338 3300005840 Bacteria 1981
133 Ga0068870_10180502 3300005840 Bacteria 1267
134 Ga0068870_10336662 3300005840 Bacteria 964
135 Ga0068863_100191247 3300005841 Bacteria 1967
136 Ga0068858_100009305 3300005842 Bacteria 9378
137 Ga0068860_100066583 3300005843 Bacteria 3422
138 Ga0068862_100000192 3300005844 Bacteria 67711
139 Ga0068862_100030731 3300005844 Bacteria 4528
140 Ga0068862_100071903 3300005844 Bacteria 2987
141 Ga0068862_100391190 3300005844 Unclassified 1299
142 Ga0068862_100407040 3300005844 Bacteria 1274
143 Ga0081455_10091179 3300005937 Bacteria 2469
144 Ga0070712_100377824 3300006175 Bacteria 1166
145 Ga0097621_100076760 3300006237 Bacteria 2772
146 Ga0097621_100246124 3300006237 Bacteria 1564
147 Ga0097621_100608711 3300006237 Bacteria 999
148 Ga0068871_100251502 3300006358 Bacteria 1539
149 Ga0068871_100414456 3300006358 Bacteria 1202
150 Ga0075428_100001176 3300006844 Bacteria 28020
151 Ga0075428_100013810 3300006844 Bacteria 8993
152 Ga0075428_100027628 3300006844 Bacteria 6277
153 Ga0075428_100136169 3300006844 Bacteria 2670
154 Ga0075428_101428563 3300006844 Bacteria 726
155 Ga0075430_100006287 3300006846 Bacteria 10018
156 Ga0075430_100008994 3300006846 Bacteria 8440
157 Ga0075430_100018955 3300006846 Bacteria 5854
158 Ga0075430_100026474 3300006846 Bacteria 4934
159 Ga0075430_100128232 3300006846 Bacteria 2115
160 Ga0075430_100482490 3300006846 Bacteria 1023
161 Ga0075431_100003423 3300006847 Bacteria 15391
162 Ga0075431_100030468 3300006847 Bacteria 5557
163 Ga0075431_100035702 3300006847 Bacteria 5118
164 Ga0075431_100062753 3300006847 Bacteria 3834
165 Ga0075433_10021580 3300006852 Bacteria 5401
166 Ga0075433_10132090 3300006852 Bacteria 2218
167 Ga0075433_10315782 3300006852 Bacteria 1383
168 Ga0075434_100008478 3300006871 Bacteria 9563
169 Ga0075434_100020596 3300006871 Bacteria 6400
170 Ga0075434_100021900 3300006871 Bacteria 6221
171 Ga0075429_100001309 3300006880 Bacteria 20298
172 Ga0075429_100028373 3300006880 Bacteria 4860
173 Ga0068865_100045066 3300006881 Bacteria 3022
174 Ga0068865_100176765 3300006881 Bacteria 1641
175 Ga0097620_100002911 3300006931 Bacteria 17381
176 Ga0097620_100023917 3300006931 Bacteria 6130
177 Ga0097620_100055265 3300006931 Bacteria 3995
178 Ga0097620_100215444 3300006931 Bacteria 2007
179 Ga0075435_100209304 3300007076 Bacteria 1654
180 Ga0111539_10000306 3300009094 Bacteria 59726
181 Ga0111539_10001399 3300009094 Bacteria 32116
182 Ga0111539_10004348 3300009094 Bacteria 18553
183 Ga0111539_10008742 3300009094 Bacteria 12847
184 Ga0111539_10090404 3300009094 Bacteria 3598
185 Ga0111539_10179295 3300009094 Bacteria 2475
186 Ga0111539_10203867 3300009094 Bacteria 2306
187 Ga0111539_10223856 3300009094 Bacteria 2191
188 Ga0111539_10297982 3300009094 Bacteria 1877
189 Ga0111539_10495184 3300009094 Bacteria 1423
190 Ga0111539_10584522 3300009094 Bacteria 1301
191 Ga0111539_10585915 3300009094 Bacteria 1299
192 Ga0111539_10781627 3300009094 Unclassified 1111
193 Ga0114129_10004870 3300009147 Bacteria 18944
194 Ga0114129_10114747 3300009147 Bacteria 3714
195 Ga0114129_10116742 3300009147 Bacteria 3677
196 Ga0114129_10123482 3300009147 Bacteria 3561
197 Ga0114129_10143684 3300009147 Bacteria 3269
198 Ga0114129_10145114 3300009147 Bacteria 3251
199 Ga0114129_10217069 3300009147 Bacteria 2582
200 Ga0114129_10284979 3300009147 Bacteria 2206
201 Ga0105243_10070301 3300009148 Bacteria 2826
202 Ga0105242_10200703 3300009176 Bacteria 1771
203 Ga0105242_10499644 3300009176 Bacteria 1157
204 Ga0105248_10073636 3300009177 Unclassified 3838
205 Ga0105248_10391124 3300009177 Bacteria 1565
