F448800

General Info

Members Datasets Scaffolds Average Seq Length
461 262 460 141

Family's Representative Sequence

Representative Sequence 3300046664|Ga0495659_0312875|Ga0495659_0312875_107_517
Length 131
Sequence MPQEMIFAPMGAMALLTFAVLLLIPLRRFRAGFAGEVVTDDFKFGESQRVPGHVAIPNRNYMNLLELPMLFYVAGLMRVDAAALAVAWTYVGLRAVHSAIHVSYNNVIHRLSVFALSNVVLGVFWVLFFVR

Samples

Sample ID Description Type Environment
1 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
90 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
91 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
162 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
163 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
170 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
171 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
172 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
173 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
174 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
175 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
178 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
190 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
209 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
210 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
216 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
220 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
228 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
239 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
240 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
259 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.22
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 2.6
Rhizosphere 94.79
Stem 0
Stem Tuber 0
Unclassified 2.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARSoilOldRDRAFT_c025710 3300000044 Bacteria 533
2 JGI24750J21931_1081071 3300002070 Bacteria 540
3 rootH2_10002821 3300003320 Bacteria 3509
4 Ga0065704_10482563 3300005289 Bacteria 680
5 Ga0065707_10213354 3300005295 Bacteria 1256
6 Ga0070658_10587878 3300005327 Bacteria 964
7 Ga0070676_10007826 3300005328 Bacteria 5745
8 Ga0070676_10008083 3300005328 Bacteria 5655
9 Ga0070676_10107713 3300005328 Bacteria 1731
10 Ga0070683_100365192 3300005329 Bacteria 1375
11 Ga0070683_100501443 3300005329 Bacteria 1160
12 Ga0070683_100768805 3300005329 Bacteria 923
13 Ga0070690_100000235 3300005330 Bacteria 28411
14 Ga0070690_100005283 3300005330 Bacteria 7241
15 Ga0070690_100385314 3300005330 Bacteria 1026
16 Ga0070670_100095041 3300005331 Bacteria 2563
17 Ga0070670_100130180 3300005331 Bacteria 2173
18 Ga0070670_100169296 3300005331 Bacteria 1895
19 Ga0070677_10051074 3300005333 Bacteria 1672
20 Ga0068869_100000023 3300005334 Bacteria 64701
21 Ga0068869_100034054 3300005334 Bacteria 3601
22 Ga0070666_10000930 3300005335 Bacteria 17786
23 Ga0070666_10261480 3300005335 Bacteria 1227
24 Ga0070666_10568266 3300005335 Bacteria 826
25 Ga0070680_100003526 3300005336 Bacteria 11681
26 Ga0070680_100063220 3300005336 Bacteria 3031
27 Ga0070682_100004674 3300005337 Bacteria 7606
28 Ga0068868_100000293 3300005338 Bacteria 33613
29 Ga0068868_100001477 3300005338 Bacteria 16207
30 Ga0068868_100050944 3300005338 Bacteria 3254
31 Ga0068868_100905958 3300005338 Bacteria 802
32 Ga0070689_100000974 3300005340 Bacteria 17888
33 Ga0070689_100540370 3300005340 Bacteria 1003
34 Ga0070689_101279859 3300005340 Bacteria 660
35 Ga0070691_10002924 3300005341 Bacteria 7661
36 Ga0070691_10006942 3300005341 Bacteria 5183
37 Ga0070687_100000142 3300005343 Bacteria 24995
38 Ga0070661_100097461 3300005344 Bacteria 2183
39 Ga0070661_100177837 3300005344 Bacteria 1618
40 Ga0070692_10007542 3300005345 Bacteria 4797
41 Ga0070692_10249482 3300005345 Bacteria 1062
42 Ga0070669_100406575 3300005353 Bacteria 1115
43 Ga0070675_100002416 3300005354 Bacteria 13927
44 Ga0070675_100107985 3300005354 Bacteria 2350
45 Ga0070671_100030696 3300005355 Bacteria 4436
46 Ga0070671_100151193 3300005355 Bacteria 1960
47 Ga0070671_100187456 3300005355 Bacteria 1753
48 Ga0070671_100191990 3300005355 Bacteria 1731
49 Ga0070671_100344845 3300005355 Bacteria 1271
50 Ga0070674_100095967 3300005356 Bacteria 2150
51 Ga0070673_100002692 3300005364 Bacteria 10883
52 Ga0070673_100217246 3300005364 Bacteria 1653
53 Ga0070673_101029226 3300005364 Bacteria 767
54 Ga0070667_100002444 3300005367 Bacteria 16235
55 Ga0070667_100740542 3300005367 Bacteria 911
56 Ga0070703_10116568 3300005406 Bacteria 963
57 Ga0070714_100224699 3300005435 Bacteria 1727
58 Ga0070701_10000090 3300005438 Bacteria 25259
59 Ga0070705_100000668 3300005440 Bacteria 19620
60 Ga0070700_100001456 3300005441 Bacteria 11776
61 Ga0070700_100299496 3300005441 Bacteria 1173
62 Ga0070694_100000160 3300005444 Bacteria 34651
63 Ga0070694_101566392 3300005444 Bacteria 559
64 Ga0070708_100518774 3300005445 Bacteria 1124
65 Ga0070663_100059649 3300005455 Bacteria 2742
66 Ga0070678_100055885 3300005456 Bacteria 2884
67 Ga0070678_100118160 3300005456 Bacteria 2086
68 Ga0070678_100876875 3300005456 Bacteria 819
69 Ga0070681_10077685 3300005458 Bacteria 3277
70 Ga0070681_10190266 3300005458 Bacteria 1972
71 Ga0068867_100001762 3300005459 Bacteria 15048
72 Ga0068867_100027232 3300005459 Bacteria 4107
73 Ga0068867_100044455 3300005459 Bacteria 3254
74 Ga0068867_100292576 3300005459 Bacteria 1339
75 Ga0070685_10968188 3300005466 Bacteria 637
76 Ga0070679_100003462 3300005530 Bacteria 14454
77 Ga0070679_100811505 3300005530 Bacteria 879
78 Ga0068853_100001493 3300005539 Bacteria 16998
79 Ga0068853_100062341 3300005539 Bacteria 3226
80 Ga0068853_100241698 3300005539 Bacteria 1655
81 Ga0068853_100271850 3300005539 Bacteria 1561
82 Ga0068853_100564445 3300005539 Bacteria 1079
83 Ga0068853_101072331 3300005539 Bacteria 777
84 Ga0070672_100037129 3300005543 Bacteria 3715
85 Ga0070672_100082250 3300005543 Bacteria 2583
86 Ga0070686_100000090 3300005544 Bacteria 63246
87 Ga0070695_100000130 3300005545 Bacteria 34256
88 Ga0070696_100000397 3300005546 Bacteria 26933
89 Ga0070693_100000496 3300005547 Bacteria 17573
90 Ga0070665_100352405 3300005548 Bacteria 1477
91 Ga0070704_100000637 3300005549 Bacteria 16929
92 Ga0068855_100006339 3300005563 Bacteria 14415
93 Ga0068855_100114613 3300005563 Bacteria 3090
94 Ga0070664_100233240 3300005564 Bacteria 1650
95 Ga0070664_100539963 3300005564 Bacteria 1077
96 Ga0068854_100001716 3300005578 Bacteria 13354
97 Ga0068854_100063174 3300005578 Bacteria 2687
98 Ga0068854_101046860 3300005578 Bacteria 725
99 Ga0068856_100017993 3300005614 Bacteria 6851
100 Ga0068856_100335567 3300005614 Bacteria 1530
101 Ga0070702_100000356 3300005615 Bacteria 15961
102 Ga0070702_100962658 3300005615 Bacteria 673
