F448938

General Info

Members Datasets Scaffolds Average Seq Length
462 256 462 160

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10198481|Ga0307508_101984813
Length 167
Sequence MLKPRTLVFVTLTLAALAAQAQMPNPYGPPVGVEAARKLAAAAVAEAKKNGWNVAAAVVDIAGDLVFFERMDGTQVGSVQVSQEKARSAVRFKRPTKAFEEALAGGRQAILGLPGAVPLEGGIPLVVDGKIIGAVGVSGATSQQDGSCAQAAVDTLGKPAAAAPAKK

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
183 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
185 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
190 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
191 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
192 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
197 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
206 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.38
Rhizosphere 96.97
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001634 3300003203 Bacteria 10574
2 Ga0065715_10096259 3300005293 Bacteria 3914
3 Ga0065715_10123141 3300005293 Unclassified 2143
4 Ga0065715_10671499 3300005293 Bacteria 668
5 Ga0070658_10154856 3300005327 Unclassified 1921
6 Ga0070676_10007517 3300005328 Bacteria 5850
7 Ga0070676_10013485 3300005328 Unclassified 4478
8 Ga0070676_10247308 3300005328 Bacteria 1188
9 Ga0070676_10378269 3300005328 Unclassified 980
10 Ga0070683_100056050 3300005329 Unclassified 3659
11 Ga0070683_102184316 3300005329 Unclassified 531
12 Ga0070690_100006040 3300005330 Bacteria 6848
13 Ga0070690_100394191 3300005330 Unclassified 1015
14 Ga0070670_100163684 3300005331 Bacteria 1928
15 Ga0070677_10009513 3300005333 Bacteria 3299
16 Ga0068869_100024263 3300005334 Bacteria 4199
17 Ga0068869_100116685 3300005334 Bacteria 2037
18 Ga0070666_10038505 3300005335 Unclassified 3182
19 Ga0070666_10084097 3300005335 Unclassified 2177
20 Ga0070666_10656610 3300005335 Bacteria 767
21 Ga0070680_100125182 3300005336 Unclassified 2147
22 Ga0070682_100048699 3300005337 Bacteria 2639
23 Ga0068868_100006585 3300005338 Bacteria 8234
24 Ga0068868_100054948 3300005338 Unclassified 3140
25 Ga0068868_100106570 3300005338 Unclassified 2274
26 Ga0070660_100009411 3300005339 Bacteria 6870
27 Ga0070689_100013119 3300005340 Bacteria 5989
28 Ga0070689_100055481 3300005340 Bacteria 3071
29 Ga0070689_101837356 3300005340 Bacteria 553
30 Ga0070691_10065223 3300005341 Unclassified 1758
31 Ga0070687_100057128 3300005343 Unclassified 2045
32 Ga0070661_100019182 3300005344 Unclassified 4871
33 Ga0070661_100851577 3300005344 Bacteria 750
34 Ga0070692_10318898 3300005345 Bacteria 955
35 Ga0070668_100008437 3300005347 Bacteria 7651
36 Ga0070669_100004104 3300005353 Bacteria 10556
37 Ga0070669_100066668 3300005353 Unclassified 2654
38 Ga0070669_100269660 3300005353 Bacteria 1360
39 Ga0070675_100025190 3300005354 Bacteria 4768
40 Ga0070675_100418746 3300005354 Unclassified 1197
41 Ga0070675_100710806 3300005354 Unclassified 915
42 Ga0070675_100765174 3300005354 Bacteria 882
43 Ga0070671_100091418 3300005355 Bacteria 2549
44 Ga0070674_100000181 3300005356 Bacteria 29542
45 Ga0070674_100087849 3300005356 Bacteria 2236
46 Ga0070674_100562167 3300005356 Unclassified 959
47 Ga0070673_100070751 3300005364 Bacteria 2801
48 Ga0070673_100279196 3300005364 Bacteria 1465
49 Ga0070688_100004013 3300005365 Bacteria 7634
50 Ga0070688_100670002 3300005365 Bacteria 801
51 Ga0070659_100107509 3300005366 Unclassified 2249
52 Ga0070659_101029462 3300005366 Bacteria 724
53 Ga0070667_100008592 3300005367 Bacteria 8466
54 Ga0070667_100299500 3300005367 Bacteria 1448
55 Ga0070709_10023283 3300005434 Bacteria 3634
56 Ga0070713_100006453 3300005436 Bacteria 8134
57 Ga0070701_10014642 3300005438 Bacteria 3601
58 Ga0070701_10600167 3300005438 Bacteria 729
59 Ga0070711_100489624 3300005439 Bacteria 1012
60 Ga0070711_100633036 3300005439 Bacteria 895
61 Ga0070705_100674022 3300005440 Unclassified 809
62 Ga0070700_100588439 3300005441 Bacteria 870
63 Ga0070694_100087987 3300005444 Unclassified 2174
64 Ga0070694_100170072 3300005444 Bacteria 1605
65 Ga0070708_100012869 3300005445 Bacteria 6836
66 Ga0070663_100103878 3300005455 Unclassified 2124
67 Ga0070678_100070812 3300005456 Unclassified 2609
68 Ga0070678_100136754 3300005456 Unclassified 1955
69 Ga0070678_100148821 3300005456 Bacteria 1883
70 Ga0070678_100329779 3300005456 Bacteria 1306
71 Ga0070678_100812650 3300005456 Bacteria 849
72 Ga0070662_100003398 3300005457 Bacteria 9924
73 Ga0070662_100476663 3300005457 Bacteria 1038
74 Ga0070662_101144156 3300005457 Bacteria 668
75 Ga0070681_10018001 3300005458 Bacteria 7059
76 Ga0070681_10106856 3300005458 Unclassified 2740
77 Ga0070681_10219757 3300005458 Unclassified 1815
78 Ga0070681_10348648 3300005458 Unclassified 1391
79 Ga0068867_100164430 3300005459 Bacteria 1752
80 Ga0068867_100466969 3300005459 Bacteria 1078
81 Ga0068867_100759465 3300005459 Bacteria 861
82 Ga0070685_10131816 3300005466 Unclassified 1564
83 Ga0070685_10193570 3300005466 Bacteria 1317
84 Ga0070706_100000451 3300005467 Bacteria 49196
85 Ga0070698_100570737 3300005471 Bacteria 1071
86 Ga0070698_100900992 3300005471 Unclassified 830
87 Ga0070699_100022221 3300005518 Bacteria 5465
88 Ga0070699_100140647 3300005518 Bacteria 2131
89 Ga0070679_100006888 3300005530 Bacteria 10599
90 Ga0070679_100099690 3300005530 Unclassified 2892
91 Ga0070679_100431185 3300005530 Unclassified 1263
92 Ga0070679_100465569 3300005530 Unclassified 1209
93 Ga0070684_100023646 3300005535 Bacteria 5144
94 Ga0070684_100357611 3300005535 Bacteria 1344
95 Ga0070684_100371442 3300005535 Bacteria 1317
96 Ga0070697_100000376 3300005536 Bacteria 34915
97 Ga0068853_100151416 3300005539 Unclassified 2088
98 Ga0070672_100022534 3300005543 Bacteria 4628
99 Ga0070672_100212205 3300005543 Bacteria 1622
100 Ga0070672_100219929 3300005543 Bacteria 1593
101 Ga0070686_100006388 3300005544 Bacteria 6547
102 Ga0070686_100058941 3300005544 Bacteria 2472
103 Ga0070695_100143105 3300005545 Unclassified 1660
104 Ga0070696_100086998 3300005546 Bacteria 2219
105 Ga0070696_100258564 3300005546 Unclassified 1319
106 Ga0070693_100086216 3300005547 Unclassified 1883
107 Ga0070693_100584566 3300005547 Bacteria 804
108 Ga0070665_100017172 3300005548 Bacteria 7260
109 Ga0070665_100225965 3300005548 Bacteria 1872
110 Ga0070665_100271514 3300005548 Unclassified 1698
111 Ga0068855_100116324 3300005563 Bacteria 3065
112 Ga0068855_100291684 3300005563 Unclassified 1808
113 Ga0068855_100876650 3300005563 Unclassified 949
114 Ga0068855_101433615 3300005563 Unclassified 711
115 Ga0070664_100010032 3300005564 Bacteria 7676
116 Ga0070664_100046861 3300005564 Bacteria 3652
117 Ga0068857_100291053 3300005577 Bacteria 1504