206 Ga0105248_11209130 3300009177 Bacteria 854
207 Ga0105249_10013622 3300009553 Bacteria 7180
208 Ga0105249_10495979 3300009553 Bacteria 1266
209 Ga0105246_10762897 3300011119 Bacteria 854
210 Ga0157374_10104642 3300013296 Bacteria 2717
211 Ga0163162_10016002 3300013306 Bacteria 7332
212 Ga0163162_10466278 3300013306 Bacteria 1394
213 Ga0163162_11319290 3300013306 Bacteria 820
214 Ga0157375_10004234 3300013308 Bacteria 12444
215 Ga0163163_10036394 3300014325 Bacteria 4781
216 Ga0163163_10755191 3300014325 Bacteria 1036
217 Ga0157380_10006596 3300014326 Bacteria 8188
218 Ga0157380_10088889 3300014326 Bacteria 2543
219 Ga0157380_10128483 3300014326 Unclassified 2158
220 Ga0157380_10214497 3300014326 Bacteria 1718
221 Ga0157380_11317449 3300014326 Bacteria 770
222 Ga0157377_10039670 3300014745 Bacteria 2606
223 Ga0157377_10143875 3300014745 Bacteria 1468
224 Ga0157379_10042184 3300014968 Bacteria 4073
225 Ga0157376_10275734 3300014969 Bacteria 1582
226 Ga0157376_10818736 3300014969 Bacteria 945
227 Ga0157376_11205305 3300014969 Bacteria 785
228 Ga0163161_10166301 3300017792 Bacteria 1684
229 Ga0207697_10079169 3300025315 Bacteria 1384
230 Ga0207697_10079717 3300025315 Bacteria 1379
231 Ga0207682_10003368 3300025893 Bacteria 6959
232 Ga0207682_10080285 3300025893 Bacteria 1397
233 Ga0207642_10366495 3300025899 Unclassified 854
234 Ga0207688_10185520 3300025901 Bacteria 1242
235 Ga0207680_10112511 3300025903 Bacteria 1768
236 Ga0207645_10024216 3300025907 Bacteria 3938
237 Ga0207645_10165438 3300025907 Bacteria 1448
238 Ga0207643_10004169 3300025908 Bacteria 7794
239 Ga0207643_10043901 3300025908 Bacteria 2523
240 Ga0207643_10087937 3300025908 Bacteria 1808
241 Ga0207643_10123424 3300025908 Bacteria 1536
242 Ga0207643_10296497 3300025908 Bacteria 1005
243 Ga0207684_10090954 3300025910 Bacteria 2600
244 Ga0207693_10212354 3300025915 Bacteria 1521
245 Ga0207662_10013443 3300025918 Bacteria 4579
246 Ga0207662_10029839 3300025918 Bacteria 3162
247 Ga0207662_10040319 3300025918 Bacteria 2744
248 Ga0207657_10285329 3300025919 Bacteria 1310
249 Ga0207649_10087884 3300025920 Unclassified 2029
250 Ga0207646_10087872 3300025922 Bacteria 2781
251 Ga0207646_10227454 3300025922 Bacteria 1685
252 Ga0207646_10235605 3300025922 Bacteria 1654
253 Ga0207681_10000719 3300025923 Bacteria 21719
254 Ga0207681_10015413 3300025923 Bacteria 4766
255 Ga0207681_10104058 3300025923 Bacteria 2053
256 Ga0207681_10218157 3300025923 Bacteria 1474
257 Ga0207650_10018799 3300025925 Bacteria 4853
258 Ga0207650_10022043 3300025925 Bacteria 4508
259 Ga0207650_10206620 3300025925 Bacteria 1575
260 Ga0207659_10000209 3300025926 Bacteria 35219
261 Ga0207659_10011339 3300025926 Bacteria 5628
262 Ga0207659_10023550 3300025926 Bacteria 4111
263 Ga0207659_10254409 3300025926 Bacteria 1426
264 Ga0207659_10393616 3300025926 Bacteria 1158
265 Ga0207659_10865307 3300025926 Bacteria 777
266 Ga0207700_10513461 3300025928 Bacteria 1061
267 Ga0207644_10159463 3300025931 Bacteria 1753
268 Ga0207644_10192552 3300025931 Bacteria 1604
269 Ga0207706_10009358 3300025933 Bacteria 8996
270 Ga0207709_10102072 3300025935 Bacteria 1898
271 Ga0207670_10057595 3300025936 Bacteria 2636
272 Ga0207670_10061353 3300025936 Bacteria 2566
273 Ga0207670_10081129 3300025936 Bacteria 2269
274 Ga0207669_10002945 3300025937 Bacteria 7309
275 Ga0207669_10280680 3300025937 Unclassified 1256
276 Ga0207704_10009060 3300025938 Bacteria 4784
277 Ga0207691_10006028 3300025940 Bacteria 11700
278 Ga0207691_10039770 3300025940 Bacteria 4349
279 Ga0207691_10044481 3300025940 Bacteria 4087