103 Ga0068852_100025914 3300005616 Bacteria 4759
104 Ga0068852_100114034 3300005616 Bacteria 2462
105 Ga0068852_100147342 3300005616 Bacteria 2185
106 Ga0068852_100182774 3300005616 Bacteria 1973
107 Ga0068852_102239562 3300005616 Bacteria 568
108 Ga0068859_100001418 3300005617 Bacteria 24320
109 Ga0068859_100001613 3300005617 Bacteria 23052
110 Ga0068859_100147848 3300005617 Bacteria 2425
111 Ga0068864_100001828 3300005618 Bacteria 17480
112 Ga0068864_100031456 3300005618 Bacteria 4503
113 Ga0068864_100738799 3300005618 Bacteria 964
114 Ga0068864_101979271 3300005618 Bacteria 589
115 Ga0068866_10000337 3300005718 Bacteria 22136
116 Ga0068861_100000043 3300005719 Bacteria 57807
117 Ga0068861_100164781 3300005719 Bacteria 1832
118 Ga0068851_10095088 3300005834 Unclassified 1574
119 Ga0068851_10609740 3300005834 Bacteria 665
120 Ga0068863_100083293 3300005841 Bacteria 3031
121 Ga0068863_100560588 3300005841 Bacteria 1129
122 Ga0068863_100862651 3300005841 Bacteria 905
123 Ga0068858_100001347 3300005842 Bacteria 25330
124 Ga0068858_100002717 3300005842 Bacteria 17826
125 Ga0068858_100053514 3300005842 Bacteria 3734
126 Ga0068860_100007750 3300005843 Bacteria 10727
127 Ga0068862_100000320 3300005844 Bacteria 52171
128 Ga0097621_100000206 3300006237 Bacteria 38579
129 Ga0097621_100796173 3300006237 Bacteria 876
130 Ga0097621_101231058 3300006237 Bacteria 706
131 Ga0068871_100000040 3300006358 Bacteria 69044
132 Ga0068871_100009531 3300006358 Bacteria 7044
133 Ga0068871_100449264 3300006358 Bacteria 1155
134 Ga0075428_100000107 3300006844 Bacteria 70381
135 Ga0075430_100114872 3300006846 Bacteria 2243
136 Ga0075430_100206335 3300006846 Bacteria 1631
137 Ga0075430_100850528 3300006846 Bacteria 752
138 Ga0075433_10021071 3300006852 Bacteria 5461
139 Ga0075433_10163236 3300006852 Bacteria 1983
140 Ga0075434_100000151 3300006871 Bacteria 42872
141 Ga0075429_100004376 3300006880 Bacteria 12122
142 Ga0068865_100000245 3300006881 Bacteria 30264
143 Ga0068865_101074983 3300006881 Bacteria 708
144 Ga0075436_100001172 3300006914 Bacteria 17766
145 Ga0097620_100001418 3300006931 Bacteria 24320
146 Ga0097620_100001613 3300006931 Bacteria 23052
147 Ga0097620_100147856 3300006931 Bacteria 2425
148 Ga0075435_100000699 3300007076 Bacteria 20808
149 Ga0105240_10000641 3300009093 Bacteria 64500
150 Ga0105240_10081004 3300009093 Bacteria 3991
151 Ga0105240_10321231 3300009093 Bacteria 1764
152 Ga0105240_10553128 3300009093 Bacteria 1273
153 Ga0105240_11081330 3300009093 Bacteria 854
154 Ga0111539_10006727 3300009094 Bacteria 14790
155 Ga0111539_10050841 3300009094 Bacteria 4938
156 Ga0105245_10000224 3300009098 Bacteria 53847
157 Ga0105247_10034226 3300009101 Bacteria 3094
158 Ga0114129_10000040 3300009147 Bacteria 107971
159 Ga0105243_10000035 3300009148 Bacteria 177598
160 Ga0105241_10244576 3300009174 Bacteria 1518
161 Ga0105241_10797054 3300009174 Bacteria 870
162 Ga0105242_10000300 3300009176 Bacteria 39346
163 Ga0105242_11095717 3300009176 Bacteria 810
164 Ga0105248_10000001 3300009177 Bacteria 1881304
165 Ga0105248_10005486 3300009177 Bacteria 13930
166 Ga0105248_10117410 3300009177 Bacteria 3000
167 Ga0105237_11276586 3300009545 Unclassified 741
168 Ga0105238_10006158 3300009551 Bacteria 11907
169 Ga0105238_10964673 3300009551 Bacteria 873
170 Ga0105249_10052250 3300009553 Bacteria 3731
171 Ga0105239_10007283 3300010375 Bacteria 12705
172 Ga0105239_10007308 3300010375 Bacteria 12683
173 Ga0105239_10105509 3300010375 Bacteria 3121
174 Ga0105239_10404885 3300010375 Bacteria 1544
175 Ga0105239_11470581 3300010375 Bacteria 787
176 Ga0105246_10384559 3300011119 Bacteria 1161
177 Ga0157341_1016265 3300012494 Bacteria 691
178 Ga0157339_1009062 3300012505 Bacteria 872
179 Ga0157315_1002588 3300012508 Bacteria 1145
180 Ga0157369_10047070 3300013105 Bacteria 4685
181 Ga0157369_11471221 3300013105 Bacteria 693
182 Ga0157374_10033778 3300013296 Bacteria 4669
183 Ga0157374_12912669 3300013296 Bacteria 506
184 Ga0157378_10002478 3300013297 Bacteria 16430
185 Ga0157378_10049281 3300013297 Bacteria 3747
186 Ga0157378_10776122 3300013297 Bacteria 983
187 Ga0163162_10017053 3300013306 Bacteria 7106
188 Ga0163162_10053252 3300013306 Bacteria 4067
189 Ga0163162_10236526 3300013306 Bacteria 1957
190 Ga0157372_10373369 3300013307 Bacteria 1662
191 Ga0157372_10769612 3300013307 Bacteria 1119
192 Ga0157372_10842233 3300013307 Bacteria 1065
193 Ga0157375_10004033 3300013308 Bacteria 12738
194 Ga0157375_12356961 3300013308 Bacteria 635
195 Ga0163163_10003621 3300014325 Bacteria 13134
196 Ga0163163_11243826 3300014325 Bacteria 807
197 Ga0157380_10020779 3300014326 Bacteria 4913
198 Ga0157380_10053091 3300014326 Bacteria 3212
199 Ga0157380_10414827 3300014326 Bacteria 1282
200 Ga0182008_10655584 3300014497 Unclassified 595
201 Ga0157377_10141533 3300014745 Bacteria 1479
202 Ga0157379_10006033 3300014968 Bacteria 10437
203 Ga0157379_10783374 3300014968 Bacteria 899
204 Ga0157376_10020252 3300014969 Bacteria 5142
205 Ga0157376_10077783 3300014969 Bacteria 2838
206 Ga0157376_10582708 3300014969 Bacteria 1111
207 Ga0213876_10000474 3300021384 Bacteria 32008
208 Ga0207656_10356152 3300025321 Bacteria 731
209 Ga0207653_10014105 3300025885 Bacteria 2505
210 Ga0207642_10002929 3300025899 Bacteria 5340
211 Ga0207710_10178060 3300025900 Bacteria 1042
212 Ga0207680_10001996 3300025903 Bacteria 9560
213 Ga0207680_10134129 3300025903 Bacteria 1635
214 Ga0207680_10237902 3300025903 Bacteria 1254
215 Ga0207680_10723956 3300025903 Bacteria 713
216 Ga0207647_10241468 3300025904 Bacteria 1037
217 Ga0207645_10005271 3300025907 Bacteria 9415
218 Ga0207645_10008824 3300025907 Bacteria 7006
219 Ga0207645_10014239 3300025907 Bacteria 5327
220 Ga0207705_10960583 3300025909 Bacteria 661
221 Ga0207654_10047104 3300025911 Bacteria 2462
222 Ga0207707_10016260 3300025912 Bacteria 6490
223 Ga0207707_10247631 3300025912 Bacteria 1548
224 Ga0207695_10000018 3300025913 Bacteria 766611
225 Ga0207695_10001727 3300025913 Bacteria 34901
226 Ga0207695_10015061 3300025913 Bacteria 9122
227 Ga0207695_10655669 3300025913 Bacteria 930
228 Ga0207660_10010313 3300025917 Bacteria 6060
229 Ga0207660_10129788 3300025917 Bacteria 1917
230 Ga0207662_10000091 3300025918 Bacteria 42710
231 Ga0207649_10021569 3300025920 Bacteria 3710
232 Ga0207652_10024709 3300025921 Bacteria 4987
233 Ga0207652_10708276 3300025921 Bacteria 898
234 Ga0207681_10188772 3300025923 Bacteria 1575
235 Ga0207681_10407514 3300025923 Bacteria 1099
236 Ga0207694_10000018 3300025924 Bacteria 331281
237 Ga0207694_10159951 3300025924 Bacteria 1818
238 Ga0207650_10103122 3300025925 Bacteria 2199
239 Ga0207650_10355288 3300025925 Bacteria 1206
240 Ga0207659_10001313 3300025926 Bacteria 14851
