F448748
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 461 | 217 | 460 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300025917|Ga0207660_10563898|Ga0207660_105638981 |
| Length | 291 |
| Sequence | MPRRYAPLLKGNEKKDMRAGCYYRAARRVLLMHSSQKVAVITGAAQGIGRRTAELFAQQGYSLALVDLKPMAATAQAAQNSGAEVLELTGDISNEQSVSHFAASVTDRWGHADVLVNNAGISFISPAEQVSAADFRRVLEVNLVAPFLLAKAFGAMMLSQKSGSIVNVASVAGLLGIADRSAYNASKHGLIGLTRTLASEWGGRGVRVNAVCPGWVKTEMDAADQAGGGYSDADITNRVPMARFASPDDIAKAIAFLADDRLSGYVNGHTLSVDGGWSGDGSWDSLRLRHR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 56 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 80 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 81 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 82 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 83 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 122 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 124 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 125 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 126 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 127 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 128 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 130 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 131 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 132 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 133 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 134 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 135 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 136 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 137 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 138 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 186 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 187 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 189 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 190 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 191 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 192 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 193 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 194 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 195 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.57 |
| Metatranscriptomes | 0.22 |
| Isolates | 0.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.65 |
| Nodule | 0 |
| Rhizoplane | 5.21 |
| Rhizosphere | 91.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1001068 | 3300000546 | Bacteria | 4287 |
| 2 | rootL2_10177401 | 3300003322 | Bacteria | 1605 |
| 3 | Ga0065715_10182087 | 3300005293 | Bacteria | 1469 |
| 4 | Ga0070683_100073239 | 3300005329 | Bacteria | 3198 |
| 5 | Ga0070683_100102370 | 3300005329 | Bacteria | 2697 |
| 6 | Ga0070683_100243372 | 3300005329 | Unclassified | 1711 |
| 7 | Ga0070683_100403897 | 3300005329 | Bacteria | 1303 |
| 8 | Ga0070670_100015491 | 3300005331 | Bacteria | 6547 |
| 9 | Ga0068869_100000075 | 3300005334 | Bacteria | 44767 |
| 10 | Ga0068869_100032738 | 3300005334 | Bacteria | 3665 |
| 11 | Ga0070682_100257977 | 3300005337 | Bacteria | 1260 |
| 12 | Ga0068868_100001557 | 3300005338 | Bacteria | 15672 |
| 13 | Ga0068868_100198273 | 3300005338 | Bacteria | 1672 |