118 Ga0068857_100457804 3300005577 Unclassified 1193
119 Ga0068854_100136304 3300005578 Unclassified 1879
120 Ga0068856_100279352 3300005614 Unclassified 1686
121 Ga0070702_100031245 3300005615 Bacteria 2911
122 Ga0070702_100105781 3300005615 Unclassified 1735
123 Ga0070702_100854816 3300005615 Unclassified 708
124 Ga0068852_100142882 3300005616 Bacteria 2217
125 Ga0068852_100187500 3300005616 Bacteria 1949
126 Ga0068859_100017672 3300005617 Bacteria 7170
127 Ga0068864_100115485 3300005618 Unclassified 2395
128 Ga0068866_10114228 3300005718 Unclassified 1511
129 Ga0068866_10473137 3300005718 Bacteria 824
130 Ga0068861_100014321 3300005719 Bacteria 5562
131 Ga0068861_100092474 3300005719 Unclassified 2389
132 Ga0068861_100418585 3300005719 Bacteria 1193
133 Ga0068861_100929700 3300005719 Unclassified 826
134 Ga0068851_10035245 3300005834 Unclassified 2500
135 Ga0068870_10114441 3300005840 Bacteria 1545
136 Ga0068870_10114865 3300005840 Unclassified 1542
137 Ga0068863_100003831 3300005841 Bacteria 14872
138 Ga0068863_100024394 3300005841 Bacteria 5768
139 Ga0068863_100297567 3300005841 Unclassified 1565
140 Ga0068858_100000609 3300005842 Bacteria 37372
141 Ga0068858_100026567 3300005842 Bacteria 5378
142 Ga0068858_100044179 3300005842 Unclassified 4131
143 Ga0068860_100046530 3300005843 Bacteria 4136
144 Ga0068860_100060525 3300005843 Bacteria 3598
145 Ga0068860_100079131 3300005843 Bacteria 3126
146 Ga0068860_100163805 3300005843 Bacteria 2145
147 Ga0068862_100009185 3300005844 Bacteria 8188
148 Ga0068862_100062317 3300005844 Bacteria 3207
149 Ga0068862_100098797 3300005844 Unclassified 2550
150 Ga0068862_100915379 3300005844 Bacteria 863
151 Ga0081455_10381769 3300005937 Bacteria 984
152 Ga0081540_1307370 3300005983 Unclassified 544
153 Ga0081539_10000108 3300005985 Bacteria 195322
154 Ga0081539_10005820 3300005985 Bacteria 12247
155 Ga0070717_10604763 3300006028 Unclassified 995
156 Ga0070715_10244487 3300006163 Unclassified 935
157 Ga0070716_100031902 3300006173 Bacteria 2869
158 Ga0097621_100000835 3300006237 Bacteria 21687
159 Ga0097621_100003028 3300006237 Bacteria 11540
160 Ga0097621_100168342 3300006237 Unclassified 1887
161 Ga0097621_100654387 3300006237 Bacteria 964
162 Ga0068871_100001082 3300006358 Bacteria 18273
163 Ga0068871_100004800 3300006358 Bacteria 9452
164 Ga0068871_100057989 3300006358 Bacteria 3152
165 Ga0075428_100007062 3300006844 Bacteria 12443
166 Ga0075428_100382042 3300006844 Bacteria 1510
167 Ga0075428_100541265 3300006844 Unclassified 1245
168 Ga0075430_100008204 3300006846 Bacteria 8820
169 Ga0075430_100130670 3300006846 Unclassified 2093
170 Ga0075431_100019478 3300006847 Bacteria 6918
171 Ga0075431_100210768 3300006847 Bacteria 1985
172 Ga0075433_10007068 3300006852 Bacteria 8892
173 Ga0075434_100052113 3300006871 Bacteria 4066
174 Ga0075429_100003402 3300006880 Bacteria 13562
175 Ga0075429_100270346 3300006880 Unclassified 1489
176 Ga0068865_100231984 3300006881 Bacteria 1448
177 Ga0068865_100266469 3300006881 Bacteria 1358
178 Ga0075436_100063294 3300006914 Unclassified 2557
179 Ga0097620_100017672 3300006931 Bacteria 7170
180 Ga0097620_100294376 3300006931 Bacteria 1716
181 Ga0075435_100108429 3300007076 Bacteria 2307
182 Ga0099794_10200946 3300007265 Bacteria 1021
183 Ga0111539_10093870 3300009094 Bacteria 3525
184 Ga0105245_10080559 3300009098 Unclassified 2975
185 Ga0105245_10821544 3300009098 Bacteria 968
186 Ga0105247_10280416 3300009101 Bacteria 1149
187 Ga0105247_10459924 3300009101 Unclassified 919
188 Ga0114129_10094978 3300009147 Bacteria 4129
189 Ga0114129_10440369 3300009147 Unclassified 1711
190 Ga0105241_10005329 3300009174 Bacteria 9503
191 Ga0105248_10416062 3300009177 Bacteria 1514
192 Ga0105248_11285534 3300009177 Bacteria 827
193 Ga0105237_10006452 3300009545 Bacteria 13006
194 Ga0105238_10331831 3300009551 Bacteria 1508
195 Ga0105249_10010494 3300009553 Bacteria 8138
196 Ga0099796_10242280 3300010159 Unclassified 746
197 Ga0105239_10035852 3300010375 Bacteria 5447
198 Ga0105246_10046874 3300011119 Unclassified 2950
199 Ga0157373_10072231 3300013100 Unclassified 2436
200 Ga0157374_10219471 3300013296 Unclassified 1865
201 Ga0157378_10109701 3300013297 Bacteria 2528
202 Ga0157378_10351112 3300013297 Bacteria 1441
203 Ga0163162_10012060 3300013306 Bacteria 8430
204 Ga0163162_10015004 3300013306 Bacteria 7568
205 Ga0163162_11563967 3300013306 Unclassified 752
206 Ga0157375_10042679 3300013308 Bacteria 4391
207 Ga0157375_10086125 3300013308 Bacteria 3192
208 Ga0157375_10174205 3300013308 Unclassified 2300
209 Ga0163163_10232787 3300014325 Bacteria 1891
210 Ga0163163_10533268 3300014325 Bacteria 1236
211 Ga0157380_10009723 3300014326 Bacteria 6902
212 Ga0157380_10496797 3300014326 Bacteria 1184
213 Ga0157380_12287905 3300014326 Unclassified 605
214 Ga0157377_10091405 3300014745 Bacteria 1798
215 Ga0157379_10001094 3300014968 Bacteria 22129
216 Ga0157379_10144170 3300014968 Bacteria 2148
217 Ga0157379_10342598 3300014968 Bacteria 1367
218 Ga0157379_10912316 3300014968 Bacteria 834
219 Ga0157376_10070296 3300014969 Unclassified 2971
220 Ga0157376_10081345 3300014969 Bacteria 2781
221 Ga0157376_10385028 3300014969 Bacteria 1352
222 Ga0157376_11199430 3300014969 Bacteria 787
223 Ga0163161_10078066 3300017792 Unclassified 2433
224 Ga0206350_10635516 3300020080 Unclassified 887
225 Ga0213876_10161970 3300021384 Unclassified 1190
226 Ga0207673_1010521 3300025290 Unclassified 1192
227 Ga0207697_10000783 3300025315 Bacteria 17995
228 Ga0207656_10113826 3300025321 Unclassified 1253
229 Ga0207682_10012317 3300025893 Bacteria 3340
230 Ga0207682_10041134 3300025893 Unclassified 1885
231 Ga0207710_10246554 3300025900 Unclassified 892
232 Ga0207688_10004441 3300025901 Bacteria 7635
233 Ga0207688_10095426 3300025901 Bacteria 1712
234 Ga0207688_10197943 3300025901 Unclassified 1204
235 Ga0207688_10429406 3300025901 Bacteria 822
236 Ga0207680_10244181 3300025903 Unclassified 1238
237 Ga0207680_10462294 3300025903 Unclassified 901
238 Ga0207647_10000699 3300025904 Bacteria 26301
239 Ga0207699_10032724 3300025906 Bacteria 2932
240 Ga0207645_10009292 3300025907 Bacteria 6808
241 Ga0207645_10028134 3300025907 Unclassified 3630
242 Ga0207645_10041259 3300025907 Bacteria 2954
243 Ga0207645_10187802 3300025907 Bacteria 1357
244 Ga0207643_10001771 3300025908 Bacteria 12044
245 Ga0207643_10130555 3300025908 Bacteria 1495
246 Ga0207643_10164716 3300025908 Unclassified 1335
247 Ga0207705_10346217 3300025909 Unclassified 1144
248 Ga0207684_10003366 3300025910 Bacteria 15657
249 Ga0207654_10020855 3300025911 Unclassified 3480
250 Ga0207654_10026268 3300025911 Unclassified 3151
251 Ga0207654_10580345 3300025911 Unclassified 799