241 Ga0207659_10325853 3300025926 Bacteria 1268
242 Ga0207659_10806051 3300025926 Bacteria 807
243 Ga0207687_10005537 3300025927 Bacteria 8350
244 Ga0207687_11126899 3300025927 Bacteria 674
245 Ga0207664_10198246 3300025929 Bacteria 1732
246 Ga0207644_10003952 3300025931 Bacteria 9617
247 Ga0207644_10041295 3300025931 Bacteria 3263
248 Ga0207644_10059420 3300025931 Bacteria 2765
249 Ga0207644_10066495 3300025931 Bacteria 2625
250 Ga0207644_10154315 3300025931 Bacteria 1779
251 Ga0207644_10267679 3300025931 Bacteria 1368
252 Ga0207686_10000914 3300025934 Bacteria 17687
253 Ga0207709_10001149 3300025935 Bacteria 19293
254 Ga0207670_10005058 3300025936 Bacteria 7191
255 Ga0207670_10023063 3300025936 Bacteria 3867
256 Ga0207670_10294335 3300025936 Bacteria 1269
257 Ga0207670_11140921 3300025936 Bacteria 659
258 Ga0207669_10047773 3300025937 Bacteria 2538
259 Ga0207669_10405234 3300025937 Bacteria 1069
260 Ga0207704_10001399 3300025938 Bacteria 10777
261 Ga0207691_10182762 3300025940 Bacteria 1832
262 Ga0207691_10336992 3300025940 Bacteria 1291
263 Ga0207711_10000002 3300025941 Bacteria 1228676
264 Ga0207711_10019340 3300025941 Bacteria 5671
265 Ga0207689_10000024 3300025942 Bacteria 107574
266 Ga0207689_10045519 3300025942 Bacteria 3628
267 Ga0207661_10267836 3300025944 Bacteria 1524
268 Ga0207661_10581470 3300025944 Bacteria 1027
269 Ga0207679_10363974 3300025945 Bacteria 1264
270 Ga0207667_10000052 3300025949 Bacteria 232415
271 Ga0207667_10040129 3300025949 Bacteria 4984
272 Ga0207667_10180291 3300025949 Bacteria 2169
273 Ga0207651_10002814 3300025960 Bacteria 8370
274 Ga0207651_10232634 3300025960 Bacteria 1497
275 Ga0207651_10427036 3300025960 Bacteria 1132
276 Ga0207712_10020378 3300025961 Bacteria 4342
277 Ga0207640_10001826 3300025981 Bacteria 11420
278 Ga0207640_10055904 3300025981 Bacteria 2588
279 Ga0207658_10007627 3300025986 Bacteria 7369
280 Ga0207658_11464954 3300025986 Bacteria 624
281 Ga0207677_10000435 3300026023 Bacteria 28214
282 Ga0207677_10000836 3300026023 Bacteria 17591
283 Ga0207677_10327402 3300026023 Bacteria 1276
284 Ga0207703_10000361 3300026035 Bacteria 48627
285 Ga0207703_10001473 3300026035 Bacteria 21462
286 Ga0207703_10160103 3300026035 Bacteria 1971
287 Ga0207639_10001596 3300026041 Bacteria 15237
288 Ga0207639_10034071 3300026041 Bacteria 3761
289 Ga0207639_10393343 3300026041 Bacteria 1247
290 Ga0207639_10511775 3300026041 Bacteria 1098
291 Ga0207639_10711809 3300026041 Bacteria 932
292 Ga0207678_10055545 3300026067 Bacteria 3411
293 Ga0207678_10302399 3300026067 Bacteria 1375
294 Ga0207678_11355815 3300026067 Bacteria 629
295 Ga0207708_10001349 3300026075 Bacteria 18419
296 Ga0207708_10190541 3300026075 Bacteria 1632
297 Ga0207702_10163189 3300026078 Bacteria 2036
298 Ga0207702_11854714 3300026078 Bacteria 594
299 Ga0207641_10018243 3300026088 Bacteria 5752
300 Ga0207641_10432479 3300026088 Bacteria 1269
301 Ga0207641_11140801 3300026088 Bacteria 778
302 Ga0207648_10000316 3300026089 Bacteria 52941
303 Ga0207648_10037742 3300026089 Bacteria 4254
304 Ga0207648_10052124 3300026089 Bacteria 3577
305 Ga0207648_10061935 3300026089 Bacteria 3262
306 Ga0207676_10001719 3300026095 Bacteria 16125
307 Ga0207676_10032335 3300026095 Bacteria 3942
308 Ga0207676_10374824 3300026095 Bacteria 1323
309 Ga0207674_11520913 3300026116 Bacteria 638
310 Ga0207675_100000017 3300026118 Bacteria 124338
311 Ga0207675_100211910 3300026118 Bacteria 1864
312 Ga0207675_100484589 3300026118 Bacteria 1229
313 Ga0207683_10001709 3300026121 Bacteria 19640
314 Ga0207683_10012223 3300026121 Bacteria 7328
315 Ga0207683_10668334 3300026121 Bacteria 963
316 Ga0207698_10082357 3300026142 Bacteria 2601
317 Ga0207698_10110618 3300026142 Bacteria 2302
318 Ga0207698_10135978 3300026142 Bacteria 2109
319 Ga0207698_10159705 3300026142 Bacteria 1969
320 Ga0207698_10475931 3300026142 Bacteria 1210
321 Ga0207428_10000179 3300027907 Bacteria 88854
322 Ga0207428_10118316 3300027907 Bacteria 2033
323 Ga0268266_10071153 3300028379 Bacteria 3015
324 Ga0268265_10003537 3300028380 Bacteria 11176
325 Ga0268264_10001250 3300028381 Bacteria 24232
326 Ga0268264_10411075 3300028381 Bacteria 1303
327 Ga0265338_10000005 3300028800 Bacteria 571137
328 Ga0265760_10004606 3300031090 Unclassified 3951
329 Ga0265325_10000010 3300031241 Bacteria 172391
330 Ga0265329_10166292 3300031242 Bacteria 718
331 Ga0265339_10001218 3300031249 Bacteria 19363
332 Ga0265313_10021854 3300031595 Bacteria 3488
333 Ga0265314_10071831 3300031711 Bacteria 2314
334 Ga0265314_10162312 3300031711 Bacteria 1358
335 Ga0307516_10187379 3300031730 Bacteria 1798
336 Ga0307410_11327494 3300031852 Bacteria 630
337 Ga0307416_101909729 3300032002 Bacteria 697
338 Ga0373930_0022750 3300034816 Bacteria 1242
339 Ga0373948_0043216 3300034817 Bacteria 949
340 Ga0373958_0053786 3300034819 Bacteria 856
341 Ga0373926_0008569 3300035083 Bacteria 3404
342 Ga0373926_0152550 3300035083 Bacteria 880
343 Ga0373928_0002250 3300035084 Bacteria 3761
344 Ga0373928_0012413 3300035084 Bacteria 1699
345 Ga0373928_0028517 3300035084 Bacteria 1222
346 Ga0373929_0063790 3300035085 Bacteria 868
347 Ga0373944_0030856 3300035089 Bacteria 1609
348 Ga0373944_0055288 3300035089 Bacteria 1260
349 Ga0373949_0001814 3300035090 Bacteria 5834
350 Ga0373951_0009441 3300035091 Bacteria 2196
351 Ga0373952_0115388 3300035092 Bacteria 723
352 Ga0373923_0070250 3300035111 Bacteria 1503
353 Ga0373932_0013816 3300035112 Bacteria 2017
354 Ga0373932_0159589 3300035112 Bacteria 779
355 Ga0373932_0196933 3300035112 Bacteria 714
356 Ga0373936_0000998 3300035113 Bacteria 10090
357 Ga0373936_0001736 3300035113 Bacteria 8000
358 Ga0373939_0005502 3300035114 Bacteria 3020
359 Ga0373939_0047765 3300035114 Bacteria 1316
360 Ga0373945_0004584 3300035116 Bacteria 4394
361 Ga0373960_0020325 3300035121 Bacteria 1754
362 Ga0373960_0138891 3300035121 Bacteria 821
363 Ga0373943_0019737 3300035170 Bacteria 3102
364 Ga0373946_0006941 3300035171 Bacteria 4124
365 Ga0373942_0009860 3300035207 Bacteria 2237
366 Ga0373942_0070755 3300035207 Bacteria 1018
367 Ga0373961_0029131 3300035241 Bacteria 1527
368 Ga0373962_0054341 3300035242 Bacteria 1161
369 Ga0373962_0282592 3300035242 Bacteria 584
370 Ga0373924_0016558 3300035410 Bacteria 2815
371 Ga0373931_0001934 3300035691 Bacteria 9078
372 Ga0373931_0022765 3300035691 Bacteria 3156
373 Ga0373931_0126666 3300035691 Bacteria 1465
374 Ga0373931_0325793 3300035691 Bacteria 955
375 Ga0373935_0028624 3300035692 Bacteria 3443
376 Ga0373935_0029511 3300035692 Bacteria 3394
377 Ga0373927_0023751 3300035695 Bacteria 4013
378 Ga0373925_0045237 3300037068 Bacteria 3269
379 Ga0395899_0834679 3300037312 Unclassified 567