280 Ga0207691_10196528 3300025940 Bacteria 1757
281 Ga0207711_10049791 3300025941 Unclassified 3587
282 Ga0207689_10275352 3300025942 Bacteria 1393
283 Ga0207689_10325115 3300025942 Bacteria 1277
284 Ga0207661_10085014 3300025944 Unclassified 2622
285 Ga0207679_10027269 3300025945 Bacteria 3949
286 Ga0207679_10059131 3300025945 Bacteria 2843
287 Ga0207679_10101545 3300025945 Bacteria 2250
288 Ga0207679_10138071 3300025945 Bacteria 1966
289 Ga0207679_11179897 3300025945 Bacteria 703
290 Ga0207651_10466148 3300025960 Unclassified 1086
291 Ga0207712_10017782 3300025961 Bacteria 4623
292 Ga0207668_10020883 3300025972 Bacteria 4169
293 Ga0207658_10071593 3300025986 Bacteria 2626
294 Ga0207658_10387808 3300025986 Bacteria 1225
295 Ga0207658_10594101 3300025986 Bacteria 994
296 Ga0207677_10798578 3300026023 Bacteria 845
297 Ga0207703_10003450 3300026035 Bacteria 13241
298 Ga0207703_10199283 3300026035 Bacteria 1778
299 Ga0207708_10015572 3300026075 Bacteria 5701
300 Ga0207708_10094823 3300026075 Bacteria 2304
301 Ga0207708_10166919 3300026075 Bacteria 1741
302 Ga0207676_10045657 3300026095 Bacteria 3386
303 Ga0207676_10169420 3300026095 Bacteria 1901
304 Ga0207676_10307616 3300026095 Bacteria 1449
305 Ga0207674_10031757 3300026116 Bacteria 5544
306 Ga0207674_10105536 3300026116 Bacteria 2795
307 Ga0207675_100131124 3300026118 Unclassified 2377
308 Ga0207675_100164907 3300026118 Bacteria 2115
309 Ga0207675_100321648 3300026118 Bacteria 1510
310 Ga0207675_100367236 3300026118 Bacteria 1413
311 Ga0207675_100576176 3300026118 Bacteria 1127
312 Ga0207683_10036565 3300026121 Bacteria 4277
313 Ga0207683_10192843 3300026121 Bacteria 1850
314 Ga0207683_10247868 3300026121 Bacteria 1625
315 Ga0210002_1017316 3300027617 Bacteria 1146
316 Ga0207428_10000690 3300027907 Bacteria 39183
317 Ga0207428_10001578 3300027907 Bacteria 23729
318 Ga0207428_10003602 3300027907 Bacteria 14959
319 Ga0207428_10004042 3300027907 Bacteria 14061
320 Ga0207428_10043903 3300027907 Unclassified 3608
321 Ga0268265_10000185 3300028380 Bacteria 73947
322 Ga0268265_10115324 3300028380 Bacteria 2202
323 Ga0268265_10404834 3300028380 Bacteria 1262
324 Ga0268264_10004319 3300028381 Bacteria 12126
325 Ga0268264_10034723 3300028381 Bacteria 4150
326 Ga0307408_101107675 3300031548 Bacteria 735
327 Ga0307405_10007186 3300031731 Bacteria 5545
328 Ga0307413_10009111 3300031824 Bacteria 4731
329 Ga0307410_10089639 3300031852 Bacteria 2180
330 Ga0307410_10095831 3300031852 Bacteria 2117
331 Ga0307407_10003277 3300031903 Bacteria 6601
332 Ga0307407_10005300 3300031903 Bacteria 5578
333 Ga0307407_10067947 3300031903 Bacteria 2109
334 Ga0307412_10110139 3300031911 Bacteria 1964
335 Ga0307412_10121701 3300031911 Bacteria 1880
336 Ga0307409_100049613 3300031995 Bacteria 3201
337 Ga0307409_100549672 3300031995 Bacteria 1133
338 Ga0307416_100032884 3300032002 Bacteria 3925
339 Ga0307416_100057222 3300032002 Bacteria 3153
340 Ga0307414_10047182 3300032004 Bacteria 2963
341 Ga0307411_10027304 3300032005 Bacteria 3452
342 Ga0307415_100006428 3300032126 Bacteria 6336
343 Ga0373933_0037369 3300035724 Bacteria 2848
344 Ga0373937_0004647 3300036401 Bacteria 11661
345 Ga0373937_0255870 3300036401 Bacteria 1651
346 Ga0439439_0092420 3300041406 Unclassified 827
347 Ga0451802_1063938 3300041460 Bacteria 773
348 Ga0439434_0097910 3300042435 Bacteria 943
349 Ga0439464_0009127 3300042439 Bacteria 2607
350 Ga0451576_0020778 3300045051 Bacteria 7146
351 Ga0451576_0087137 3300045051 Bacteria 3247
352 Ga0451576_0383151 3300045051 Bacteria 1474
353 Ga0495592_0089006 3300046454 Bacteria 2218