252 Ga0207707_10040125 3300025912 Unclassified 4090
253 Ga0207707_10147969 3300025912 Unclassified 2053
254 Ga0207707_10217946 3300025912 Unclassified 1661
255 Ga0207707_10503424 3300025912 Unclassified 1033
256 Ga0207707_10908418 3300025912 Bacteria 728
257 Ga0207695_10074541 3300025913 Unclassified 3456
258 Ga0207695_10473224 3300025913 Bacteria 1135
259 Ga0207671_10128551 3300025914 Bacteria 1943
260 Ga0207671_10143427 3300025914 Unclassified 1842
261 Ga0207663_10077730 3300025916 Unclassified 2161
262 Ga0207663_10336772 3300025916 Bacteria 1138
263 Ga0207663_10905687 3300025916 Unclassified 705
264 Ga0207662_10022592 3300025918 Bacteria 3608
265 Ga0207657_10001800 3300025919 Bacteria 23117
266 Ga0207649_10387230 3300025920 Unclassified 1043
267 Ga0207652_10045173 3300025921 Unclassified 3754
268 Ga0207652_10051337 3300025921 Bacteria 3535
269 Ga0207652_11132903 3300025921 Unclassified 683
270 Ga0207681_10050494 3300025923 Unclassified 2814
271 Ga0207681_10096939 3300025923 Bacteria 2118
272 Ga0207681_10135810 3300025923 Unclassified 1825
273 Ga0207694_10831682 3300025924 Unclassified 780
274 Ga0207650_10036319 3300025925 Bacteria 3584
275 Ga0207659_10488698 3300025926 Unclassified 1041
276 Ga0207659_10744890 3300025926 Bacteria 840
277 Ga0207687_10004333 3300025927 Bacteria 9473
278 Ga0207687_10606049 3300025927 Unclassified 923
279 Ga0207700_10017739 3300025928 Unclassified 4761
280 Ga0207690_10548379 3300025932 Unclassified 940
281 Ga0207706_10000075 3300025933 Bacteria 102980
282 Ga0207706_10007634 3300025933 Bacteria 9997
283 Ga0207706_10366405 3300025933 Bacteria 1252
284 Ga0207706_10772147 3300025933 Bacteria 818
285 Ga0207686_10187841 3300025934 Unclassified 1471
286 Ga0207709_10766848 3300025935 Bacteria 776
287 Ga0207670_10008502 3300025936 Bacteria 5801
288 Ga0207669_10082019 3300025937 Bacteria 2069
289 Ga0207669_10200359 3300025937 Bacteria 1448
290 Ga0207669_10760912 3300025937 Unclassified 801
291 Ga0207669_10847613 3300025937 Unclassified 760
292 Ga0207704_10145492 3300025938 Bacteria 1664
293 Ga0207704_10231508 3300025938 Bacteria 1374
294 Ga0207704_10655101 3300025938 Unclassified 865
295 Ga0207704_10726555 3300025938 Bacteria 824
296 Ga0207665_10021533 3300025939 Unclassified 4240
297 Ga0207691_10040746 3300025940 Unclassified 4290
298 Ga0207691_10613653 3300025940 Bacteria 920
299 Ga0207711_10040054 3300025941 Bacteria 3985
300 Ga0207711_11205310 3300025941 Bacteria 699
301 Ga0207689_10000087 3300025942 Bacteria 74575
302 Ga0207689_10019405 3300025942 Bacteria 5731
303 Ga0207689_10080367 3300025942 Unclassified 2680
304 Ga0207661_10146560 3300025944 Unclassified 2037
305 Ga0207679_10035088 3300025945 Bacteria 3545
306 Ga0207679_10071369 3300025945 Bacteria 2619
307 Ga0207667_10015261 3300025949 Bacteria 8735
308 Ga0207667_10735068 3300025949 Bacteria 987
309 Ga0207651_10002325 3300025960 Bacteria 9058
310 Ga0207651_10147148 3300025960 Bacteria 1829
311 Ga0207651_10176531 3300025960 Bacteria 1690
312 Ga0207712_10086454 3300025961 Unclassified 2297
313 Ga0207668_10080568 3300025972 Unclassified 2359
314 Ga0207658_10273298 3300025986 Unclassified 1445
315 Ga0207658_10800691 3300025986 Unclassified 855
316 Ga0207677_10022822 3300026023 Bacteria 3853
317 Ga0207677_10187107 3300026023 Unclassified 1634
318 Ga0207677_10217374 3300026023 Unclassified 1530
319 Ga0207677_10651843 3300026023 Bacteria 929
320 Ga0207703_10020622 3300026035 Bacteria 5156
321 Ga0207703_10052325 3300026035 Bacteria 3315
322 Ga0207703_10331404 3300026035 Unclassified 1396
323 Ga0207639_10274836 3300026041 Unclassified 1479
324 Ga0207678_10004879 3300026067 Bacteria 12045
325 Ga0207678_10103952 3300026067 Unclassified 2424
326 Ga0207708_10040186 3300026075 Bacteria 3566
327 Ga0207708_10505914 3300026075 Unclassified 1013
328 Ga0207702_11260986 3300026078 Unclassified 733
329 Ga0207641_10010449 3300026088 Bacteria 7629
330 Ga0207641_10030676 3300026088 Bacteria 4454
331 Ga0207641_10315870 3300026088 Bacteria 1480
332 Ga0207648_10017492 3300026089 Bacteria 6521
333 Ga0207648_10060045 3300026089 Unclassified 3316
334 Ga0207648_10302357 3300026089 Bacteria 1435
335 Ga0207674_10010091 3300026116 Bacteria 10739
336 Ga0207674_10487540 3300026116 Bacteria 1191
337 Ga0207675_100002618 3300026118 Bacteria 17803
338 Ga0207675_100053477 3300026118 Bacteria 3767
339 Ga0207675_100109871 3300026118 Bacteria 2602
340 Ga0207675_100280346 3300026118 Bacteria 1619
341 Ga0207683_10076922 3300026121 Bacteria 2955
342 Ga0207683_10182366 3300026121 Bacteria 1904
343 Ga0207683_10294229 3300026121 Unclassified 1485
344 Ga0207683_10416870 3300026121 Unclassified 1236
345 Ga0207683_10546116 3300026121 Bacteria 1071
346 Ga0207698_10195144 3300026142 Bacteria 1808
347 Ga0207698_10226850 3300026142 Bacteria 1693
348 Ga0209968_1036958 3300027526 Bacteria 827
349 Ga0209966_1057332 3300027695 Bacteria 837
350 Ga0209974_10035920 3300027876 Bacteria 1645
351 Ga0207428_10001523 3300027907 Bacteria 24202
352 Ga0207428_10254312 3300027907 Bacteria 1309
353 Ga0268266_10064322 3300028379 Bacteria 3169
354 Ga0268266_10412690 3300028379 Unclassified 1278
355 Ga0268265_10129627 3300028380 Unclassified 2093
356 Ga0268265_10361309 3300028380 Bacteria 1329
357 Ga0268264_10144295 3300028381 Unclassified 2127
358 Ga0268264_10368428 3300028381 Unclassified 1372
359 Ga0268264_10792415 3300028381 Bacteria 946
360 Ga0265318_10058521 3300028577 Unclassified 1438
361 Ga0265760_10155263 3300031090 Unclassified 752
362 Ga0265328_10368750 3300031239 Bacteria 561
363 Ga0265331_10116233 3300031250 Unclassified 1225
364 Ga0307508_10198481 3300031616 Bacteria 1607
365 Ga0265314_10035453 3300031711 Bacteria 3636
366 Ga0307411_11010606 3300032005 Bacteria 745
367 Ga0373952_0009364 3300035092 Unclassified 1874
368 Ga0373932_0057885 3300035112 Bacteria 1170
369 Ga0373941_0006530 3300035115 Unclassified 2815
370 Ga0373954_0064199 3300035118 Bacteria 1736
371 Ga0373954_0104444 3300035118 Bacteria 1368
372 Ga0373943_0007328 3300035170 Bacteria 4952
373 Ga0373946_0002356 3300035171 Bacteria 6679
374 Ga0373955_0006759 3300035172 Bacteria 5238
375 Ga0373955_0338467 3300035172 Bacteria 910
376 Ga0373955_0412417 3300035172 Unclassified 821
377 Ga0373942_0177858 3300035207 Bacteria 696
378 Ga0373961_0029212 3300035241 Unclassified 1526
379 Ga0373924_0017042 3300035410 Bacteria 2782
380 Ga0373924_0351395 3300035410 Bacteria 657
381 Ga0373931_0538765 3300035691 Unclassified 757
382 Ga0373935_0144515 3300035692 Unclassified 1609
383 Ga0373927_0162797 3300035695 Bacteria 1462
384 Ga0373947_0014919 3300035725 Bacteria 4459
385 Ga0373937_0360881 3300036401 Unclassified 1377
386 Ga0373937_1396756 3300036401 Bacteria 648