380 Ga0395900_0183663 3300037418 Bacteria 2124
381 Ga0436365_1016022 3300039437 Bacteria 3902
382 Ga0436365_1849791 3300039437 Bacteria 109940
383 Ga0451577_0231965 3300042876 Bacteria 1669
384 Ga0453684_1387694 3300044712 Bacteria 729
385 Ga0451576_0000822 3300045051 Bacteria 60600
386 Ga0451576_0053628 3300045051 Bacteria 4222
387 Ga0451576_0175350 3300045051 Bacteria 2238
388 Ga0451576_0687294 3300045051 Bacteria 1075
389 Ga0495603_0011613 3300046455 Bacteria 5329
390 Ga0495629_0923170 3300046459 Bacteria 571
391 Ga0495651_0262479 3300046462 Bacteria 1175
392 Ga0495651_0715861 3300046462 Unclassified 623
393 Ga0495580_0010391 3300046472 Bacteria 7255
394 Ga0495582_0014893 3300046473 Bacteria 4273
395 Ga0495639_0037774 3300046475 Bacteria 2166
396 Ga0495664_0356341 3300046477 Bacteria 881
397 Ga0495607_0324743 3300046501 Bacteria 717
398 Ga0495644_0245160 3300046523 Bacteria 695
399 Ga0495666_0055192 3300046526 Bacteria 1904
400 Ga0495652_0376900 3300046529 Bacteria 1010
401 Ga0495665_0260677 3300046531 Bacteria 891
402 Ga0495586_0044579 3300046535 Bacteria 2389
403 Ga0495587_0137269 3300046536 Bacteria 1397
404 Ga0495587_0411412 3300046536 Bacteria 751
405 Ga0495598_0031344 3300046537 Bacteria 1495
406 Ga0495621_0522145 3300046539 Unclassified 514
407 Ga0495645_0119687 3300046543 Bacteria 1855
408 Ga0495656_0020881 3300046615 Bacteria 2544
409 Ga0495635_1009825 3300046663 Bacteria 529
410 Ga0495659_0026910 3300046664 Bacteria 1980
411 Ga0495659_0312875 3300046664 Bacteria 665
412 Ga0495588_0006502 3300046674 Bacteria 5269
413 Ga0495647_0000149 3300046681 Bacteria 17854
414 Ga0495647_0099105 3300046681 Bacteria 1205
415 Ga0495658_0004682 3300046683 Bacteria 6729
416 Ga0495669_0082403 3300046684 Bacteria 1478
417 Ga0495670_0207310 3300046691 Bacteria 1039
418 Ga0495581_0035777 3300047315 Bacteria 2873
419 Ga0495676_0045133 3300047321 Bacteria 3590
420 Ga0495677_0119472 3300047445 Bacteria 1004
421 Ga0496100_0782645 3300048903 Bacteria 747
422 Ga0496101_0407049 3300048904 Bacteria 1072
423 Ga0496105_0970483 3300048908 Bacteria 637
424 Ga0496106_0620407 3300048909 Bacteria 865
425 Ga0496107_1269794 3300048910 Bacteria 527
426 Ga0496108_0013424 3300048911 Bacteria 6682
427 Ga0496108_0049577 3300048911 Bacteria 3512
428 Ga0496109_0059814 3300048912 Bacteria 3481
429 Ga0496109_1442127 3300048912 Bacteria 624
430 Ga0496110_0172872 3300048913 Bacteria 1960
431 Ga0496110_0177112 3300048913 Bacteria 1936
432 Ga0496112_1357298 3300048915 Unclassified 626
433 Ga0496117_0145981 3300048920 Bacteria 1408
434 Ga0496118_0024776 3300048921 Bacteria 5168
435 Ga0496124_0098493 3300048927 Bacteria 2372
436 Ga0496125_0426052 3300048928 Bacteria 767
437 Ga0495682_0001571 3300049460 Bacteria 11912
438 Ga0501034_0169602 3300049571 Bacteria 2150
439 Ga0501040_0203080 3300049576 Bacteria 1408
440 Ga0501047_0874461 3300049581 Bacteria 712
441 Ga0501070_0028936 3300049586 Bacteria 4646
442 Ga0501072_1162974 3300049588 Unclassified 600
443 Ga0501080_0019238 3300049742 Bacteria 6324
444 Ga0501044_0901850 3300049823 Bacteria 759
445 nmdc:mga05p37_802_c1 3300050507 Bacteria 35044
446 nmdc:mga09592_320_c1 3300050508 Bacteria 35151
447 nmdc:mga0qj67_116583_c1 3300050509 Bacteria 2158
448 nmdc:mga08y16_1134462_c1 3300050511 Bacteria 755
449 nmdc:mga08y16_1159_c1 3300050511 Bacteria 25985
450 nmdc:mga08y16_596375_c1 3300050511 Bacteria 1114
451 nmdc:mga08y16_75787_c1 3300050511 Bacteria 3506
452 nmdc:mga0n895_2079_c1 3300050512 Bacteria 15416
453 nmdc:mga0rr50_4941_c1 3300050513 Bacteria 7895
454 nmdc:mga08x19_952_c1 3300050514 Bacteria 18176
455 nmdc:mga0a205_193827_c1 3300050515 Bacteria 1923
456 nmdc:mga0a205_5728_c1 3300050515 Bacteria 11195
457 Ga0500608_000963 3300053122 Bacteria 10305
458 Ga0500655_004732 3300053133 Bacteria 2447
459 Ga0501084_0000016 3300054114 Bacteria 155919
460 Ga0501082_0546103 3300060353 Bacteria 1013

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035084 Ga0373928_0012413 Ga0373928_0012413_579_977 121
2 3300006846 Ga0075430_100850528 Ga0075430_1008505282 129
3 3300046501 Ga0495607_0324743 Ga0495607_0324743_134_523 129
4 3300046539 Ga0495621_0522145 Ga0495621_0522145_72_461 129
5 3300046684 Ga0495669_0082403 Ga0495669_0082403_21_410 129
6 3300049576 Ga0501040_0203080 Ga0501040_0203080_407_796 129
7 3300049588 Ga0501072_1162974 Ga0501072_1162974_199_588 129
8 3300005435 Ga0070714_100224699 Ga0070714_1002246992 130
9 3300025923 Ga0207681_10188772 Ga0207681_101887722 130
10 3300025929 Ga0207664_10198246 Ga0207664_101982462 130
11 3300046664 Ga0495659_0312875 Ga0495659_0312875_107_517 131
12 3300005330 Ga0070690_100000235 Ga0070690_10000023530 132
13 3300005334 Ga0068869_100000023 Ga0068869_10000002346 132
14 3300005335 Ga0070666_10261480 Ga0070666_102614802 132
15 3300005336 Ga0070680_100003526 Ga0070680_10000352612 132
16 3300005337 Ga0070682_100004674 Ga0070682_1000046746 132
17 3300005338 Ga0068868_100000293 Ga0068868_10000029313 132
18 3300005341 Ga0070691_10002924 Ga0070691_100029244 132
19 3300005345 Ga0070692_10007542 Ga0070692_100075422 132
20 3300005364 Ga0070673_100217246 Ga0070673_1002172462 132
21 3300005406 Ga0070703_10116568 Ga0070703_101165681 132
22 3300005438 Ga0070701_10000090 Ga0070701_1000009014 132
23 3300005441 Ga0070700_100001456 Ga0070700_10000145610 132
24 3300005444 Ga0070694_100000160 Ga0070694_10000016027 132
25 3300005445 Ga0070708_100518774 Ga0070708_1005187742 132
26 3300005456 Ga0070678_100055885 Ga0070678_1000558853 132
27 3300005458 Ga0070681_10190266 Ga0070681_101902663 132
28 3300005459 Ga0068867_100001762 Ga0068867_1000017628 132
29 3300005539 Ga0068853_100241698 Ga0068853_1002416983 132
30 3300005543 Ga0070672_100037129 Ga0070672_1000371294 132
31 3300005544 Ga0070686_100000090 Ga0070686_1000000909 132
32 3300005545 Ga0070695_100000130 Ga0070695_10000013027 132
33 3300005546 Ga0070696_100000397 Ga0070696_10000039718 132
34 3300005549 Ga0070704_100000637 Ga0070704_10000063712 132
35 3300005615 Ga0070702_100000356 Ga0070702_1000003566 132
36 3300005617 Ga0068859_100001613 Ga0068859_10000161314 132
37 3300005618 Ga0068864_100001828 Ga0068864_10000182822 132
38 3300005842 Ga0068858_100001347 Ga0068858_10000134712 132
39 3300006358 Ga0068871_100009531 Ga0068871_10000953114 132
40 3300006931 Ga0097620_100001613 Ga0097620_10000161327 132
41 3300025885 Ga0207653_10014105 Ga0207653_100141052 132
42 3300025921 Ga0207652_10708276 Ga0207652_107082762 132
43 3300025925 Ga0207650_10103122 Ga0207650_101031222 132
44 3300025926 Ga0207659_10001313 Ga0207659_1000131319 132
45 3300025931 Ga0207644_10003952 Ga0207644_1000395216 132
46 3300025941 Ga0207711_10019340 Ga0207711_100193402 132
47 3300026023 Ga0207677_10000836 Ga0207677_1000083617 132