| 14 | Ga0068868_100344322 | 3300005338 | Bacteria | 1275 |
| 15 | Ga0070661_100003311 | 3300005344 | Bacteria | 11125 |
| 16 | Ga0070661_100033503 | 3300005344 | Bacteria | 3721 |
| 17 | Ga0070661_100046043 | 3300005344 | Bacteria | 3190 |
| 18 | Ga0070675_100044413 | 3300005354 | Bacteria | 3634 |
| 19 | Ga0070674_100032198 | 3300005356 | Bacteria | 3480 |
| 20 | Ga0070667_100002745 | 3300005367 | Bacteria | 15234 |
| 21 | Ga0070667_100345473 | 3300005367 | Bacteria | 1346 |
| 22 | Ga0070709_10000025 | 3300005434 | Bacteria | 129264 |
| 23 | Ga0070709_10020681 | 3300005434 | Bacteria | 3823 |
| 24 | Ga0070714_100025142 | 3300005435 | Bacteria | 4912 |
| 25 | Ga0070714_100068005 | 3300005435 | Unclassified | 3073 |
| 26 | Ga0070714_100241869 | 3300005435 | Bacteria | 1666 |
| 27 | Ga0070714_100253396 | 3300005435 | Bacteria | 1628 |
| 28 | Ga0070714_100384595 | 3300005435 | Unclassified | 1323 |
| 29 | Ga0070713_100026334 | 3300005436 | Bacteria | 4564 |
| 30 | Ga0070713_100328325 | 3300005436 | Bacteria | 1414 |
| 31 | Ga0070713_100361187 | 3300005436 | Unclassified | 1349 |
| 32 | Ga0070713_100670676 | 3300005436 | Bacteria | 988 |
| 33 | Ga0070711_100188093 | 3300005439 | Bacteria | 1585 |
| 34 | Ga0070711_100264541 | 3300005439 | Unclassified | 1355 |
| 35 | Ga0070711_100477751 | 3300005439 | Bacteria | 1024 |
| 36 | Ga0070663_100041016 | 3300005455 | Bacteria | 3244 |
| 37 | Ga0070663_100052111 | 3300005455 | Bacteria | 2918 |
| 38 | Ga0070663_100086273 | 3300005455 | Bacteria | 2318 |
| 39 | Ga0070678_100116659 | 3300005456 | Bacteria | 2098 |
| 40 | Ga0070662_100133884 | 3300005457 | Bacteria | 1914 |
| 41 | Ga0070681_10004083 | 3300005458 | Bacteria | 13792 |
| 42 | Ga0068867_100115804 | 3300005459 | Bacteria | 2065 |
| 43 | Ga0070679_100011350 | 3300005530 | Bacteria | 8490 |
| 44 | Ga0070679_100263789 | 3300005530 | Bacteria | 1677 |
| 45 | Ga0070684_100000516 | 3300005535 | Bacteria | 26542 |
| 46 | Ga0070684_100046808 | 3300005535 | Bacteria | 3748 |
| 47 | Ga0068853_100000474 | 3300005539 | Bacteria | 27401 |
| 48 | Ga0068853_100002760 | 3300005539 | Bacteria | 13257 |
| 49 | Ga0068853_100589251 | 3300005539 | Bacteria | 1055 |
| 50 | Ga0070672_100435006 | 3300005543 | Bacteria | 1128 |
| 51 | Ga0070696_100073248 | 3300005546 | Bacteria | 2413 |
| 52 | Ga0070665_100001777 | 3300005548 | Bacteria | 24558 |
| 53 | Ga0070665_100012643 | 3300005548 | Bacteria | 8501 |
| 54 | Ga0070665_100121699 | 3300005548 | Bacteria | 2611 |
| 55 | Ga0070704_100012967 | 3300005549 | Bacteria | 5157 |
| 56 | Ga0068855_100001789 | 3300005563 | Bacteria | 26855 |
| 57 | Ga0068855_100002618 | 3300005563 | Bacteria | 22183 |
| 58 | Ga0068855_100003162 | 3300005563 | Bacteria | 20152 |
| 59 | Ga0068855_100132121 | 3300005563 | Bacteria | 2850 |
| 60 | Ga0068855_100476921 | 3300005563 | Bacteria | 1358 |
| 61 | Ga0070664_100092019 | 3300005564 | Bacteria | 2625 |
| 62 | Ga0070664_100607744 | 3300005564 | Bacteria | 1014 |
| 63 | Ga0068857_100007650 | 3300005577 | Bacteria | 9304 |
| 64 | Ga0068857_100011623 | 3300005577 | Bacteria | 7658 |
| 65 | Ga0068857_100019826 | 3300005577 | Bacteria | 5909 |
| 66 | Ga0068857_100022550 | 3300005577 | Bacteria | 5539 |