387 Ga0436365_0496957 3300039437 Unclassified 1404
388 Ga0436361_0014451 3300039447 Bacteria 1793
389 Ga0436361_0556487 3300039447 Bacteria 7123
390 Ga0436361_0609563 3300039447 Unclassified 798
391 Ga0439444_0098830 3300042437 Bacteria 659
392 Ga0451576_0353940 3300045051 Unclassified 1537
393 Ga0451576_1561849 3300045051 Bacteria 685
394 Ga0495592_0089586 3300046454 Unclassified 2209
395 Ga0495580_0048421 3300046472 Bacteria 3010
396 Ga0495580_0082038 3300046472 Unclassified 2247
397 Ga0495580_0221062 3300046472 Bacteria 1302
398 Ga0495580_0299079 3300046472 Unclassified 1096
399 Ga0495639_0358726 3300046475 Unclassified 732
400 Ga0495664_0096222 3300046477 Unclassified 1782
401 Ga0495608_0001969 3300046511 Bacteria 14721
402 Ga0495628_0071114 3300046516 Bacteria 2712
403 Ga0495630_0178619 3300046517 Unclassified 1618
404 Ga0495630_0294701 3300046517 Bacteria 1240
405 Ga0495652_0061077 3300046529 Unclassified 3183
406 Ga0495665_0369642 3300046531 Bacteria 729
407 Ga0495586_0043554 3300046535 Unclassified 2418
408 Ga0495645_0114918 3300046543 Unclassified 1901
409 Ga0495667_0300795 3300046559 Unclassified 1016
410 Ga0495634_0040271 3300046642 Bacteria 3179
411 Ga0495588_0360520 3300046674 Unclassified 764
412 Ga0495657_0113615 3300046675 Bacteria 1713
413 Ga0495657_0612819 3300046675 Bacteria 629
414 Ga0495669_0001029 3300046684 Bacteria 11623
415 Ga0495669_0020151 3300046684 Bacteria 2884
416 Ga0495613_0001205 3300046689 Bacteria 19765
417 Ga0495600_0388695 3300046809 Bacteria 869
418 Ga0495581_0054737 3300047315 Unclassified 2303
419 Ga0495604_0014976 3300047317 Bacteria 6186
420 Ga0495674_0063705 3300047319 Unclassified 3206
421 Ga0495672_0096546 3300047320 Bacteria 1611
422 Ga0495680_0166017 3300047322 Bacteria 1601
423 Ga0495675_0386496 3300047444 Bacteria 818
424 Ga0495684_0000066 3300047471 Bacteria 72827
425 Ga0495602_0400532 3300048088 Unclassified 979
426 Ga0496100_0129127 3300048903 Bacteria 1778
427 Ga0496102_0010730 3300048905 Bacteria 7891
428 Ga0496104_0014278 3300048907 Bacteria 7170
429 Ga0496104_0309398 3300048907 Bacteria 1493
430 Ga0496104_0332476 3300048907 Unclassified 1432
431 Ga0496106_0001891 3300048909 Bacteria 15680
432 Ga0496107_0072019 3300048910 Unclassified 2512
433 Ga0496108_1002184 3300048911 Unclassified 713
434 Ga0496109_0350302 3300048912 Bacteria 1395
435 Ga0496109_0361046 3300048912 Unclassified 1372
436 Ga0496112_0092964 3300048915 Bacteria 2986
437 Ga0501040_1209444 3300049576 Unclassified 548
438 Ga0501042_0460064 3300049578 Unclassified 923
439 nmdc:mga05p37_385474_c1 3300050507 Unclassified 1641
440 nmdc:mga05p37_83989_c1 3300050507 Bacteria 3923
441 nmdc:mga09592_1234438_c1 3300050508 Bacteria 617
442 nmdc:mga09592_200772_c1 3300050508 Bacteria 1727
443 nmdc:mga09592_5178_c1 3300050508 Bacteria 10597
444 nmdc:mga0qj67_194209_c1 3300050509 Bacteria 1649
445 nmdc:mga0qj67_20263_c1 3300050509 Bacteria 5089
446 nmdc:mga0qj67_4569_c1 3300050509 Bacteria 10036
447 nmdc:mga06r32_214404_c1 3300050510 Bacteria 1913
448 nmdc:mga06r32_237881_c1 3300050510 Bacteria 1809
449 nmdc:mga08y16_1062236_c1 3300050511 Bacteria 787
450 nmdc:mga08y16_678487_c1 3300050511 Bacteria 1032
451 nmdc:mga0n895_482371_c1 3300050512 Bacteria 1250
452 nmdc:mga0n895_50513_c1 3300050512 Bacteria 4077
453 nmdc:mga0n895_873435_c1 3300050512 Bacteria 886
454 nmdc:mga0rr50_107603_c1 3300050513 Bacteria 2201
455 nmdc:mga0a205_694111_c1 3300050515 Bacteria 868
456 Ga0495601_0144505 3300053077 Unclassified 1552
457 Ga0495595_0027837 3300053084 Unclassified 2521
458 Ga0495595_0512804 3300053084 Bacteria 611
459 Ga0495619_0000807 3300053085 Bacteria 20478
460 Ga0495619_0301680 3300053085 Bacteria 1109
461 Ga0501082_1609382 3300060353 Unclassified 567
462 Ga0530510_1117388 3300061734 Bacteria 604

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005458 Ga0070681_10018001 Ga0070681_100180013 135
2 3300005530 Ga0070679_100006888 Ga0070679_10000688812 135
3 3300025912 Ga0207707_10147969 Ga0207707_101479692 135
4 3300025921 Ga0207652_10051337 Ga0207652_100513372 135
5 3300048911 Ga0496108_1002184 Ga0496108_1002184_123_536 135
6 3300048912 Ga0496109_0350302 Ga0496109_0350302_932_1345 135
7 3300048915 Ga0496112_0092964 Ga0496112_0092964_702_1115 135
8 3300005439 Ga0070711_100633036 Ga0070711_1006330362 143
9 3300025916 Ga0207663_10905687 Ga0207663_109056871 143
10 3300005338 Ga0068868_100006585 Ga0068868_1000065856 149
11 3300005340 Ga0070689_101837356 Ga0070689_1018373561 149
12 3300005344 Ga0070661_100851577 Ga0070661_1008515771 149
13 3300005457 Ga0070662_101144156 Ga0070662_1011441561 149
14 3300005466 Ga0070685_10193570 Ga0070685_101935702 149
15 3300005548 Ga0070665_100225965 Ga0070665_1002259651 149
16 3300005563 Ga0068855_100116324 Ga0068855_1001163241 149
17 3300005616 Ga0068852_100187500 Ga0068852_1001875002 149
18 3300005617 Ga0068859_100017672 Ga0068859_1000176722 149
19 3300005719 Ga0068861_100418585 Ga0068861_1004185852 149
20 3300005841 Ga0068863_100024394 Ga0068863_1000243945 149
21 3300005842 Ga0068858_100000609 Ga0068858_10000060917 149
22 3300005843 Ga0068860_100079131 Ga0068860_1000791312 149
23 3300005844 Ga0068862_100915379 Ga0068862_1009153791 149
24 3300006881 Ga0068865_100266469 Ga0068865_1002664691 149
25 3300006931 Ga0097620_100017672 Ga0097620_1000176726 149
26 3300009098 Ga0105245_10821544 Ga0105245_108215442 149
27 3300009177 Ga0105248_11285534 Ga0105248_112855341 149
28 3300009545 Ga0105237_10006452 Ga0105237_100064527 149
29 3300010375 Ga0105239_10035852 Ga0105239_100358526 149
30 3300013306 Ga0163162_10015004 Ga0163162_100150046 149
31 3300025901 Ga0207688_10429406 Ga0207688_104294061 149
32 3300025904 Ga0207647_10000699 Ga0207647_100006999 149
33 3300025914 Ga0207671_10128551 Ga0207671_101285512 149
34 3300025933 Ga0207706_10772147 Ga0207706_107721471 149
35 3300025942 Ga0207689_10000087 Ga0207689_1000008758 149
36 3300025949 Ga0207667_10735068 Ga0207667_107350681 149
37 3300026023 Ga0207677_10022822 Ga0207677_100228222 149
38 3300026035 Ga0207703_10020622 Ga0207703_100206223 149
39 3300026088 Ga0207641_10030676 Ga0207641_100306763 149
40 3300026089 Ga0207648_10017492 Ga0207648_100174921 149
41 3300026118 Ga0207675_100053477 Ga0207675_1000534775 149
42 3300026142 Ga0207698_10195144 Ga0207698_101951442 149
43 3300028381 Ga0268264_10792415 Ga0268264_107924152 149
44 3300048907 Ga0496104_0309398 Ga0496104_0309398_509_994 149
45 3300035695 Ga0373927_0162797 Ga0373927_0162797_12_464 150
46 3300005329 Ga0070683_102184316 Ga0070683_1021843161 156
47 3300014325 Ga0163163_10533268 Ga0163163_105332681 156
48 3300031616 Ga0307508_10198481 Ga0307508_101984813 156