48 3300026035 Ga0207703_10000361 Ga0207703_1000036164 132
49 3300026041 Ga0207639_10511775 Ga0207639_105117752 132
50 3300026041 Ga0207639_10711809 Ga0207639_107118092 132
51 3300026078 Ga0207702_10163189 Ga0207702_101631892 132
52 3300026095 Ga0207676_10001719 Ga0207676_1000171917 132
53 3300026118 Ga0207675_100211910 Ga0207675_1002119102 132
54 3300034817 Ga0373948_0043216 Ga0373948_0043216_58_456 132
55 3300035111 Ga0373923_0070250 Ga0373923_0070250_1092_1493 132
56 3300035121 Ga0373960_0138891 Ga0373960_0138891_378_776 132
57 3300035242 Ga0373962_0282592 Ga0373962_0282592_44_442 132
58 3300035691 Ga0373931_0022765 Ga0373931_0022765_264_662 132
59 3300046459 Ga0495629_0923170 Ga0495629_0923170_20_421 132
60 3300025941 Ga0207711_10000002 Ga0207711_10000002757 133
61 3300031852 Ga0307410_11327494 Ga0307410_113274942 134
62 3300005329 Ga0070683_100768805 Ga0070683_1007688051 135
63 3300005345 Ga0070692_10249482 Ga0070692_102494822 135
64 iso_pu_bacteria 8001522603 8001523033 135
65 3300005327 Ga0070658_10587878 Ga0070658_105878781 136
66 3300005329 Ga0070683_100365192 Ga0070683_1003651922 136
67 3300005329 Ga0070683_100501443 Ga0070683_1005014431 136
68 3300005336 Ga0070680_100063220 Ga0070680_1000632205 136
69 3300005341 Ga0070691_10006942 Ga0070691_100069426 136
70 3300005355 Ga0070671_100151193 Ga0070671_1001511932 136
71 3300005458 Ga0070681_10077685 Ga0070681_100776853 136
72 3300005530 Ga0070679_100003462 Ga0070679_10000346211 136
73 3300005539 Ga0068853_100564445 Ga0068853_1005644452 136
74 3300005563 Ga0068855_100114613 Ga0068855_1001146133 136
75 3300005564 Ga0070664_100539963 Ga0070664_1005399633 136
76 3300005578 Ga0068854_101046860 Ga0068854_1010468602 136
77 3300005618 Ga0068864_100738799 Ga0068864_1007387992 136
78 3300009093 Ga0105240_10081004 Ga0105240_100810043 136
79 3300025909 Ga0207705_10960583 Ga0207705_109605832 136
80 3300025912 Ga0207707_10016260 Ga0207707_100162601 136
81 3300025913 Ga0207695_10001727 Ga0207695_1000172738 136
82 3300025913 Ga0207695_10015061 Ga0207695_1001506111 136
83 3300025917 Ga0207660_10129788 Ga0207660_101297885 136
84 3300025921 Ga0207652_10024709 Ga0207652_100247092 136
85 3300025924 Ga0207694_10159951 Ga0207694_101599512 136
86 3300025931 Ga0207644_10267679 Ga0207644_102676792 136
87 3300025944 Ga0207661_10581470 Ga0207661_105814703 136
88 3300025945 Ga0207679_10363974 Ga0207679_103639742 136
89 3300025949 Ga0207667_10180291 Ga0207667_101802913 136
90 3300026067 Ga0207678_11355815 Ga0207678_113558151 136
91 3300026078 Ga0207702_11854714 Ga0207702_118547141 136
92 3300026095 Ga0207676_10374824 Ga0207676_103748241 136
93 3300035113 Ga0373936_0000998 Ga0373936_0000998_9459_9869 136
94 3300037312 Ga0395899_0834679 Ga0395899_0834679_127_537 136
95 3300037418 Ga0395900_0183663 Ga0395900_0183663_290_700 136
96 3300046663 Ga0495635_1009825 Ga0495635_1009825_40_450 136
97 3300049823 Ga0501044_0901850 Ga0501044_0901850_295_705 136
98 3300005340 Ga0070689_101279859 Ga0070689_1012798591 138
99 3300048904 Ga0496101_0407049 Ga0496101_0407049_547_963 138
100 3300048915 Ga0496112_1357298 Ga0496112_1357298_180_596 138
101 3300005539 Ga0068853_100062341 Ga0068853_1000623413 139
102 3300026041 Ga0207639_10034071 Ga0207639_100340713 139
103 3300032002 Ga0307416_101909729 Ga0307416_1019097292 139
104 3300048920 Ga0496117_0145981 Ga0496117_0145981_952_1371 139
105 3300048921 Ga0496118_0024776 Ga0496118_0024776_2132_2551 139
106 3300048927 Ga0496124_0098493 Ga0496124_0098493_1319_1738 139
107 3300048928 Ga0496125_0426052 Ga0496125_0426052_19_438 139
108 3300049586 Ga0501070_0028936 Ga0501070_0028936_3963_4382 139
109 3300054114 Ga0501084_0000016 Ga0501084_0000016_89699_90118 139
110 3300060353 Ga0501082_0546103 Ga0501082_0546103_565_984 139
111 3300003320 rootH2_10002821 rootH2_100028212 140
112 3300005539 Ga0068853_100001493 Ga0068853_10000149317 140
113 3300005616 Ga0068852_100182774 Ga0068852_1001827742 140
114 3300009093 Ga0105240_10321231 Ga0105240_103212313 140
115 3300009093 Ga0105240_11081330 Ga0105240_110813301 140
116 3300009177 Ga0105248_10000001 Ga0105248_1000000156 140
117 3300009551 Ga0105238_10964673 Ga0105238_109646731 140
118 3300010375 Ga0105239_10404885 Ga0105239_104048851 140
119 3300014497 Ga0182008_10655584 Ga0182008_106555841 140
120 3300025913 Ga0207695_10655669 Ga0207695_106556692 140
121 3300026041 Ga0207639_10001596 Ga0207639_1000159616 140
122 3300026142 Ga0207698_10082357 Ga0207698_100823572 140
123 3300031711 Ga0265314_10162312 Ga0265314_101623123 140
124 3300046462 Ga0495651_0262479 Ga0495651_0262479_296_718 140
125 3300049581 Ga0501047_0874461 Ga0501047_0874461_241_663 140
126 3300049742 Ga0501080_0019238 Ga0501080_0019238_4084_4506 140
127 3300053122 Ga0500608_000963 Ga0500608_000963_3180_3602 140
128 3300005328 Ga0070676_10008083 Ga0070676_100080832 141
129 3300005328 Ga0070676_10107713 Ga0070676_101077132 141
130 3300005331 Ga0070670_100095041 Ga0070670_1000950413 141
131 3300005331 Ga0070670_100169296 Ga0070670_1001692964 141
132 3300005333 Ga0070677_10051074 Ga0070677_100510743 141
133 3300005335 Ga0070666_10568266 Ga0070666_105682662 141
134 3300005338 Ga0068868_100050944 Ga0068868_1000509444 141
135 3300005338 Ga0068868_100905958 Ga0068868_1009059582 141
136 3300005344 Ga0070661_100097461 Ga0070661_1000974613 141
137 3300005353 Ga0070669_100406575 Ga0070669_1004065752 141
138 3300005354 Ga0070675_100107985 Ga0070675_1001079855 141
139 3300005355 Ga0070671_100187456 Ga0070671_1001874563 141
140 3300005355 Ga0070671_100191990 Ga0070671_1001919902 141
141 3300005355 Ga0070671_100344845 Ga0070671_1003448453 141
142 3300005356 Ga0070674_100095967 Ga0070674_1000959673 141
143 3300005364 Ga0070673_101029226 Ga0070673_1010292262 141
144 3300005367 Ga0070667_100740542 Ga0070667_1007405422 141
145 3300005441 Ga0070700_100299496 Ga0070700_1002994961 141
146 3300005455 Ga0070663_100059649 Ga0070663_1000596496 141
147 3300005456 Ga0070678_100118160 Ga0070678_1001181604 141
148 3300005456 Ga0070678_100876875 Ga0070678_1008768751 141
149 3300005459 Ga0068867_100027232 Ga0068867_1000272327 141
150 3300005459 Ga0068867_100044455 Ga0068867_1000444555 141
151 3300005539 Ga0068853_100271850 Ga0068853_1002718502 141
152 3300005539 Ga0068853_101072331 Ga0068853_1010723311 141
153 3300005543 Ga0070672_100082250 Ga0070672_1000822502 141
154 3300005548 Ga0070665_100352405 Ga0070665_1003524052 141
155 3300005578 Ga0068854_100063174 Ga0068854_1000631743 141
156 3300005614 Ga0068856_100335567 Ga0068856_1003355672 141
157 3300005615 Ga0070702_100962658 Ga0070702_1009626582 141
158 3300005616 Ga0068852_100025914 Ga0068852_1000259142 141
159 3300005616 Ga0068852_100147342 Ga0068852_1001473422 141