354 Ga0495629_0006672 3300046459 Bacteria 8545
355 Ga0495580_0144036 3300046472 Bacteria 1652
356 Ga0495584_0248542 3300046491 Bacteria 904
357 Ga0495628_0117626 3300046516 Bacteria 2041
358 Ga0495628_0619804 3300046516 Bacteria 771
359 Ga0495643_0004518 3300046522 Bacteria 9698
360 Ga0495598_0185231 3300046537 Bacteria 745
361 Ga0495609_0025944 3300046538 Bacteria 2684
362 Ga0495621_0002788 3300046539 Bacteria 4751
363 Ga0495621_0007136 3300046539 Bacteria 3297
364 Ga0495621_0010404 3300046539 Bacteria 2845
365 Ga0495621_0021085 3300046539 Unclassified 2145
366 Ga0495621_0143490 3300046539 Bacteria 936
367 Ga0495633_0043140 3300046558 Bacteria 2140
368 Ga0495659_0012872 3300046664 Bacteria 2717
369 Ga0495659_0014178 3300046664 Bacteria 2606
370 Ga0495659_0014736 3300046664 Bacteria 2564
371 Ga0495659_0032501 3300046664 Bacteria 1827
372 Ga0495659_0084002 3300046664 Bacteria 1213
373 Ga0495588_0014472 3300046674 Bacteria 3777
374 Ga0495588_0167927 3300046674 Bacteria 1160
375 Ga0495599_0102253 3300046678 Bacteria 1786
376 Ga0495599_0350928 3300046678 Bacteria 884
377 Ga0495669_0003518 3300046684 Bacteria 6460
378 Ga0495669_0032699 3300046684 Bacteria 2287
379 Ga0495636_0238679 3300047318 Bacteria 838
380 Ga0495676_0187647 3300047321 Bacteria 1444
381 Ga0495677_0023884 3300047445 Bacteria 2218
382 Ga0495677_0052932 3300047445 Bacteria 1496
383 Ga0495684_0444807 3300047471 Bacteria 902
384 Ga0496104_0149499 3300048907 Bacteria 2243
385 Ga0501298_018290 3300049521 Bacteria 1287
386 Ga0501033_0149353 3300049570 Bacteria 1687
387 Ga0501034_0028738 3300049571 Bacteria 5657
388 Ga0501036_0586656 3300049572 Bacteria 925
389 Ga0501036_0754927 3300049572 Unclassified 802
390 Ga0501039_0017659 3300049575 Bacteria 5473
391 Ga0501040_0084899 3300049576 Bacteria 2197
392 Ga0501042_0036190 3300049578 Bacteria 3502
393 Ga0501042_0233090 3300049578 Bacteria 1328
394 Ga0501046_0533983 3300049580 Bacteria 837
395 Ga0501048_0051145 3300049582 Bacteria 2942
396 Ga0501067_0062466 3300049583 Bacteria 2062
397 Ga0501068_0037125 3300049584 Bacteria 2917
398 Ga0501068_0130577 3300049584 Bacteria 1571
399 Ga0501070_0308127 3300049586 Unclassified 1289
400 Ga0501072_0071814 3300049588 Bacteria 2735
401 Ga0501072_0239039 3300049588 Bacteria 1446
402 Ga0501074_0702227 3300049590 Bacteria 714
403 Ga0501075_0020826 3300049591 Bacteria 4774
404 Ga0501075_0187412 3300049591 Bacteria 1578
405 Ga0501076_0288576 3300049592 Bacteria 1344
406 Ga0501076_0389088 3300049592 Bacteria 1146
407 Ga0501249_006279 3300049679 Bacteria 2444
408 Ga0501079_0015462 3300049741 Bacteria 5824
409 Ga0501080_0848736 3300049742 Bacteria 799
410 Ga0501268_051278 3300049765 Bacteria 799
411 Ga0501283_013655 3300049779 Bacteria 1233
412 Ga0501035_0548457 3300049822 Bacteria 947
413 Ga0501045_0409975 3300049824 Bacteria 1008
414 nmdc:mga05p37_102394_c1 3300050507 Bacteria 2801
415 nmdc:mga05p37_17413_c1 3300050507 Bacteria 5986
416 nmdc:mga05p37_181950_c1 3300050507 Bacteria 2556
417 nmdc:mga05p37_226042_c1 3300050507 Bacteria 2257
418 nmdc:mga05p37_25129_c1 3300050507 Bacteria 7243
419 nmdc:mga05p37_60561_c1 3300050507 Bacteria 4660
420 nmdc:mga05p37_75661_c1 3300050507 Bacteria 4144
421 nmdc:mga05p37_86761_c1 3300050507 Bacteria 3858
422 nmdc:mga05p37_89676_c1 3300050507 Bacteria 3789
423 nmdc:mga09592_20182_c1 3300050508 Bacteria 5476
424 nmdc:mga09592_303325_c1 3300050508 Bacteria 1385
425 nmdc:mga09592_529264_c1 3300050508 Bacteria 1013
426 nmdc:mga09592_806600_c1 3300050508 Bacteria 794
427 nmdc:mga09592_953_c1 3300050508 Bacteria 22761
428 nmdc:mga0qj67_2106_c1 3300050509 Bacteria 14178