49 3300005327 Ga0070658_10154856 Ga0070658_101548563 157
50 3300005328 Ga0070676_10007517 Ga0070676_100075176 157
51 3300005329 Ga0070683_100056050 Ga0070683_1000560504 157
52 3300005334 Ga0068869_100024263 Ga0068869_1000242635 157
53 3300005335 Ga0070666_10084097 Ga0070666_100840972 157
54 3300005336 Ga0070680_100125182 Ga0070680_1001251824 157
55 3300005337 Ga0070682_100048699 Ga0070682_1000486992 157
56 3300005338 Ga0068868_100054948 Ga0068868_1000549483 157
57 3300005339 Ga0070660_100009411 Ga0070660_1000094117 157
58 3300005340 Ga0070689_100055481 Ga0070689_1000554812 157
59 3300005341 Ga0070691_10065223 Ga0070691_100652232 157
60 3300005343 Ga0070687_100057128 Ga0070687_1000571282 157
61 3300005345 Ga0070692_10318898 Ga0070692_103188981 157
62 3300005347 Ga0070668_100008437 Ga0070668_1000084377 157
63 3300005353 Ga0070669_100066668 Ga0070669_1000666682 157
64 3300005366 Ga0070659_100107509 Ga0070659_1001075092 157
65 3300005367 Ga0070667_100008592 Ga0070667_1000085929 157
66 3300005434 Ga0070709_10023283 Ga0070709_100232833 157
67 3300005436 Ga0070713_100006453 Ga0070713_1000064532 157
68 3300005440 Ga0070705_100674022 Ga0070705_1006740222 157
69 3300005444 Ga0070694_100170072 Ga0070694_1001700721 157
70 3300005455 Ga0070663_100103878 Ga0070663_1001038782 157
71 3300005456 Ga0070678_100136754 Ga0070678_1001367542 157
72 3300005457 Ga0070662_100003398 Ga0070662_10000339810 157
73 3300005458 Ga0070681_10106856 Ga0070681_101068562 157
74 3300005458 Ga0070681_10219757 Ga0070681_102197572 157
75 3300005458 Ga0070681_10348648 Ga0070681_103486482 157
76 3300005459 Ga0068867_100466969 Ga0068867_1004669691 157
77 3300005530 Ga0070679_100099690 Ga0070679_1000996902 157
78 3300005530 Ga0070679_100431185 Ga0070679_1004311852 157
79 3300005530 Ga0070679_100465569 Ga0070679_1004655692 157
80 3300005535 Ga0070684_100023646 Ga0070684_1000236465 157
81 3300005535 Ga0070684_100357611 Ga0070684_1003576111 157
82 3300005535 Ga0070684_100371442 Ga0070684_1003714422 157
83 3300005539 Ga0068853_100151416 Ga0068853_1001514162 157
84 3300005544 Ga0070686_100006388 Ga0070686_1000063882 157
85 3300005545 Ga0070695_100143105 Ga0070695_1001431052 157
86 3300005546 Ga0070696_100086998 Ga0070696_1000869982 157
87 3300005546 Ga0070696_100258564 Ga0070696_1002585642 157
88 3300005547 Ga0070693_100086216 Ga0070693_1000862162 157
89 3300005547 Ga0070693_100584566 Ga0070693_1005845661 157
90 3300005548 Ga0070665_100017172 Ga0070665_1000171727 157
91 3300005563 Ga0068855_100291684 Ga0068855_1002916842 157
92 3300005563 Ga0068855_100876650 Ga0068855_1008766501 157
93 3300005563 Ga0068855_101433615 Ga0068855_1014336151 157
94 3300005564 Ga0070664_100046861 Ga0070664_1000468612 157
95 3300005577 Ga0068857_100457804 Ga0068857_1004578042 157
96 3300005578 Ga0068854_100136304 Ga0068854_1001363042 157
97 3300005614 Ga0068856_100279352 Ga0068856_1002793523 157
98 3300005615 Ga0070702_100031245 Ga0070702_1000312453 157
99 3300005615 Ga0070702_100854816 Ga0070702_1008548161 157
100 3300005616 Ga0068852_100142882 Ga0068852_1001428822 157
101 3300005618 Ga0068864_100115485 Ga0068864_1001154852 157
102 3300005718 Ga0068866_10114228 Ga0068866_101142282 157
103 3300005719 Ga0068861_100092474 Ga0068861_1000924742 157
104 3300005834 Ga0068851_10035245 Ga0068851_100352453 157
105 3300005840 Ga0068870_10114865 Ga0068870_101148652 157
106 3300005841 Ga0068863_100297567 Ga0068863_1002975672 157
107 3300005842 Ga0068858_100044179 Ga0068858_1000441794 157
108 3300005843 Ga0068860_100060525 Ga0068860_1000605252 157
109 3300005844 Ga0068862_100098797 Ga0068862_1000987972 157
110 3300005937 Ga0081455_10381769 Ga0081455_103817691 157
111 3300006237 Ga0097621_100000835 Ga0097621_1000008359 157
112 3300006237 Ga0097621_100168342 Ga0097621_1001683422 157
113 3300006358 Ga0068871_100001082 Ga0068871_1000010825 157
114 3300006358 Ga0068871_100004800 Ga0068871_1000048003 157
115 3300006358 Ga0068871_100057989 Ga0068871_1000579892 157
116 3300006880 Ga0075429_100270346 Ga0075429_1002703462 157
117 3300006914 Ga0075436_100063294 Ga0075436_1000632945 157
118 3300007076 Ga0075435_100108429 Ga0075435_1001084293 157
119 3300009551 Ga0105238_10331831 Ga0105238_103318312 157
120 3300013100 Ga0157373_10072231 Ga0157373_100722313 157
121 3300013297 Ga0157378_10351112 Ga0157378_103511122 157
122 3300014969 Ga0157376_10385028 Ga0157376_103850282 157
123 3300014969 Ga0157376_11199430 Ga0157376_111994302 157
124 3300020080 Ga0206350_10635516 Ga0206350_106355162 157
125 3300021384 Ga0213876_10161970 Ga0213876_101619701 157
126 3300025321 Ga0207656_10113826 Ga0207656_101138262 157
127 3300025903 Ga0207680_10244181 Ga0207680_102441811 157
128 3300025906 Ga0207699_10032724 Ga0207699_100327242 157
129 3300025907 Ga0207645_10009292 Ga0207645_100092927 157
130 3300025908 Ga0207643_10164716 Ga0207643_101647162 157
131 3300025909 Ga0207705_10346217 Ga0207705_103462172 157
132 3300025911 Ga0207654_10020855 Ga0207654_100208555 157
133 3300025911 Ga0207654_10580345 Ga0207654_105803451 157
134 3300025912 Ga0207707_10040125 Ga0207707_100401252 157
135 3300025912 Ga0207707_10217946 Ga0207707_102179462 157
136 3300025912 Ga0207707_10503424 Ga0207707_105034242 157
137 3300025912 Ga0207707_10908418 Ga0207707_109084181 157
138 3300025913 Ga0207695_10074541 Ga0207695_100745413 157
139 3300025913 Ga0207695_10473224 Ga0207695_104732242 157
140 3300025914 Ga0207671_10143427 Ga0207671_101434272 157
141 3300025919 Ga0207657_10001800 Ga0207657_1000180013 157
142 3300025921 Ga0207652_10045173 Ga0207652_100451732 157
143 3300025921 Ga0207652_11132903 Ga0207652_111329032 157
144 3300025923 Ga0207681_10135810 Ga0207681_101358102 157
145 3300025924 Ga0207694_10831682 Ga0207694_108316822 157
146 3300025927 Ga0207687_10004333 Ga0207687_100043332 157
147 3300025928 Ga0207700_10017739 Ga0207700_100177395 157
148 3300025933 Ga0207706_10000075 Ga0207706_1000007517 157
149 3300025934 Ga0207686_10187841 Ga0207686_101878412 157
150 3300025938 Ga0207704_10655101 Ga0207704_106551012 157
151 3300025941 Ga0207711_10040054 Ga0207711_100400542 157
152 3300025942 Ga0207689_10080367 Ga0207689_100803672 157
153 3300025944 Ga0207661_10146560 Ga0207661_101465602 157
154 3300025945 Ga0207679_10071369 Ga0207679_100713692 157
155 3300025949 Ga0207667_10015261 Ga0207667_100152612 157
156 3300025972 Ga0207668_10080568 Ga0207668_100805682 157
157 3300025986 Ga0207658_10800691 Ga0207658_108006912 157
158 3300026023 Ga0207677_10187107 Ga0207677_101871072 157
159 3300026035 Ga0207703_10052325 Ga0207703_100523254 157
160 3300026041 Ga0207639_10274836 Ga0207639_102748362 157
161 3300026067 Ga0207678_10004879 Ga0207678_100048795 157
162 3300026078 Ga0207702_11260986 Ga0207702_112609861 157