160 3300005616 Ga0068852_102239562 Ga0068852_1022395622 141
161 3300005618 Ga0068864_101979271 Ga0068864_1019792711 141
162 3300005719 Ga0068861_100164781 Ga0068861_1001647813 141
163 3300005834 Ga0068851_10095088 Ga0068851_100950883 141
164 3300005834 Ga0068851_10609740 Ga0068851_106097402 141
165 3300006237 Ga0097621_100796173 Ga0097621_1007961731 141
166 3300006237 Ga0097621_101231058 Ga0097621_1012310582 141
167 3300006358 Ga0068871_100449264 Ga0068871_1004492641 141
168 3300006846 Ga0075430_100114872 Ga0075430_1001148723 141
169 3300006881 Ga0068865_101074983 Ga0068865_1010749832 141
170 3300009093 Ga0105240_10000641 Ga0105240_1000064157 141
171 3300009093 Ga0105240_10553128 Ga0105240_105531282 141
172 3300009101 Ga0105247_10034226 Ga0105247_100342262 141
173 3300009174 Ga0105241_10797054 Ga0105241_107970541 141
174 3300009176 Ga0105242_11095717 Ga0105242_110957172 141
175 3300009177 Ga0105248_10117410 Ga0105248_101174106 141
176 3300009551 Ga0105238_10006158 Ga0105238_1000615815 141
177 3300010375 Ga0105239_10007283 Ga0105239_1000728311 141
178 3300010375 Ga0105239_10007308 Ga0105239_1000730811 141
179 3300013105 Ga0157369_10047070 Ga0157369_100470702 141
180 3300013105 Ga0157369_11471221 Ga0157369_114712211 141
181 3300013297 Ga0157378_10049281 Ga0157378_100492814 141
182 3300013297 Ga0157378_10776122 Ga0157378_107761221 141
183 3300013306 Ga0163162_10236526 Ga0163162_102365264 141
184 3300013307 Ga0157372_10769612 Ga0157372_107696121 141
185 3300013308 Ga0157375_10004033 Ga0157375_100040335 141
186 3300014325 Ga0163163_11243826 Ga0163163_112438262 141
187 3300014326 Ga0157380_10053091 Ga0157380_100530913 141
188 3300014326 Ga0157380_10414827 Ga0157380_104148272 141
189 3300014969 Ga0157376_10077783 Ga0157376_100777834 141
190 3300025321 Ga0207656_10356152 Ga0207656_103561521 141
191 3300025900 Ga0207710_10178060 Ga0207710_101780601 141
192 3300025903 Ga0207680_10134129 Ga0207680_101341293 141
193 3300025903 Ga0207680_10723956 Ga0207680_107239562 141
194 3300025907 Ga0207645_10005271 Ga0207645_100052716 141
195 3300025907 Ga0207645_10008824 Ga0207645_100088242 141
196 3300025911 Ga0207654_10047104 Ga0207654_100471042 141
197 3300025913 Ga0207695_10000018 Ga0207695_10000018322 141
198 3300025920 Ga0207649_10021569 Ga0207649_100215692 141
199 3300025923 Ga0207681_10407514 Ga0207681_104075142 141
200 3300025924 Ga0207694_10000018 Ga0207694_10000018216 141
201 3300025925 Ga0207650_10355288 Ga0207650_103552883 141
202 3300025926 Ga0207659_10325853 Ga0207659_103258533 141
203 3300025927 Ga0207687_11126899 Ga0207687_111268991 141
204 3300025931 Ga0207644_10041295 Ga0207644_100412952 141
205 3300025931 Ga0207644_10059420 Ga0207644_100594204 141
206 3300025931 Ga0207644_10066495 Ga0207644_100664952 141
207 3300025931 Ga0207644_10154315 Ga0207644_101543152 141
208 3300025936 Ga0207670_11140921 Ga0207670_111409211 141
209 3300025937 Ga0207669_10047773 Ga0207669_100477732 141
210 3300025937 Ga0207669_10405234 Ga0207669_104052342 141
211 3300025940 Ga0207691_10182762 Ga0207691_101827623 141
212 3300025944 Ga0207661_10267836 Ga0207661_102678363 141
213 3300025949 Ga0207667_10000052 Ga0207667_10000052137 141
214 3300025960 Ga0207651_10232634 Ga0207651_102326342 141
215 3300025981 Ga0207640_10055904 Ga0207640_100559042 141
216 3300025986 Ga0207658_11464954 Ga0207658_114649542 141
217 3300026023 Ga0207677_10327402 Ga0207677_103274022 141
218 3300026041 Ga0207639_10393343 Ga0207639_103933432 141
219 3300026067 Ga0207678_10055545 Ga0207678_100555453 141
220 3300026075 Ga0207708_10190541 Ga0207708_101905412 141
221 3300026088 Ga0207641_10432479 Ga0207641_104324792 141
222 3300026089 Ga0207648_10052124 Ga0207648_100521247 141
223 3300026089 Ga0207648_10061935 Ga0207648_100619355 141
224 3300026118 Ga0207675_100484589 Ga0207675_1004845893 141
225 3300026121 Ga0207683_10012223 Ga0207683_100122237 141
226 3300026121 Ga0207683_10668334 Ga0207683_106683342 141
227 3300026142 Ga0207698_10110618 Ga0207698_101106181 141
228 3300026142 Ga0207698_10135978 Ga0207698_101359784 141
229 3300026142 Ga0207698_10475931 Ga0207698_104759311 141
230 3300028379 Ga0268266_10071153 Ga0268266_100711534 141
231 3300028800 Ga0265338_10000005 Ga0265338_10000005155 141
232 3300031090 Ga0265760_10004606 Ga0265760_100046066 141
233 3300031241 Ga0265325_10000010 Ga0265325_1000001029 141
234 3300031242 Ga0265329_10166292 Ga0265329_101662921 141
235 3300031249 Ga0265339_10001218 Ga0265339_1000121812 141
236 3300031595 Ga0265313_10021854 Ga0265313_100218542 141
237 3300031711 Ga0265314_10071831 Ga0265314_100718311 141
238 3300031730 Ga0307516_10187379 Ga0307516_101873792 141
239 3300035083 Ga0373926_0008569 Ga0373926_0008569_739_1164 141
240 3300035083 Ga0373926_0152550 Ga0373926_0152550_421_849 141
241 3300035089 Ga0373944_0030856 Ga0373944_0030856_335_760 141
242 3300035089 Ga0373944_0055288 Ga0373944_0055288_799_1224 141
243 3300035113 Ga0373936_0001736 Ga0373936_0001736_7083_7508 141
244 3300035116 Ga0373945_0004584 Ga0373945_0004584_743_1168 141
245 3300035170 Ga0373943_0019737 Ga0373943_0019737_2161_2586 141
246 3300035171 Ga0373946_0006941 Ga0373946_0006941_1394_1819 141
247 3300035410 Ga0373924_0016558 Ga0373924_0016558_2230_2655 141
248 3300035692 Ga0373935_0028624 Ga0373935_0028624_2962_3387 141
249 3300035692 Ga0373935_0029511 Ga0373935_0029511_2172_2597 141
250 3300035695 Ga0373927_0023751 Ga0373927_0023751_866_1291 141
251 3300037068 Ga0373925_0045237 Ga0373925_0045237_1323_1748 141
252 3300045051 Ga0451576_0175350 Ga0451576_0175350_853_1278 141
253 3300046455 Ga0495603_0011613 Ga0495603_0011613_1206_1631 141
254 3300046462 Ga0495651_0715861 Ga0495651_0715861_128_553 141
255 3300046472 Ga0495580_0010391 Ga0495580_0010391_1078_1503 141
256 3300046473 Ga0495582_0014893 Ga0495582_0014893_3028_3453 141
257 3300046475 Ga0495639_0037774 Ga0495639_0037774_945_1370 141
258 3300046477 Ga0495664_0356341 Ga0495664_0356341_213_638 141
259 3300046523 Ga0495644_0245160 Ga0495644_0245160_52_477 141
260 3300046526 Ga0495666_0055192 Ga0495666_0055192_576_1001 141
261 3300046529 Ga0495652_0376900 Ga0495652_0376900_445_870 141
262 3300046531 Ga0495665_0260677 Ga0495665_0260677_225_650 141
263 3300046535 Ga0495586_0044579 Ga0495586_0044579_1213_1638 141
264 3300046536 Ga0495587_0137269 Ga0495587_0137269_224_649 141
265 3300046536 Ga0495587_0411412 Ga0495587_0411412_295_723 141
266 3300046537 Ga0495598_0031344 Ga0495598_0031344_1013_1438 141
267 3300046543 Ga0495645_0119687 Ga0495645_0119687_500_925 141
268 3300046615 Ga0495656_0020881 Ga0495656_0020881_1030_1455 141
269 3300046664 Ga0495659_0026910 Ga0495659_0026910_1055_1480 141
270 3300046674 Ga0495588_0006502 Ga0495588_0006502_3354_3779 141