429 nmdc:mga0qj67_237503_c1 3300050509 Bacteria 1479
430 nmdc:mga0qj67_240362_c1 3300050509 Bacteria 1469
431 nmdc:mga0qj67_34185_c1 3300050509 Bacteria 3970
432 nmdc:mga0qj67_541161_c1 3300050509 Bacteria 934
433 nmdc:mga0qj67_622803_c1 3300050509 Bacteria 862
434 nmdc:mga06r32_151376_c1 3300050510 Bacteria 2299
435 nmdc:mga06r32_25696_c1 3300050510 Bacteria 5482
436 nmdc:mga06r32_360036_c1 3300050510 Bacteria 1439
437 nmdc:mga06r32_432553_c1 3300050510 Bacteria 1297
438 nmdc:mga08y16_105_c1 3300050511 Bacteria 70187
439 nmdc:mga08y16_181985_c1 3300050511 Bacteria 2182
440 nmdc:mga08y16_1992_c1 3300050511 Bacteria 20862
441 nmdc:mga08y16_213681_c1 3300050511 Bacteria 1997
442 nmdc:mga08y16_272266_c1 3300050511 Bacteria 1748
443 nmdc:mga08y16_384654_c1 3300050511 Bacteria 1438
444 nmdc:mga08y16_5555_c1 3300050511 Bacteria 13204
445 nmdc:mga08y16_6332_c1 3300050511 Bacteria 12414
446 nmdc:mga08y16_927907_c1 3300050511 Bacteria 855
447 nmdc:mga0n895_18517_c1 3300050512 Bacteria 6446
448 nmdc:mga0n895_317608_c1 3300050512 Bacteria 1579
449 nmdc:mga0n895_4954_c1 3300050512 Bacteria 11048
450 nmdc:mga0rr50_150546_c1 3300050513 Bacteria 1880
451 nmdc:mga0a205_10811_c1 3300050515 Bacteria 8398
452 nmdc:mga0a205_223081_c1 3300050515 Bacteria 1770
453 nmdc:mga0a205_272400_c1 3300050515 Bacteria 1570
454 nmdc:mga0a205_28818_c1 3300050515 Bacteria 5309
455 Ga0495601_0138626 3300053077 Bacteria 1586
456 Ga0495612_0238320 3300053078 Bacteria 808
457 Ga0495595_0211227 3300053084 Bacteria 967
458 Ga0495619_0224796 3300053085 Bacteria 1300
459 Ga0501084_0055890 3300054114 Bacteria 3303
460 Ga0501084_0081017 3300054114 Bacteria 2722
461 Ga0501082_0046875 3300060353 Bacteria 3725
462 Ga0501082_0445356 3300060353 Bacteria 1131
463 Ga0530510_0003783 3300061734 Bacteria 10422
464 Ga0070687_100041092
465 SwRhRL2b_contig_2077211
466 SwRhRL2b_contig_2771117
467 JGI24743J22301_10041684
468 Ga0065714_10100363
469 Ga0065704_10003539
470 Ga0065704_10097436
471 Ga0065704_10203360
472 Ga0065712_10004042
473 Ga0065712_10120307
474 Ga0065712_10193734
475 Ga0065712_10416329
476 Ga0065715_10007485
477 Ga0065715_10360882
478 Ga0065707_10004683
479 Ga0065707_10088952
480 Ga0065707_10106017
481 Ga0070676_10019941
482 Ga0070683_100046940
483 Ga0070690_100011216
484 Ga0070670_100002273
485 Ga0070670_100002473
486 Ga0070670_100017996
487 Ga0070670_100365905
488 Ga0068869_100186718
489 Ga0068869_100191655
490 Ga0068869_100267818
491 Ga0070666_10026201
492 Ga0070682_100261857
493 Ga0070660_100644585
494 Ga0070689_100009208
495 Ga0070689_100064855
496 Ga0070691_10311746
497 Ga0070687_100029113
498 Ga0070687_100032769
499 Ga0070692_10017951
500 Ga0070668_101016122
501 Ga0070669_100002969
502 Ga0070669_100033435
503 Ga0070669_100043436
504 Ga0070669_100093776
505 Ga0070669_100099289
506 Ga0070669_100383309
507 Ga0070669_100583738
508 Ga0070675_100014196
509 Ga0070675_100018033
510 Ga0070675_100041503
511 Ga0070675_100079551
512 Ga0070675_100139630
513 Ga0070675_100226748
514 Ga0070671_100024138
515 Ga0070671_100124026
516 Ga0070671_100194988
517 Ga0070674_100019139
518 Ga0070674_100490203
519 Ga0070673_100021722
520 Ga0070673_100069028
521 Ga0070673_100165749
522 Ga0070688_100228694
523 Ga0070667_100234485
524 Ga0070667_100344616
525 Ga0070713_100094707
526 Ga0070701_10084149
527 Ga0070701_10238071
528 Ga0070701_10243574
529 Ga0070701_10251292
530 Ga0070705_100373032
531 Ga0070700_100138275
532 Ga0070700_100379593
533 Ga0070700_100860941
534 Ga0070694_100000817
535 Ga0070694_100119259
536 Ga0070708_100061754
537 Ga0070708_100152879
538 Ga0070708_100329283
539 Ga0070678_100008019