163 3300026089 Ga0207648_10060045 Ga0207648_100600453 157
164 3300026116 Ga0207674_10010091 Ga0207674_100100914 157
165 3300026118 Ga0207675_100109871 Ga0207675_1001098713 157
166 3300026121 Ga0207683_10294229 Ga0207683_102942291 157
167 3300026142 Ga0207698_10226850 Ga0207698_102268502 157
168 3300028379 Ga0268266_10412690 Ga0268266_104126902 157
169 3300028381 Ga0268264_10368428 Ga0268264_103684282 157
170 3300028577 Ga0265318_10058521 Ga0265318_100585212 157
171 3300031239 Ga0265328_10368750 Ga0265328_103687501 157
172 3300031250 Ga0265331_10116233 Ga0265331_101162332 157
173 3300031711 Ga0265314_10035453 Ga0265314_100354533 157
174 3300035118 Ga0373954_0064199 Ga0373954_0064199_24_497 157
175 3300035118 Ga0373954_0104444 Ga0373954_0104444_775_1248 157
176 3300035170 Ga0373943_0007328 Ga0373943_0007328_231_704 157
177 3300035171 Ga0373946_0002356 Ga0373946_0002356_2097_2570 157
178 3300035172 Ga0373955_0006759 Ga0373955_0006759_2464_2937 157
179 3300035172 Ga0373955_0338467 Ga0373955_0338467_423_896 157
180 3300035172 Ga0373955_0412417 Ga0373955_0412417_17_490 157
181 3300035410 Ga0373924_0017042 Ga0373924_0017042_1559_2032 157
182 3300035410 Ga0373924_0351395 Ga0373924_0351395_28_501 157
183 3300035692 Ga0373935_0144515 Ga0373935_0144515_521_994 157
184 3300035725 Ga0373947_0014919 Ga0373947_0014919_2576_3049 157
185 3300036401 Ga0373937_0360881 Ga0373937_0360881_742_1215 157
186 3300036401 Ga0373937_1396756 Ga0373937_1396756_141_614 157
187 3300039437 Ga0436365_0496957 Ga0436365_0496957_116_589 157
188 3300046454 Ga0495592_0089586 Ga0495592_0089586_858_1331 157
189 3300046472 Ga0495580_0048421 Ga0495580_0048421_482_955 157
190 3300046472 Ga0495580_0221062 Ga0495580_0221062_348_821 157
191 3300046472 Ga0495580_0299079 Ga0495580_0299079_201_674 157
192 3300046475 Ga0495639_0358726 Ga0495639_0358726_232_705 157
193 3300046477 Ga0495664_0096222 Ga0495664_0096222_1260_1733 157
194 3300046511 Ga0495608_0001969 Ga0495608_0001969_12811_13284 157
195 3300046516 Ga0495628_0071114 Ga0495628_0071114_2228_2701 157
196 3300046517 Ga0495630_0178619 Ga0495630_0178619_1004_1477 157
197 3300046517 Ga0495630_0294701 Ga0495630_0294701_648_1121 157
198 3300046529 Ga0495652_0061077 Ga0495652_0061077_1413_1886 157
199 3300046531 Ga0495665_0369642 Ga0495665_0369642_139_612 157
200 3300046535 Ga0495586_0043554 Ga0495586_0043554_969_1442 157
201 3300046543 Ga0495645_0114918 Ga0495645_0114918_859_1332 157
202 3300046559 Ga0495667_0300795 Ga0495667_0300795_253_726 157
203 3300046642 Ga0495634_0040271 Ga0495634_0040271_907_1380 157
204 3300046674 Ga0495588_0360520 Ga0495588_0360520_186_659 157
205 3300046675 Ga0495657_0113615 Ga0495657_0113615_939_1412 157
206 3300046675 Ga0495657_0612819 Ga0495657_0612819_95_568 157
207 3300046684 Ga0495669_0001029 Ga0495669_0001029_2467_2940 157
208 3300046684 Ga0495669_0020151 Ga0495669_0020151_370_843 157
209 3300046689 Ga0495613_0001205 Ga0495613_0001205_13242_13715 157
210 3300046809 Ga0495600_0388695 Ga0495600_0388695_148_621 157
211 3300047315 Ga0495581_0054737 Ga0495581_0054737_1236_1709 157
212 3300047317 Ga0495604_0014976 Ga0495604_0014976_4878_5351 157
213 3300047319 Ga0495674_0063705 Ga0495674_0063705_1981_2454 157
214 3300047322 Ga0495680_0166017 Ga0495680_0166017_40_513 157
215 3300047444 Ga0495675_0386496 Ga0495675_0386496_270_743 157
216 3300047471 Ga0495684_0000066 Ga0495684_0000066_65705_66178 157
217 3300048088 Ga0495602_0400532 Ga0495602_0400532_312_785 157
218 3300050508 nmdc:mga09592_200772_c1 nmdc:mga09592_200772_c1_904_1389 157
219 3300050509 nmdc:mga0qj67_20263_c1 nmdc:mga0qj67_20263_c1_4468_4953 157
220 3300050512 nmdc:mga0n895_482371_c1 nmdc:mga0n895_482371_c1_98_571 157
221 3300050512 nmdc:mga0n895_873435_c1 nmdc:mga0n895_873435_c1_45_527 157
222 3300053077 Ga0495601_0144505 Ga0495601_0144505_316_789 157
223 3300053084 Ga0495595_0027837 Ga0495595_0027837_1471_1944 157
224 3300053084 Ga0495595_0512804 Ga0495595_0512804_30_503 157
225 3300053085 Ga0495619_0000807 Ga0495619_0000807_10874_11347 157
226 3300053085 Ga0495619_0301680 Ga0495619_0301680_486_959 157
227 3300060353 Ga0501082_1609382 Ga0501082_1609382_67_552 157
228 3300005293 Ga0065715_10123141 Ga0065715_101231413 158
229 3300005328 Ga0070676_10013485 Ga0070676_100134854 158
230 3300005330 Ga0070690_100006040 Ga0070690_1000060405 158
231 3300005333 Ga0070677_10009513 Ga0070677_100095133 158
232 3300005335 Ga0070666_10038505 Ga0070666_100385051 158
233 3300005338 Ga0068868_100106570 Ga0068868_1001065703 158
234 3300005340 Ga0070689_100013119 Ga0070689_1000131192 158
235 3300005344 Ga0070661_100019182 Ga0070661_1000191825 158
236 3300005353 Ga0070669_100004104 Ga0070669_1000041044 158
237 3300005354 Ga0070675_100418746 Ga0070675_1004187462 158
238 3300005356 Ga0070674_100562167 Ga0070674_1005621671 158
239 3300005365 Ga0070688_100004013 Ga0070688_1000040135 158
240 3300005366 Ga0070659_101029462 Ga0070659_1010294622 158
241 3300005438 Ga0070701_10014642 Ga0070701_100146423 158
242 3300005439 Ga0070711_100489624 Ga0070711_1004896241 158
243 3300005441 Ga0070700_100588439 Ga0070700_1005884392 158
244 3300005444 Ga0070694_100087987 Ga0070694_1000879873 158
245 3300005445 Ga0070708_100012869 Ga0070708_1000128692 158
246 3300005456 Ga0070678_100812650 Ga0070678_1008126501 158
247 3300005459 Ga0068867_100164430 Ga0068867_1001644303 158
248 3300005466 Ga0070685_10131816 Ga0070685_101318163 158
249 3300005467 Ga0070706_100000451 Ga0070706_10000045123 158
250 3300005471 Ga0070698_100570737 Ga0070698_1005707372 158
251 3300005518 Ga0070699_100140647 Ga0070699_1001406472 158
252 3300005536 Ga0070697_100000376 Ga0070697_10000037610 158
253 3300005543 Ga0070672_100022534 Ga0070672_1000225344 158
254 3300005548 Ga0070665_100271514 Ga0070665_1002715143 158
255 3300005564 Ga0070664_100010032 Ga0070664_1000100324 158
256 3300005615 Ga0070702_100105781 Ga0070702_1001057813 158
257 3300005719 Ga0068861_100014321 Ga0068861_1000143214 158
258 3300005719 Ga0068861_100929700 Ga0068861_1009297002 158
259 3300005841 Ga0068863_100003831 Ga0068863_1000038314 158
260 3300005842 Ga0068858_100026567 Ga0068858_1000265674 158
261 3300005843 Ga0068860_100046530 Ga0068860_1000465303 158
262 3300005843 Ga0068860_100163805 Ga0068860_1001638053 158
263 3300005844 Ga0068862_100009185 Ga0068862_1000091854 158
264 3300005983 Ga0081540_1307370 Ga0081540_13073701 158
265 3300006028 Ga0070717_10604763 Ga0070717_106047632 158
266 3300006163 Ga0070715_10244487 Ga0070715_102444872 158
267 3300006173 Ga0070716_100031902 Ga0070716_1000319023 158
268 3300006852 Ga0075433_10007068 Ga0075433_100070683 158
269 3300006871 Ga0075434_100052113 Ga0075434_1000521133 158