| 67 | Ga0068857_100450753 | 3300005577 | Bacteria | 1203 |
| 68 | Ga0068854_100049081 | 3300005578 | Bacteria | 3014 |
| 69 | Ga0068854_100136943 | 3300005578 | Bacteria | 1875 |
| 70 | Ga0068854_100328044 | 3300005578 | Unclassified | 1246 |
| 71 | Ga0068856_100001190 | 3300005614 | Bacteria | 27408 |
| 72 | Ga0068856_100002078 | 3300005614 | Bacteria | 20771 |
| 73 | Ga0068856_100006428 | 3300005614 | Bacteria | 11533 |
| 74 | Ga0068856_100007628 | 3300005614 | Bacteria | 10558 |
| 75 | Ga0068856_100016253 | 3300005614 | Bacteria | 7200 |
| 76 | Ga0068856_100261928 | 3300005614 | Bacteria | 1744 |
| 77 | Ga0068852_100000046 | 3300005616 | Bacteria | 87937 |
| 78 | Ga0068852_100000078 | 3300005616 | Bacteria | 68720 |
| 79 | Ga0068852_100083573 | 3300005616 | Bacteria | 2839 |
| 80 | Ga0068859_100020456 | 3300005617 | Bacteria | 6642 |
| 81 | Ga0068864_100002989 | 3300005618 | Bacteria | 13980 |
| 82 | Ga0068866_10022080 | 3300005718 | Bacteria | 2941 |
| 83 | Ga0068851_10012742 | 3300005834 | Bacteria | 3971 |
| 84 | Ga0068851_10020298 | 3300005834 | Bacteria | 3216 |
| 85 | Ga0068851_10048202 | 3300005834 | Bacteria | 2159 |
| 86 | Ga0068851_10048271 | 3300005834 | Bacteria | 2157 |
| 87 | Ga0068863_100009508 | 3300005841 | Bacteria | 9482 |
| 88 | Ga0068863_100010964 | 3300005841 | Bacteria | 8789 |
| 89 | Ga0068863_100519209 | 3300005841 | Bacteria | 1174 |
| 90 | Ga0068858_100010050 | 3300005842 | Bacteria | 8985 |
| 91 | Ga0068858_100240880 | 3300005842 | Bacteria | 1716 |
| 92 | Ga0068860_100009498 | 3300005843 | Bacteria | 9659 |
| 93 | Ga0068860_100014067 | 3300005843 | Bacteria | 7850 |
| 94 | Ga0068862_100019940 | 3300005844 | Bacteria | 5597 |
| 95 | Ga0081540_1027891 | 3300005983 | Bacteria | 3187 |
| 96 | Ga0070717_10042187 | 3300006028 | Bacteria | 3721 |
| 97 | Ga0070717_10069048 | 3300006028 | Bacteria | 2942 |
| 98 | Ga0070717_10220542 | 3300006028 | Bacteria | 1667 |
| 99 | Ga0070716_100049161 | 3300006173 | Bacteria | 2388 |
| 100 | Ga0070716_100092825 | 3300006173 | Bacteria | 1831 |
| 101 | Ga0070712_100376215 | 3300006175 | Bacteria | 1168 |
| 102 | Ga0075367_10217548 | 3300006178 | Bacteria | 1195 |
| 103 | Ga0097621_100061878 | 3300006237 | Bacteria | 3071 |
| 104 | Ga0097621_100063183 | 3300006237 | Bacteria | 3042 |
| 105 | Ga0097621_100072019 | 3300006237 | Bacteria | 2858 |
| 106 | Ga0097621_100082669 | 3300006237 | Bacteria | 2675 |
| 107 | Ga0068871_100001065 | 3300006358 | Bacteria | 18417 |
| 108 | Ga0068871_100001674 | 3300006358 | Bacteria | 14903 |
| 109 | Ga0068871_100003942 | 3300006358 | Bacteria | 10243 |
| 110 | Ga0075433_10090932 | 3300006852 | Bacteria | 2698 |
| 111 | Ga0075433_10131169 | 3300006852 | Bacteria | 2226 |
| 112 | Ga0075434_100013220 | 3300006871 | Bacteria | 7846 |
| 113 | Ga0075434_100713257 | 3300006871 | Bacteria | 1020 |
| 114 | Ga0075436_100012163 | 3300006914 | Bacteria | 5896 |
| 115 | Ga0075436_100022363 | 3300006914 | Bacteria | 4342 |
| 116 | Ga0097620_100020456 | 3300006931 | Bacteria | 6642 |
| 117 | Ga0075435_100012104 | 3300007076 | Bacteria | 6377 |
| 118 | Ga0075435_100138257 | 3300007076 | Bacteria | 2042 |
| 119 | Ga0099795_10050119 | 3300007788 | Bacteria | 1517 |