540 Ga0070678_100019881
541 Ga0070678_100035918
542 Ga0070678_100044093
543 Ga0070678_100214287
544 Ga0070662_100116272
545 Ga0070662_100171932
546 Ga0068867_100140662
547 Ga0068867_100239523
548 Ga0068867_100382223
549 Ga0070685_10061336
550 Ga0070685_10110960
551 Ga0070706_100131438
552 Ga0070707_100073488
553 Ga0070707_100140883
554 Ga0070707_100178501
555 Ga0070698_100034339
556 Ga0070698_100313831
557 Ga0070698_100355954
558 Ga0070699_100000422
559 Ga0070699_100017029
560 Ga0070699_100072300
561 Ga0070699_100380078
562 Ga0070684_100034500
563 Ga0070684_100685180
564 Ga0070672_100033402
565 Ga0070672_100062410
566 Ga0070672_100228391
567 Ga0070686_100752407
568 Ga0070695_100103756
569 Ga0070695_100211106
570 Ga0070696_100004124
571 Ga0070696_100108107
572 Ga0070693_100111993
573 Ga0070665_100363808
574 Ga0070704_100003354
575 Ga0070704_100054507
576 Ga0070704_100292870
577 Ga0070664_100062979
578 Ga0070664_100084913
579 Ga0070664_100088606
580 Ga0068857_100027237
581 Ga0068857_100567047
582 Ga0068859_100002911
583 Ga0068859_100023917
584 Ga0068859_100055265
585 Ga0068859_100215435
586 Ga0068864_100301741
587 Ga0068864_100515738
588 Ga0068864_100675778
589 Ga0068866_10222354
590 Ga0068861_100006139
591 Ga0068861_100109315
592 Ga0068861_100169423
593 Ga0068861_100352948
594 Ga0068870_10007802
595 Ga0068870_10064338
596 Ga0068870_10180502
597 Ga0068870_10336662
598 Ga0068863_100191247
599 Ga0068858_100009305
600 Ga0068860_100066583
601 Ga0068862_100000192
602 Ga0068862_100030731
603 Ga0068862_100071903
604 Ga0068862_100391190
605 Ga0068862_100407040
606 Ga0081455_10091179
607 Ga0070712_100377824
608 Ga0097621_100076760
609 Ga0097621_100246124
610 Ga0097621_100608711
611 Ga0068871_100251502
612 Ga0068871_100414456
613 Ga0075428_100001176
614 Ga0075428_100013810
615 Ga0075428_100027628
616 Ga0075428_100136169
617 Ga0075428_101428563
618 Ga0075430_100006287
619 Ga0075430_100008994
620 Ga0075430_100018955
621 Ga0075430_100026474
622 Ga0075430_100128232
623 Ga0075430_100482490
624 Ga0075431_100003423
625 Ga0075431_100030468
626 Ga0075431_100035702
627 Ga0075431_100062753
628 Ga0075433_10021580
629 Ga0075433_10132090
630 Ga0075433_10315782
631 Ga0075434_100008478
632 Ga0075434_100020596
633 Ga0075434_100021900
634 Ga0075429_100001309
635 Ga0075429_100028373
636 Ga0068865_100045066
637 Ga0068865_100176765
638 Ga0097620_100002911
639 Ga0097620_100023917
640 Ga0097620_100055265
641 Ga0097620_100215444
642 Ga0075435_100209304
643 Ga0111539_10000306
644 Ga0111539_10001399
645 Ga0111539_10004348
646 Ga0111539_10008742
647 Ga0111539_10090404
648 Ga0111539_10179295
649 Ga0111539_10203867
650 Ga0111539_10223856
651 Ga0111539_10297982
652 Ga0111539_10495184
653 Ga0111539_10584522
654 Ga0111539_10585915
655 Ga0111539_10781627
656 Ga0114129_10004870
657 Ga0114129_10114747
658 Ga0114129_10116742
659 Ga0114129_10123482
660 Ga0114129_10143684
661 Ga0114129_10145114
662 Ga0114129_10217069
663 Ga0114129_10284979
664 Ga0105243_10070301
665 Ga0105242_10200703
666 Ga0105242_10499644
667 Ga0105248_10073636
668 Ga0105248_10391124
669 Ga0105248_11209130
670 Ga0105249_10013622
671 Ga0105249_10495979
672 Ga0105246_10762897
673 Ga0157374_10104642
674 Ga0163162_10016002
675 Ga0163162_10466278
676 Ga0163162_11319290
677 Ga0157375_10004234
678 Ga0163163_10036394
679 Ga0163163_10755191
680 Ga0157380_10006596
681 Ga0157380_10088889
682 Ga0157380_10128483
683 Ga0157380_10214497
684 Ga0157380_11317449
685 Ga0157377_10039670
686 Ga0157377_10143875
687 Ga0157379_10042184
688 Ga0157376_10275734
689 Ga0157376_10818736
690 Ga0157376_11205305
691 Ga0163161_10166301