270 3300006881 Ga0068865_100231984 Ga0068865_1002319842 158
271 3300007265 Ga0099794_10200946 Ga0099794_102009461 158
272 3300009098 Ga0105245_10080559 Ga0105245_100805594 158
273 3300009101 Ga0105247_10280416 Ga0105247_102804162 158
274 3300009101 Ga0105247_10459924 Ga0105247_104599242 158
275 3300009147 Ga0114129_10440369 Ga0114129_104403692 158
276 3300009174 Ga0105241_10005329 Ga0105241_100053295 158
277 3300009177 Ga0105248_10416062 Ga0105248_104160622 158
278 3300009553 Ga0105249_10010494 Ga0105249_100104946 158
279 3300011119 Ga0105246_10046874 Ga0105246_100468743 158
280 3300013296 Ga0157374_10219471 Ga0157374_102194713 158
281 3300013297 Ga0157378_10109701 Ga0157378_101097014 158
282 3300013306 Ga0163162_10012060 Ga0163162_100120604 158
283 3300013306 Ga0163162_11563967 Ga0163162_115639672 158
284 3300013308 Ga0157375_10042679 Ga0157375_100426794 158
285 3300014326 Ga0157380_10009723 Ga0157380_100097233 158
286 3300014968 Ga0157379_10001094 Ga0157379_1000109412 158
287 3300014968 Ga0157379_10144170 Ga0157379_101441702 158
288 3300014968 Ga0157379_10342598 Ga0157379_103425981 158
289 3300014968 Ga0157379_10912316 Ga0157379_109123161 158
290 3300014969 Ga0157376_10081345 Ga0157376_100813452 158
291 3300017792 Ga0163161_10078066 Ga0163161_100780663 158
292 3300025290 Ga0207673_1010521 Ga0207673_10105212 158
293 3300025315 Ga0207697_10000783 Ga0207697_100007839 158
294 3300025893 Ga0207682_10041134 Ga0207682_100411341 158
295 3300025900 Ga0207710_10246554 Ga0207710_102465541 158
296 3300025901 Ga0207688_10004441 Ga0207688_100044413 158
297 3300025903 Ga0207680_10462294 Ga0207680_104622941 158
298 3300025907 Ga0207645_10028134 Ga0207645_100281344 158
299 3300025908 Ga0207643_10001771 Ga0207643_100017718 158
300 3300025910 Ga0207684_10003366 Ga0207684_100033669 158
301 3300025911 Ga0207654_10026268 Ga0207654_100262685 158
302 3300025916 Ga0207663_10077730 Ga0207663_100777302 158
303 3300025916 Ga0207663_10336772 Ga0207663_103367721 158
304 3300025918 Ga0207662_10022592 Ga0207662_100225923 158
305 3300025920 Ga0207649_10387230 Ga0207649_103872302 158
306 3300025923 Ga0207681_10050494 Ga0207681_100504943 158
307 3300025927 Ga0207687_10606049 Ga0207687_106060492 158
308 3300025932 Ga0207690_10548379 Ga0207690_105483791 158
309 3300025933 Ga0207706_10007634 Ga0207706_100076345 158
310 3300025933 Ga0207706_10366405 Ga0207706_103664052 158
311 3300025936 Ga0207670_10008502 Ga0207670_100085024 158
312 3300025937 Ga0207669_10082019 Ga0207669_100820192 158
313 3300025938 Ga0207704_10231508 Ga0207704_102315082 158
314 3300025939 Ga0207665_10021533 Ga0207665_100215336 158
315 3300025941 Ga0207711_11205310 Ga0207711_112053101 158
316 3300025945 Ga0207679_10035088 Ga0207679_100350883 158
317 3300025960 Ga0207651_10002325 Ga0207651_100023253 158
318 3300025961 Ga0207712_10086454 Ga0207712_100864543 158
319 3300025986 Ga0207658_10273298 Ga0207658_102732982 158
320 3300026023 Ga0207677_10217374 Ga0207677_102173742 158
321 3300026035 Ga0207703_10331404 Ga0207703_103314042 158
322 3300026067 Ga0207678_10103952 Ga0207678_101039523 158
323 3300026075 Ga0207708_10505914 Ga0207708_105059141 158
324 3300026088 Ga0207641_10010449 Ga0207641_100104494 158
325 3300026088 Ga0207641_10315870 Ga0207641_103158702 158
326 3300026089 Ga0207648_10302357 Ga0207648_103023572 158
327 3300026118 Ga0207675_100002618 Ga0207675_1000026188 158
328 3300026121 Ga0207683_10416870 Ga0207683_104168701 158
329 3300027526 Ga0209968_1036958 Ga0209968_10369582 158
330 3300027695 Ga0209966_1057332 Ga0209966_10573322 158
331 3300027876 Ga0209974_10035920 Ga0209974_100359202 158
332 3300027907 Ga0207428_10001523 Ga0207428_100015239 158
333 3300028379 Ga0268266_10064322 Ga0268266_100643223 158
334 3300028380 Ga0268265_10129627 Ga0268265_101296273 158
335 3300028381 Ga0268264_10144295 Ga0268264_101442951 158
336 3300031090 Ga0265760_10155263 Ga0265760_101552631 158
337 3300035092 Ga0373952_0009364 Ga0373952_0009364_1364_1852 158
338 3300035112 Ga0373932_0057885 Ga0373932_0057885_518_1006 158
339 3300035115 Ga0373941_0006530 Ga0373941_0006530_394_882 158
340 3300035207 Ga0373942_0177858 Ga0373942_0177858_166_654 158
341 3300035241 Ga0373961_0029212 Ga0373961_0029212_40_528 158
342 3300045051 Ga0451576_0353940 Ga0451576_0353940_617_1138 158
343 3300047320 Ga0495672_0096546 Ga0495672_0096546_778_1260 158
344 3300048903 Ga0496100_0129127 Ga0496100_0129127_774_1259 158
345 3300048905 Ga0496102_0010730 Ga0496102_0010730_236_721 158
346 3300048907 Ga0496104_0014278 Ga0496104_0014278_1962_2447 158
347 3300048909 Ga0496106_0001891 Ga0496106_0001891_13567_14052 158
348 3300048910 Ga0496107_0072019 Ga0496107_0072019_16_501 158
349 3300048912 Ga0496109_0361046 Ga0496109_0361046_687_1175 158
350 3300050507 nmdc:mga05p37_385474_c1 nmdc:mga05p37_385474_c1_608_1096 158
351 3300050508 nmdc:mga09592_1234438_c1 nmdc:mga09592_1234438_c1_87_575 158
352 3300050512 nmdc:mga0n895_50513_c1 nmdc:mga0n895_50513_c1_2218_2706 158
353 3300050513 nmdc:mga0rr50_107603_c1 nmdc:mga0rr50_107603_c1_1459_1947 158
354 3300003203 JGI25406J46586_10001634 JGI25406J46586_100016346 159
355 3300005293 Ga0065715_10096259 Ga0065715_100962596 159
356 3300005293 Ga0065715_10671499 Ga0065715_106714991 159
357 3300005328 Ga0070676_10247308 Ga0070676_102473082 159
358 3300005328 Ga0070676_10378269 Ga0070676_103782692 159
359 3300005330 Ga0070690_100394191 Ga0070690_1003941912 159
360 3300005331 Ga0070670_100163684 Ga0070670_1001636844 159
361 3300005334 Ga0068869_100116685 Ga0068869_1001166852 159
362 3300005335 Ga0070666_10656610 Ga0070666_106566101 159
363 3300005353 Ga0070669_100269660 Ga0070669_1002696601 159
364 3300005354 Ga0070675_100025190 Ga0070675_1000251902 159
365 3300005354 Ga0070675_100710806 Ga0070675_1007108061 159
366 3300005354 Ga0070675_100765174 Ga0070675_1007651741 159
367 3300005355 Ga0070671_100091418 Ga0070671_1000914182 159
368 3300005356 Ga0070674_100000181 Ga0070674_1000001812 159
369 3300005356 Ga0070674_100087849 Ga0070674_1000878492 159
370 3300005364 Ga0070673_100070751 Ga0070673_1000707513 159
371 3300005364 Ga0070673_100279196 Ga0070673_1002791961 159
372 3300005365 Ga0070688_100670002 Ga0070688_1006700021 159
373 3300005367 Ga0070667_100299500 Ga0070667_1002995001 159
374 3300005438 Ga0070701_10600167 Ga0070701_106001671 159
375 3300005456 Ga0070678_100070812 Ga0070678_1000708122 159
376 3300005456 Ga0070678_100148821 Ga0070678_1001488211 159
377 3300005456 Ga0070678_100329779 Ga0070678_1003297792 159
378 3300005457 Ga0070662_100476663 Ga0070662_1004766631 159
379 3300005459 Ga0068867_100759465 Ga0068867_1007594651 159
380 3300005471 Ga0070698_100900992 Ga0070698_1009009921 159