271 3300046681 Ga0495647_0000149 Ga0495647_0000149_14163_14588 141
272 3300046681 Ga0495647_0099105 Ga0495647_0099105_34_465 141
273 3300046683 Ga0495658_0004682 Ga0495658_0004682_2823_3248 141
274 3300046691 Ga0495670_0207310 Ga0495670_0207310_59_484 141
275 3300047315 Ga0495581_0035777 Ga0495581_0035777_2068_2493 141
276 3300047321 Ga0495676_0045133 Ga0495676_0045133_2241_2666 141
277 3300047445 Ga0495677_0119472 Ga0495677_0119472_394_819 141
278 3300048903 Ga0496100_0782645 Ga0496100_0782645_74_505 141
279 3300048908 Ga0496105_0970483 Ga0496105_0970483_99_527 141
280 3300048911 Ga0496108_0013424 Ga0496108_0013424_200_628 141
281 3300048912 Ga0496109_0059814 Ga0496109_0059814_2969_3397 141
282 3300048913 Ga0496110_0172872 Ga0496110_0172872_1373_1801 141
283 3300048913 Ga0496110_0177112 Ga0496110_0177112_366_797 141
284 3300049460 Ga0495682_0001571 Ga0495682_0001571_10065_10490 141
285 3300049571 Ga0501034_0169602 Ga0501034_0169602_407_832 141
286 3300050511 nmdc:mga08y16_596375_c1 nmdc:mga08y16_596375_c1_332_760 141
287 3300053133 Ga0500655_004732 Ga0500655_004732_438_863 141
288 3300005328 Ga0070676_10007826 Ga0070676_100078268 142
289 3300005330 Ga0070690_100005283 Ga0070690_1000052831 142
290 3300005331 Ga0070670_100130180 Ga0070670_1001301802 142
291 3300005334 Ga0068869_100034054 Ga0068869_1000340547 142
292 3300005335 Ga0070666_10000930 Ga0070666_100009309 142
293 3300005338 Ga0068868_100001477 Ga0068868_10000147724 142
294 3300005340 Ga0070689_100540370 Ga0070689_1005403702 142
295 3300005344 Ga0070661_100177837 Ga0070661_1001778373 142
296 3300005354 Ga0070675_100002416 Ga0070675_10000241621 142
297 3300005355 Ga0070671_100030696 Ga0070671_1000306966 142
298 3300005364 Ga0070673_100002692 Ga0070673_10000269221 142
299 3300005367 Ga0070667_100002444 Ga0070667_10000244418 142
300 3300005459 Ga0068867_100292576 Ga0068867_1002925761 142
301 3300005564 Ga0070664_100233240 Ga0070664_1002332402 142
302 3300005841 Ga0068863_100083293 Ga0068863_1000832932 142
303 3300005841 Ga0068863_100862651 Ga0068863_1008626512 142
304 3300009177 Ga0105248_10005486 Ga0105248_1000548622 142
305 3300011119 Ga0105246_10384559 Ga0105246_103845592 142
306 3300013296 Ga0157374_10033778 Ga0157374_100337782 142
307 3300013306 Ga0163162_10017053 Ga0163162_100170533 142
308 3300014325 Ga0163163_10003621 Ga0163163_100036219 142
309 3300014968 Ga0157379_10006033 Ga0157379_1000603315 142
310 3300014969 Ga0157376_10582708 Ga0157376_105827082 142
311 3300025903 Ga0207680_10001996 Ga0207680_100019969 142
312 3300025907 Ga0207645_10014239 Ga0207645_100142395 142
313 3300025936 Ga0207670_10294335 Ga0207670_102943352 142
314 3300025940 Ga0207691_10336992 Ga0207691_103369923 142
315 3300025942 Ga0207689_10045519 Ga0207689_100455191 142
316 3300025960 Ga0207651_10002814 Ga0207651_100028147 142
317 3300025986 Ga0207658_10007627 Ga0207658_1000762712 142
318 3300026067 Ga0207678_10302399 Ga0207678_103023992 142
319 3300026088 Ga0207641_10018243 Ga0207641_100182434 142
320 3300026089 Ga0207648_10037742 Ga0207648_100377423 142
321 3300026121 Ga0207683_10001709 Ga0207683_1000170917 142
322 3300028381 Ga0268264_10411075 Ga0268264_104110753 142
323 3300039437 Ga0436365_1016022 Ga0436365_1016022_163_594 142
324 3300048909 Ga0496106_0620407 Ga0496106_0620407_137_571 142
325 3300048910 Ga0496107_1269794 Ga0496107_1269794_24_458 142
326 3300048911 Ga0496108_0049577 Ga0496108_0049577_739_1173 142
327 3300005444 Ga0070694_101566392 Ga0070694_1015663921 143
328 3300021384 Ga0213876_10000474 Ga0213876_1000047432 143
329 3300039437 Ga0436365_1849791 Ga0436365_1849791_108695_109171 143
330 3300002070 JGI24750J21931_1081071 JGI24750J21931_10810711 144
331 3300005340 Ga0070689_100000974 Ga0070689_10000097417 144
332 3300005343 Ga0070687_100000142 Ga0070687_1000001426 144
333 3300005440 Ga0070705_100000668 Ga0070705_1000006682 144
334 3300005466 Ga0070685_10968188 Ga0070685_109681881 144
335 3300005530 Ga0070679_100811505 Ga0070679_1008115051 144
336 3300005547 Ga0070693_100000496 Ga0070693_10000049617 144
337 3300005563 Ga0068855_100006339 Ga0068855_1000063396 144
338 3300005578 Ga0068854_100001716 Ga0068854_10000171617 144
339 3300005614 Ga0068856_100017993 Ga0068856_1000179936 144
340 3300005616 Ga0068852_100114034 Ga0068852_1001140341 144
341 3300005617 Ga0068859_100001418 Ga0068859_1000014187 144
342 3300005718 Ga0068866_10000337 Ga0068866_1000033716 144
343 3300005719 Ga0068861_100000043 Ga0068861_10000004320 144
344 3300005842 Ga0068858_100002717 Ga0068858_10000271711 144
345 3300005843 Ga0068860_100007750 Ga0068860_1000077508 144
346 3300005844 Ga0068862_100000320 Ga0068862_10000032027 144
347 3300006237 Ga0097621_100000206 Ga0097621_10000020643 144
348 3300006358 Ga0068871_100000040 Ga0068871_10000004056 144
349 3300006881 Ga0068865_100000245 Ga0068865_10000024516 144
350 3300006931 Ga0097620_100001418 Ga0097620_1000014187 144
351 3300009098 Ga0105245_10000224 Ga0105245_1000022444 144
352 3300009148 Ga0105243_10000035 Ga0105243_10000035108 144
353 3300009174 Ga0105241_10244576 Ga0105241_102445762 144
354 3300009176 Ga0105242_10000300 Ga0105242_100003006 144
355 3300009545 Ga0105237_11276586 Ga0105237_112765862 144
356 3300009553 Ga0105249_10052250 Ga0105249_100522504 144
357 3300010375 Ga0105239_10105509 Ga0105239_101055094 144
358 3300013296 Ga0157374_12912669 Ga0157374_129126691 144
359 3300013297 Ga0157378_10002478 Ga0157378_1000247817 144
360 3300013306 Ga0163162_10053252 Ga0163162_100532526 144
361 3300013307 Ga0157372_10373369 Ga0157372_103733692 144
362 3300013307 Ga0157372_10842233 Ga0157372_108422332 144
363 3300014326 Ga0157380_10020779 Ga0157380_100207794 144
364 3300014745 Ga0157377_10141533 Ga0157377_101415332 144
365 3300014968 Ga0157379_10783374 Ga0157379_107833742 144
366 3300014969 Ga0157376_10020252 Ga0157376_100202526 144
367 3300025899 Ga0207642_10002929 Ga0207642_100029292 144
368 3300025903 Ga0207680_10237902 Ga0207680_102379022 144
369 3300025912 Ga0207707_10247631 Ga0207707_102476312 144
370 3300025917 Ga0207660_10010313 Ga0207660_100103139 144
371 3300025918 Ga0207662_10000091 Ga0207662_1000009145 144
372 3300025926 Ga0207659_10806051 Ga0207659_108060512 144
373 3300025927 Ga0207687_10005537 Ga0207687_100055376 144
374 3300025934 Ga0207686_10000914 Ga0207686_1000091417 144
375 3300025935 Ga0207709_10001149 Ga0207709_100011499 144
376 3300025936 Ga0207670_10005058 Ga0207670_100050589 144
377 3300025938 Ga0207704_10001399 Ga0207704_100013999 144
378 3300025942 Ga0207689_10000024 Ga0207689_10000024101 144
379 3300025949 Ga0207667_10040129 Ga0207667_100401296 144
380 3300025960 Ga0207651_10427036 Ga0207651_104270362 144
381 3300025961 Ga0207712_10020378 Ga0207712_100203785 144