| 120 | Ga0105240_10000002 | 3300009093 | Bacteria | 1924170 |
| 121 | Ga0105240_10000873 | 3300009093 | Bacteria | 54313 |
| 122 | Ga0105240_10001944 | 3300009093 | Bacteria | 34235 |
| 123 | Ga0105240_10022769 | 3300009093 | Bacteria | 8299 |
| 124 | Ga0105240_10031415 | 3300009093 | Bacteria | 6887 |
| 125 | Ga0105240_10036835 | 3300009093 | Bacteria | 6289 |
| 126 | Ga0105240_10110891 | 3300009093 | Bacteria | 3320 |
| 127 | Ga0111539_10016056 | 3300009094 | Bacteria | 9293 |
| 128 | Ga0111539_10044621 | 3300009094 | Bacteria | 5310 |
| 129 | Ga0105245_10001560 | 3300009098 | Bacteria | 20803 |
| 130 | Ga0105245_10061799 | 3300009098 | Bacteria | 3378 |
| 131 | Ga0105245_10070906 | 3300009098 | Bacteria | 3164 |
| 132 | Ga0105247_10004000 | 3300009101 | Bacteria | 9486 |
| 133 | Ga0114129_10188048 | 3300009147 | Bacteria | 2806 |
| 134 | Ga0105241_10000203 | 3300009174 | Bacteria | 44600 |
| 135 | Ga0105241_10001995 | 3300009174 | Bacteria | 15444 |
| 136 | Ga0105241_10004226 | 3300009174 | Bacteria | 10606 |
| 137 | Ga0105241_10021460 | 3300009174 | Bacteria | 4773 |
| 138 | Ga0105241_10025216 | 3300009174 | Bacteria | 4419 |
| 139 | Ga0105248_10001549 | 3300009177 | Bacteria | 25595 |
| 140 | Ga0105248_10004769 | 3300009177 | Bacteria | 15006 |
| 141 | Ga0105248_10032765 | 3300009177 | Bacteria | 5805 |
| 142 | Ga0105248_10108689 | 3300009177 | Bacteria | 3127 |
| 143 | Ga0105248_10119433 | 3300009177 | Bacteria | 2973 |
| 144 | Ga0105248_10308262 | 3300009177 | Bacteria | 1783 |
| 145 | Ga0105248_10839608 | 3300009177 | Bacteria | 1037 |
| 146 | Ga0105237_10001830 | 3300009545 | Bacteria | 27399 |
| 147 | Ga0105237_10097030 | 3300009545 | Bacteria | 2938 |
| 148 | Ga0105237_10445348 | 3300009545 | Bacteria | 1301 |
| 149 | Ga0105238_10002145 | 3300009551 | Bacteria | 19942 |
| 150 | Ga0105238_10004627 | 3300009551 | Bacteria | 13627 |
| 151 | Ga0105238_10009579 | 3300009551 | Bacteria | 9691 |
| 152 | Ga0105238_10014419 | 3300009551 | Bacteria | 7989 |
| 153 | Ga0105238_10053031 | 3300009551 | Bacteria | 4076 |
| 154 | Ga0105238_10094688 | 3300009551 | Bacteria | 2974 |
| 155 | Ga0105238_10196658 | 3300009551 | Bacteria | 1992 |
| 156 | Ga0105238_10409799 | 3300009551 | Bacteria | 1349 |
| 157 | Ga0105238_10489522 | 3300009551 | Unclassified | 1230 |
| 158 | Ga0105239_10003190 | 3300010375 | Bacteria | 20298 |
| 159 | Ga0105239_10030067 | 3300010375 | Bacteria | 5974 |
| 160 | Ga0105239_10054980 | 3300010375 | Bacteria | 4366 |
| 161 | Ga0105239_10069944 | 3300010375 | Bacteria | 3855 |
| 162 | Ga0105239_10292327 | 3300010375 | Bacteria | 1835 |
| 163 | Ga0105246_10009119 | 3300011119 | Bacteria | 6109 |
| 164 | Ga0157370_10001044 | 3300013104 | Bacteria | 34837 |
| 165 | Ga0157370_10073074 | 3300013104 | Bacteria | 3236 |
| 166 | Ga0157369_10000182 | 3300013105 | Bacteria | 87266 |
| 167 | Ga0157369_10000309 | 3300013105 | Bacteria | 65396 |
| 168 | Ga0157369_10001053 | 3300013105 | Bacteria | 34829 |
| 169 | Ga0157369_10006652 | 3300013105 | Bacteria | 13357 |
| 170 | Ga0157369_10013201 | 3300013105 | Bacteria | 9350 |
| 171 | Ga0157369_10037774 | 3300013105 | Bacteria | 5286 |