381 3300005518 Ga0070699_100022221 Ga0070699_1000222212 159
382 3300005543 Ga0070672_100212205 Ga0070672_1002122053 159
383 3300005543 Ga0070672_100219929 Ga0070672_1002199292 159
384 3300005544 Ga0070686_100058941 Ga0070686_1000589412 159
385 3300005577 Ga0068857_100291053 Ga0068857_1002910532 159
386 3300005718 Ga0068866_10473137 Ga0068866_104731371 159
387 3300005840 Ga0068870_10114441 Ga0068870_101144412 159
388 3300005844 Ga0068862_100062317 Ga0068862_1000623173 159
389 3300005985 Ga0081539_10000108 Ga0081539_1000010861 159
390 3300005985 Ga0081539_10005820 Ga0081539_100058208 159
391 3300006237 Ga0097621_100003028 Ga0097621_1000030288 159
392 3300006237 Ga0097621_100654387 Ga0097621_1006543871 159
393 3300006844 Ga0075428_100007062 Ga0075428_10000706210 159
394 3300006844 Ga0075428_100382042 Ga0075428_1003820422 159
395 3300006844 Ga0075428_100541265 Ga0075428_1005412651 159
396 3300006846 Ga0075430_100008204 Ga0075430_1000082047 159
397 3300006846 Ga0075430_100130670 Ga0075430_1001306704 159
398 3300006847 Ga0075431_100019478 Ga0075431_1000194786 159
399 3300006847 Ga0075431_100210768 Ga0075431_1002107681 159
400 3300006880 Ga0075429_100003402 Ga0075429_10000340211 159
401 3300006931 Ga0097620_100294376 Ga0097620_1002943762 159
402 3300009094 Ga0111539_10093870 Ga0111539_100938705 159
403 3300009147 Ga0114129_10094978 Ga0114129_100949782 159
404 3300010159 Ga0099796_10242280 Ga0099796_102422802 159
405 3300013308 Ga0157375_10086125 Ga0157375_100861251 159
406 3300013308 Ga0157375_10174205 Ga0157375_101742052 159
407 3300014325 Ga0163163_10232787 Ga0163163_102327873 159
408 3300014326 Ga0157380_10496797 Ga0157380_104967972 159
409 3300014326 Ga0157380_12287905 Ga0157380_122879051 159
410 3300014745 Ga0157377_10091405 Ga0157377_100914051 159
411 3300014969 Ga0157376_10070296 Ga0157376_100702962 159
412 3300025893 Ga0207682_10012317 Ga0207682_100123172 159
413 3300025901 Ga0207688_10095426 Ga0207688_100954262 159
414 3300025901 Ga0207688_10197943 Ga0207688_101979431 159
415 3300025907 Ga0207645_10041259 Ga0207645_100412593 159
416 3300025907 Ga0207645_10187802 Ga0207645_101878022 159
417 3300025908 Ga0207643_10130555 Ga0207643_101305551 159
418 3300025923 Ga0207681_10096939 Ga0207681_100969392 159
419 3300025925 Ga0207650_10036319 Ga0207650_100363195 159
420 3300025926 Ga0207659_10488698 Ga0207659_104886981 159
421 3300025926 Ga0207659_10744890 Ga0207659_107448902 159
422 3300025935 Ga0207709_10766848 Ga0207709_107668481 159
423 3300025937 Ga0207669_10200359 Ga0207669_102003592 159
424 3300025937 Ga0207669_10760912 Ga0207669_107609121 159
425 3300025937 Ga0207669_10847613 Ga0207669_108476131 159
426 3300025938 Ga0207704_10145492 Ga0207704_101454922 159
427 3300025938 Ga0207704_10726555 Ga0207704_107265551 159
428 3300025940 Ga0207691_10040746 Ga0207691_100407461 159
429 3300025940 Ga0207691_10613653 Ga0207691_106136531 159
430 3300025942 Ga0207689_10019405 Ga0207689_100194054 159
431 3300025960 Ga0207651_10147148 Ga0207651_101471482 159
432 3300025960 Ga0207651_10176531 Ga0207651_101765311 159
433 3300026023 Ga0207677_10651843 Ga0207677_106518432 159
434 3300026075 Ga0207708_10040186 Ga0207708_100401864 159
435 3300026116 Ga0207674_10487540 Ga0207674_104875402 159
436 3300026118 Ga0207675_100280346 Ga0207675_1002803463 159
437 3300026121 Ga0207683_10076922 Ga0207683_100769225 159
438 3300026121 Ga0207683_10182366 Ga0207683_101823662 159
439 3300026121 Ga0207683_10546116 Ga0207683_105461161 159
440 3300027907 Ga0207428_10254312 Ga0207428_102543122 159
441 3300028380 Ga0268265_10361309 Ga0268265_103613092 159
442 3300032005 Ga0307411_11010606 Ga0307411_110106062 159
443 3300035691 Ga0373931_0538765 Ga0373931_0538765_193_687 159
444 3300039447 Ga0436361_0014451 Ga0436361_0014451_445_933 159
445 3300039447 Ga0436361_0556487 Ga0436361_0556487_265_753 159
446 3300039447 Ga0436361_0609563 Ga0436361_0609563_63_551 159
447 3300042437 Ga0439444_0098830 Ga0439444_0098830_143_634 159
448 3300045051 Ga0451576_1561849 Ga0451576_1561849_165_644 159
449 3300046472 Ga0495580_0082038 Ga0495580_0082038_1269_1841 159
450 3300048907 Ga0496104_0332476 Ga0496104_0332476_759_1247 159
451 3300049576 Ga0501040_1209444 Ga0501040_1209444_23_514 159
452 3300049578 Ga0501042_0460064 Ga0501042_0460064_119_610 159
453 3300050507 nmdc:mga05p37_83989_c1 nmdc:mga05p37_83989_c1_738_1229 159
454 3300050508 nmdc:mga09592_5178_c1 nmdc:mga09592_5178_c1_1523_2014 159
455 3300050509 nmdc:mga0qj67_194209_c1 nmdc:mga0qj67_194209_c1_413_904 159
456 3300050509 nmdc:mga0qj67_4569_c1 nmdc:mga0qj67_4569_c1_2262_2753 159
457 3300050510 nmdc:mga06r32_214404_c1 nmdc:mga06r32_214404_c1_1327_1818 159
458 3300050510 nmdc:mga06r32_237881_c1 nmdc:mga06r32_237881_c1_253_744 159
459 3300050511 nmdc:mga08y16_1062236_c1 nmdc:mga08y16_1062236_c1_275_754 159
460 3300050511 nmdc:mga08y16_678487_c1 nmdc:mga08y16_678487_c1_508_999 159
461 3300050515 nmdc:mga0a205_694111_c1 nmdc:mga0a205_694111_c1_221_700 159
462 3300061734 Ga0530510_1117388 Ga0530510_1117388_73_564 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03928

HbpS-like

Haem degrading protein HbpS-like

31

154

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oj5-assembly1.cif.gz_A crystal structure of the nco-a1 pas-b domain bound to the stat6 transactivation domain lxxll motif 0.8565 54 70
6bws-assembly1.cif.gz_B-2 crystal structure of efga from methylobacterium extorquens 0.8178 29 158
3fpv-assembly1.cif.gz_C crystal structure of hbps 0.8101 25 159
6nob-assembly1.cif.gz_A structure of glycoside hydrolase family 32 from bifidobacterium adolescentis 0.807 53 71
2a2l-assembly1.cif.gz_A crystal structure of klebsiella pneumoniae protein orfy, pfam duf336 0.801 28 158
ID Description Score Start End Superfamily
af_I1MRB2_6_205_3.30.70.890 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;GHMP kinase, C-terminal domain 0.8296 53 71 3.30.70.890
3fpvA01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.825 32 159 3.30.450.150
6c0zB00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.8171 29 158 3.30.450.150
af_P0AEQ1_1_133_3.30.450.150 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.8132 25 159 3.30.450.150
3fpvA01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.8129 32 159 3.30.450.150
ID Description Score Start End GO Terms
AF-A0A6N7GX27-F1-model_v4 Heme-binding protein 0.8522 24 158
AF-A0A536ZDL2-F1-model_v4 Heme-binding protein 0.8517 25 159
AF-A0A4V3UFN3-F1-model_v4 deleted 0.8507 25 159
AF-A0A536U1Z4-F1-model_v4 Heme-binding protein 0.8496 25 159
AF-A0A2E5V9S6-F1-model_v4 Heme-binding protein 0.8469 17 159

Feature Viewer

pLDDT pTM Quality
84.84 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map