692 Ga0207697_10079169
693 Ga0207697_10079717
694 Ga0207682_10003368
695 Ga0207682_10080285
696 Ga0207642_10366495
697 Ga0207688_10185520
698 Ga0207680_10112511
699 Ga0207645_10024216
700 Ga0207645_10165438
701 Ga0207643_10004169
702 Ga0207643_10043901
703 Ga0207643_10087937
704 Ga0207643_10123424
705 Ga0207643_10296497
706 Ga0207684_10090954
707 Ga0207693_10212354
708 Ga0207662_10013443
709 Ga0207662_10029839
710 Ga0207662_10040319
711 Ga0207657_10285329
712 Ga0207649_10087884
713 Ga0207646_10087872
714 Ga0207646_10227454
715 Ga0207646_10235605
716 Ga0207681_10000719
717 Ga0207681_10015413
718 Ga0207681_10104058
719 Ga0207681_10218157
720 Ga0207650_10018799
721 Ga0207650_10022043
722 Ga0207650_10206620
723 Ga0207659_10000209
724 Ga0207659_10011339
725 Ga0207659_10023550
726 Ga0207659_10254409
727 Ga0207659_10393616
728 Ga0207659_10865307
729 Ga0207700_10513461
730 Ga0207644_10159463
731 Ga0207644_10192552
732 Ga0207706_10009358
733 Ga0207709_10102072
734 Ga0207670_10057595
735 Ga0207670_10061353
736 Ga0207670_10081129
737 Ga0207669_10002945
738 Ga0207669_10280680
739 Ga0207704_10009060
740 Ga0207691_10006028
741 Ga0207691_10039770
742 Ga0207691_10044481
743 Ga0207691_10196528
744 Ga0207711_10049791
745 Ga0207689_10275352
746 Ga0207689_10325115
747 Ga0207661_10085014
748 Ga0207679_10027269
749 Ga0207679_10059131
750 Ga0207679_10101545
751 Ga0207679_10138071
752 Ga0207679_11179897
753 Ga0207651_10466148
754 Ga0207712_10017782
755 Ga0207668_10020883
756 Ga0207658_10071593
757 Ga0207658_10387808
758 Ga0207658_10594101
759 Ga0207677_10798578
760 Ga0207703_10003450
761 Ga0207703_10199283
762 Ga0207708_10015572
763 Ga0207708_10094823
764 Ga0207708_10166919
765 Ga0207676_10045657
766 Ga0207676_10169420
767 Ga0207676_10307616
768 Ga0207674_10031757
769 Ga0207674_10105536
770 Ga0207675_100131124
771 Ga0207675_100164907
772 Ga0207675_100321648
773 Ga0207675_100367236
774 Ga0207675_100576176
775 Ga0207683_10036565
776 Ga0207683_10192843
777 Ga0207683_10247868
778 Ga0210002_1017316
779 Ga0207428_10000690
780 Ga0207428_10001578
781 Ga0207428_10003602
782 Ga0207428_10004042
783 Ga0207428_10043903
784 Ga0268265_10000185
785 Ga0268265_10115324
786 Ga0268265_10404834
787 Ga0268264_10004319
788 Ga0268264_10034723
789 Ga0307408_101107675
790 Ga0307405_10007186
791 Ga0307413_10009111
792 Ga0307410_10089639
793 Ga0307410_10095831
794 Ga0307407_10003277
795 Ga0307407_10005300
796 Ga0307407_10067947
797 Ga0307412_10110139
798 Ga0307412_10121701
799 Ga0307409_100049613
800 Ga0307409_100549672
801 Ga0307416_100032884
802 Ga0307416_100057222
803 Ga0307414_10047182
804 Ga0307411_10027304
805 Ga0307415_100006428
806 Ga0373933_0037369
807 Ga0373937_0004647
808 Ga0373937_0255870
809 Ga0439439_0092420
810 Ga0451802_1063938
811 Ga0439434_0097910
812 Ga0439464_0009127
813 Ga0451576_0020778
814 Ga0451576_0087137
815 Ga0451576_0383151
816 Ga0495592_0089006
817 Ga0495629_0006672
818 Ga0495580_0144036
819 Ga0495584_0248542
820 Ga0495628_0117626
821 Ga0495628_0619804
822 Ga0495643_0004518
823 Ga0495598_0185231
824 Ga0495609_0025944
825 Ga0495621_0002788
826 Ga0495621_0007136
827 Ga0495621_0010404
828 Ga0495621_0021085
829 Ga0495621_0143490
830 Ga0495633_0043140
831 Ga0495659_0012872
832 Ga0495659_0014178
833 Ga0495659_0014736
834 Ga0495659_0032501
835 Ga0495659_0084002
836 Ga0495588_0014472
837 Ga0495588_0167927
838 Ga0495599_0102253
839 Ga0495599_0350928
840 Ga0495669_0003518
841 Ga0495669_0032699
842 Ga0495636_0238679
843 Ga0495676_0187647
844 Ga0495677_0023884
845 Ga0495677_0052932
846 Ga0495684_0444807
847 Ga0496104_0149499
848 Ga0501298_018290