| 172 | Ga0157369_10078882 | 3300013105 | Bacteria | 3527 |
| 173 | Ga0157374_10013124 | 3300013296 | Bacteria | 7226 |
| 174 | Ga0157374_10023455 | 3300013296 | Bacteria | 5519 |
| 175 | Ga0157374_10070034 | 3300013296 | Bacteria | 3304 |
| 176 | Ga0157374_10080117 | 3300013296 | Bacteria | 3096 |
| 177 | Ga0157378_10000080 | 3300013297 | Bacteria | 88903 |
| 178 | Ga0157378_10005574 | 3300013297 | Bacteria | 11019 |
| 179 | Ga0157378_10040291 | 3300013297 | Unclassified | 4141 |
| 180 | Ga0157378_10050323 | 3300013297 | Bacteria | 3708 |
| 181 | Ga0163162_10007164 | 3300013306 | Bacteria | 10827 |
| 182 | Ga0163162_10068594 | 3300013306 | Bacteria | 3598 |
| 183 | Ga0163162_10101829 | 3300013306 | Bacteria | 2965 |
| 184 | Ga0157372_10000768 | 3300013307 | Bacteria | 34833 |
| 185 | Ga0157372_10001317 | 3300013307 | Bacteria | 26883 |
| 186 | Ga0157372_10023937 | 3300013307 | Bacteria | 6627 |
| 187 | Ga0157372_10028704 | 3300013307 | Bacteria | 6074 |
| 188 | Ga0157372_10042036 | 3300013307 | Bacteria | 5054 |
| 189 | Ga0157372_10106201 | 3300013307 | Bacteria | 3212 |
| 190 | Ga0157372_10138745 | 3300013307 | Unclassified | 2800 |
| 191 | Ga0157372_10265175 | 3300013307 | Bacteria | 1994 |
| 192 | Ga0157372_10474828 | 3300013307 | Bacteria | 1458 |
| 193 | Ga0157375_10001385 | 3300013308 | Bacteria | 20924 |
| 194 | Ga0157375_10488144 | 3300013308 | Bacteria | 1396 |
| 195 | Ga0163163_10001619 | 3300014325 | Bacteria | 18937 |
| 196 | Ga0163163_10057250 | 3300014325 | Bacteria | 3853 |
| 197 | Ga0163163_10292130 | 3300014325 | Bacteria | 1682 |
| 198 | Ga0157379_10003945 | 3300014968 | Bacteria | 12651 |
| 199 | Ga0157379_10370259 | 3300014968 | Bacteria | 1314 |
| 200 | Ga0157376_10000060 | 3300014969 | Bacteria | 95745 |
| 201 | Ga0157376_10002245 | 3300014969 | Bacteria | 13027 |
| 202 | Ga0157376_10040741 | 3300014969 | Bacteria | 3798 |
| 203 | Ga0157376_10281361 | 3300014969 | Bacteria | 1567 |
| 204 | Ga0163161_10471983 | 3300017792 | Bacteria | 1017 |
| 205 | Ga0213872_10001956 | 3300021361 | Bacteria | 12567 |
| 206 | Ga0213874_10072254 | 3300021377 | Bacteria | 1103 |
| 207 | Ga0213876_10222069 | 3300021384 | Bacteria | 1004 |
| 208 | Ga0213875_10000005 | 3300021388 | Bacteria | 595146 |
| 209 | Ga0209233_1005731 | 3300025261 | Bacteria | 4095 |
| 210 | Ga0207656_10018024 | 3300025321 | Bacteria | 2774 |
| 211 | Ga0207710_10000905 | 3300025900 | Bacteria | 15868 |
| 212 | Ga0207647_10019216 | 3300025904 | Bacteria | 4600 |
| 213 | Ga0207699_10000036 | 3300025906 | Bacteria | 129236 |
| 214 | Ga0207699_10007094 | 3300025906 | Bacteria | 5462 |
| 215 | Ga0207654_10000019 | 3300025911 | Bacteria | 171031 |
| 216 | Ga0207654_10000334 | 3300025911 | Bacteria | 28260 |
| 217 | Ga0207654_10000384 | 3300025911 | Bacteria | 25716 |
| 218 | Ga0207707_10038066 | 3300025912 | Bacteria | 4203 |
| 219 | Ga0207695_10000002 | 3300025913 | Bacteria | 2188391 |
| 220 | Ga0207695_10000188 | 3300025913 | Bacteria | 178721 |
| 221 | Ga0207695_10000332 | 3300025913 | Bacteria | 112161 |
| 222 | Ga0207695_10000989 | 3300025913 | Bacteria | 50393 |
| 223 | Ga0207695_10001708 | 3300025913 | Bacteria | 35163 |
| 224 | Ga0207695_10023237 | 3300025913 | Bacteria | 7013 |