382 3300025981 Ga0207640_10001826 Ga0207640_1000182615 144
383 3300026023 Ga0207677_10000435 Ga0207677_1000043511 144
384 3300026035 Ga0207703_10001473 Ga0207703_1000147314 144
385 3300026075 Ga0207708_10001349 Ga0207708_1000134914 144
386 3300026089 Ga0207648_10000316 Ga0207648_1000031641 144
387 3300026118 Ga0207675_100000017 Ga0207675_10000001721 144
388 3300026142 Ga0207698_10159705 Ga0207698_101597051 144
389 3300028380 Ga0268265_10003537 Ga0268265_1000353712 144
390 3300028381 Ga0268264_10001250 Ga0268264_1000125015 144
391 3300035084 Ga0373928_0028517 Ga0373928_0028517_146_592 144
392 3300035112 Ga0373932_0159589 Ga0373932_0159589_18_464 144
393 3300035207 Ga0373942_0070755 Ga0373942_0070755_515_961 144
394 3300035691 Ga0373931_0325793 Ga0373931_0325793_256_702 144
395 3300045051 Ga0451576_0687294 Ga0451576_0687294_134_568 144
396 3300000044 ARSoilOldRDRAFT_c025710 ARSoilOldRDRAFT_0257101 145
397 3300005289 Ga0065704_10482563 Ga0065704_104825631 145
398 3300005295 Ga0065707_10213354 Ga0065707_102133541 145
399 3300005330 Ga0070690_100385314 Ga0070690_1003853141 145
400 3300005617 Ga0068859_100147848 Ga0068859_1001478482 145
401 3300005618 Ga0068864_100031456 Ga0068864_1000314564 145
402 3300005841 Ga0068863_100560588 Ga0068863_1005605882 145
403 3300005842 Ga0068858_100053514 Ga0068858_1000535143 145
404 3300006844 Ga0075428_100000107 Ga0075428_10000010771 145
405 3300006846 Ga0075430_100206335 Ga0075430_1002063352 145
406 3300006852 Ga0075433_10021071 Ga0075433_100210712 145
407 3300006852 Ga0075433_10163236 Ga0075433_101632362 145
408 3300006871 Ga0075434_100000151 Ga0075434_10000015131 145
409 3300006880 Ga0075429_100004376 Ga0075429_1000043762 145
410 3300006914 Ga0075436_100001172 Ga0075436_10000117221 145
411 3300006931 Ga0097620_100147856 Ga0097620_1001478562 145
412 3300007076 Ga0075435_100000699 Ga0075435_10000069920 145
413 3300009094 Ga0111539_10006727 Ga0111539_1000672715 145
414 3300009094 Ga0111539_10050841 Ga0111539_100508413 145
415 3300009147 Ga0114129_10000040 Ga0114129_1000004021 145
416 3300010375 Ga0105239_11470581 Ga0105239_114705812 145
417 3300012494 Ga0157341_1016265 Ga0157341_10162652 145
418 3300012505 Ga0157339_1009062 Ga0157339_10090622 145
419 3300012508 Ga0157315_1002588 Ga0157315_10025882 145
420 3300013308 Ga0157375_12356961 Ga0157375_123569612 145
421 3300025904 Ga0207647_10241468 Ga0207647_102414682 145
422 3300025936 Ga0207670_10023063 Ga0207670_100230636 145
423 3300026035 Ga0207703_10160103 Ga0207703_101601032 145
424 3300026088 Ga0207641_11140801 Ga0207641_111408012 145
425 3300026095 Ga0207676_10032335 Ga0207676_100323353 145
426 3300026116 Ga0207674_11520913 Ga0207674_115209132 145
427 3300027907 Ga0207428_10000179 Ga0207428_1000017933 145
428 3300027907 Ga0207428_10118316 Ga0207428_101183163 145
429 3300034816 Ga0373930_0022750 Ga0373930_0022750_758_1195 145
430 3300034819 Ga0373958_0053786 Ga0373958_0053786_390_827 145
431 3300035084 Ga0373928_0002250 Ga0373928_0002250_625_1062 145
432 3300035085 Ga0373929_0063790 Ga0373929_0063790_302_739 145
433 3300035090 Ga0373949_0001814 Ga0373949_0001814_366_803 145
434 3300035091 Ga0373951_0009441 Ga0373951_0009441_1301_1738 145
435 3300035092 Ga0373952_0115388 Ga0373952_0115388_77_514 145
436 3300035112 Ga0373932_0013816 Ga0373932_0013816_328_765 145
437 3300035112 Ga0373932_0196933 Ga0373932_0196933_177_614 145
438 3300035114 Ga0373939_0005502 Ga0373939_0005502_697_1134 145
439 3300035114 Ga0373939_0047765 Ga0373939_0047765_68_505 145
440 3300035121 Ga0373960_0020325 Ga0373960_0020325_194_631 145
441 3300035207 Ga0373942_0009860 Ga0373942_0009860_1547_1984 145
442 3300035241 Ga0373961_0029131 Ga0373961_0029131_174_611 145
443 3300035242 Ga0373962_0054341 Ga0373962_0054341_107_544 145
444 3300035691 Ga0373931_0001934 Ga0373931_0001934_5806_6243 145
445 3300035691 Ga0373931_0126666 Ga0373931_0126666_316_753 145
446 3300042876 Ga0451577_0231965 Ga0451577_0231965_237_686 145
447 3300044712 Ga0453684_1387694 Ga0453684_1387694_91_540 145
448 3300045051 Ga0451576_0000822 Ga0451576_0000822_59268_59717 145
449 3300045051 Ga0451576_0053628 Ga0451576_0053628_426_863 145
450 3300048912 Ga0496109_1442127 Ga0496109_1442127_74_511 145
451 3300050507 nmdc:mga05p37_802_c1 nmdc:mga05p37_802_c1_27198_27635 145
452 3300050508 nmdc:mga09592_320_c1 nmdc:mga09592_320_c1_23725_24162 145
453 3300050509 nmdc:mga0qj67_116583_c1 nmdc:mga0qj67_116583_c1_1057_1494 145
454 3300050511 nmdc:mga08y16_1134462_c1 nmdc:mga08y16_1134462_c1_239_688 145
455 3300050511 nmdc:mga08y16_1159_c1 nmdc:mga08y16_1159_c1_17967_18404 145
456 3300050511 nmdc:mga08y16_75787_c1 nmdc:mga08y16_75787_c1_2541_2978 145
457 3300050512 nmdc:mga0n895_2079_c1 nmdc:mga0n895_2079_c1_12771_13208 145
458 3300050513 nmdc:mga0rr50_4941_c1 nmdc:mga0rr50_4941_c1_1540_1977 145
459 3300050514 nmdc:mga08x19_952_c1 nmdc:mga08x19_952_c1_11554_11991 145
460 3300050515 nmdc:mga0a205_193827_c1 nmdc:mga0a205_193827_c1_152_589 145
461 3300050515 nmdc:mga0a205_5728_c1 nmdc:mga0a205_5728_c1_6034_6471 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01124

MAPEG

MAPEG family

6

130

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dww-assembly1.cif.gz_B electron crystallographic structure of human microsomal prostaglandin e synthase 1 0.6822 7 145
5bqg-assembly1.cif.gz_A crystal structure of mpges-1 bound to an inhibitor 0.6764 9 145
3dww-assembly1.cif.gz_B electron crystallographic structure of human microsomal prostaglandin e synthase 1 0.6661 7 145
5bqg-assembly1.cif.gz_A crystal structure of mpges-1 bound to an inhibitor 0.6413 9 145
3dww-assembly1.cif.gz_A electron crystallographic structure of human microsomal prostaglandin e synthase 1 0.6147 10 143
ID Description Score Start End Superfamily
af_A0A1D6GTQ9_1_167_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7835 66 145 1.20.58.70
af_P10620_2_155_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7231 9 140 1.20.120.550
af_Q86B54_20_166_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7207 6 143 1.20.120.550
af_Q9JHF3_7_153_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.712 6 145 1.20.120.550
af_Q86B54_20_166_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6868 6 143 1.20.120.550
ID Description Score Start End GO Terms
AF-K6YBU2-F1-model_v4 MAPEG family protein 0.9717 61 143 GO:0016020
AF-A0A536X9D6-F1-model_v4 MAPEG family protein 0.9552 15 141 GO:0016020
AF-A0A346MVJ5-F1-model_v4 MAPEG family protein 0.9536 7 141 GO:0016020
AF-A0A3N7CAH3-F1-model_v4 MAPEG family protein 0.953 7 141 GO:0016020
AF-K6YBU2-F1-model_v4 MAPEG family protein 0.9494 61 143 GO:0016020

Feature Viewer

pLDDT pTM Quality
89.54 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map