849 Ga0501033_0149353
850 Ga0501034_0028738
851 Ga0501036_0586656
852 Ga0501036_0754927
853 Ga0501039_0017659
854 Ga0501040_0084899
855 Ga0501042_0036190
856 Ga0501042_0233090
857 Ga0501046_0533983
858 Ga0501048_0051145
859 Ga0501067_0062466
860 Ga0501068_0037125
861 Ga0501068_0130577
862 Ga0501070_0308127
863 Ga0501072_0071814
864 Ga0501072_0239039
865 Ga0501074_0702227
866 Ga0501075_0020826
867 Ga0501075_0187412
868 Ga0501076_0288576
869 Ga0501076_0389088
870 Ga0501249_006279
871 Ga0501079_0015462
872 Ga0501080_0848736
873 Ga0501268_051278
874 Ga0501283_013655
875 Ga0501035_0548457
876 Ga0501045_0409975
877 nmdc:mga05p37_102394_c1
878 nmdc:mga05p37_17413_c1
879 nmdc:mga05p37_181950_c1
880 nmdc:mga05p37_226042_c1
881 nmdc:mga05p37_25129_c1
882 nmdc:mga05p37_60561_c1
883 nmdc:mga05p37_75661_c1
884 nmdc:mga05p37_86761_c1
885 nmdc:mga05p37_89676_c1
886 nmdc:mga09592_20182_c1
887 nmdc:mga09592_303325_c1
888 nmdc:mga09592_529264_c1
889 nmdc:mga09592_806600_c1
890 nmdc:mga09592_953_c1
891 nmdc:mga0qj67_2106_c1
892 nmdc:mga0qj67_237503_c1
893 nmdc:mga0qj67_240362_c1
894 nmdc:mga0qj67_34185_c1
895 nmdc:mga0qj67_541161_c1
896 nmdc:mga0qj67_622803_c1
897 nmdc:mga06r32_151376_c1
898 nmdc:mga06r32_25696_c1
899 nmdc:mga06r32_360036_c1
900 nmdc:mga06r32_432553_c1
901 nmdc:mga08y16_105_c1
902 nmdc:mga08y16_181985_c1
903 nmdc:mga08y16_1992_c1
904 nmdc:mga08y16_213681_c1
905 nmdc:mga08y16_272266_c1
906 nmdc:mga08y16_384654_c1
907 nmdc:mga08y16_5555_c1
908 nmdc:mga08y16_6332_c1
909 nmdc:mga08y16_927907_c1
910 nmdc:mga0n895_18517_c1
911 nmdc:mga0n895_317608_c1
912 nmdc:mga0n895_4954_c1
913 nmdc:mga0rr50_150546_c1
914 nmdc:mga0a205_10811_c1
915 nmdc:mga0a205_223081_c1
916 nmdc:mga0a205_272400_c1
917 nmdc:mga0a205_28818_c1
918 Ga0495601_0138626
919 Ga0495612_0238320
920 Ga0495595_0211227
921 Ga0495619_0224796
922 Ga0501084_0055890
923 Ga0501084_0081017
924 Ga0501082_0046875
925 Ga0501082_0445356
926 Ga0530510_0003783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01712

dNK

Deoxynucleoside kinase

54

249

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2j41-assembly1.cif.gz_A crystal structure of staphylococcus aureus guanylate monophosphate kinase 0.6255 5 34
7sxo-assembly1.cif.gz_D yeast lon (pim1) with endogenous substrate 0.566 1 34
2way-assembly2.cif.gz_C structure of the human ddx6 c-terminal domain in complex with an edc3- fdf peptide 0.5009 1 85
1gg4-assembly2.cif.gz_B crystal structure of escherichia coli udpmurnac-tripeptide d-alanyl-d-alanine-adding enzyme (murf) at 2.3 angstrom resolution 0.4998 1 108
1ko1-assembly1.cif.gz_A crystal structure of gluconate kinase 0.4895 2 209
ID Description Score Start End Superfamily
af_Q4DZ91_94_277_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6233 1 28 3.40.50.300
af_A0A0P0X8K8_522_695_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5525 2 83 3.40.50.300
af_Q9NU22_1063_1233_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5455 2 33 3.40.50.300
af_A0A0P0X3E8_17_159_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5315 5 87 3.40.50.300
af_B7EZK2_25_145_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.4835 2 90 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2D8WSX7-F1-model_v4 Deoxynucleoside kinase 0.7471 4 91 GO:0016301
AF-A0A7Y5MVJ5-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.7434 3 86 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A662DQC0-F1-model_v4 Deoxynucleoside kinase 0.7254 1 84 GO:0016301
AF-A0A3N5NNT9-F1-model_v4 Deoxynucleoside kinase domain-containing protein 0.7253 5 92
AF-A0A2S6DK87-F1-model_v4 deleted 0.7127 1 86

Map