| 225 | Ga0207695_10027992 | 3300025913 | Bacteria | 6263 |
| 226 | Ga0207695_10204456 | 3300025913 | Bacteria | 1888 |
| 227 | Ga0207695_10245338 | 3300025913 | Bacteria | 1691 |
| 228 | Ga0207671_10000449 | 3300025914 | Bacteria | 56932 |
| 229 | Ga0207671_10000506 | 3300025914 | Bacteria | 52834 |
| 230 | Ga0207671_10101972 | 3300025914 | Bacteria | 2175 |
| 231 | Ga0207671_10330775 | 3300025914 | Bacteria | 1206 |
| 232 | Ga0207660_10563898 | 3300025917 | Bacteria | 927 |
| 233 | Ga0207649_10002605 | 3300025920 | Bacteria | 10014 |
| 234 | Ga0207649_10020982 | 3300025920 | Bacteria | 3753 |
| 235 | Ga0207652_10014880 | 3300025921 | Bacteria | 6308 |
| 236 | Ga0207652_10381294 | 3300025921 | Bacteria | 1272 |
| 237 | Ga0207694_10000076 | 3300025924 | Bacteria | 113436 |
| 238 | Ga0207694_10000102 | 3300025924 | Bacteria | 94003 |
| 239 | Ga0207694_10002367 | 3300025924 | Bacteria | 15419 |
| 240 | Ga0207694_10008422 | 3300025924 | Bacteria | 7783 |
| 241 | Ga0207694_10040882 | 3300025924 | Bacteria | 3572 |
| 242 | Ga0207694_10442091 | 3300025924 | Bacteria | 1085 |
| 243 | Ga0207650_10004058 | 3300025925 | Bacteria | 10010 |
| 244 | Ga0207650_10205859 | 3300025925 | Bacteria | 1578 |
| 245 | Ga0207687_10009056 | 3300025927 | Bacteria | 6508 |
| 246 | Ga0207687_10082799 | 3300025927 | Bacteria | 2322 |
| 247 | Ga0207687_10292001 | 3300025927 | Bacteria | 1310 |
| 248 | Ga0207700_10204949 | 3300025928 | Bacteria | 1664 |
| 249 | Ga0207664_10022722 | 3300025929 | Bacteria | 4688 |
| 250 | Ga0207664_10153069 | 3300025929 | Bacteria | 1960 |
| 251 | Ga0207664_10184798 | 3300025929 | Unclassified | 1791 |
| 252 | Ga0207664_10285424 | 3300025929 | Bacteria | 1449 |
| 253 | Ga0207664_10618283 | 3300025929 | Bacteria | 973 |
| 254 | Ga0207644_10044485 | 3300025931 | Bacteria | 3154 |
| 255 | Ga0207644_10448290 | 3300025931 | Bacteria | 1060 |
| 256 | Ga0207706_10044673 | 3300025933 | Bacteria | 3927 |
| 257 | Ga0207665_10011705 | 3300025939 | Bacteria | 5764 |
| 258 | Ga0207665_10215010 | 3300025939 | Bacteria | 1406 |
| 259 | Ga0207665_10441451 | 3300025939 | Bacteria | 997 |
| 260 | Ga0207711_10003748 | 3300025941 | Bacteria | 13098 |
| 261 | Ga0207711_10285874 | 3300025941 | Bacteria | 1519 |
| 262 | Ga0207689_10000954 | 3300025942 | Bacteria | 27817 |
| 263 | Ga0207689_10070351 | 3300025942 | Bacteria | 2874 |
| 264 | Ga0207661_10010552 | 3300025944 | Bacteria | 6654 |
| 265 | Ga0207661_10018981 | 3300025944 | Bacteria | 5117 |
| 266 | Ga0207661_10156826 | 3300025944 | Bacteria | 1972 |
| 267 | Ga0207679_10217170 | 3300025945 | Bacteria | 1607 |
| 268 | Ga0207679_10229982 | 3300025945 | Bacteria | 1565 |
| 269 | Ga0207679_10734431 | 3300025945 | Bacteria | 897 |
| 270 | Ga0207667_10000442 | 3300025949 | Bacteria | 55598 |
| 271 | Ga0207667_10010139 | 3300025949 | Bacteria | 11033 |
| 272 | Ga0207667_10011777 | 3300025949 | Bacteria | 10134 |
| 273 | Ga0207667_10067914 | 3300025949 | Bacteria | 3713 |
| 274 | Ga0207667_10122829 | 3300025949 | Bacteria | 2675 |
| 275 | Ga0207640_10024932 | 3300025981 | Bacteria | 3614 |
| 276 | Ga0207640_10335944 | 3300025981 | Bacteria | 1208 |
| 277 | Ga0207658_10001428 | 3300025986 | Bacteria | 18626 |
| 278 | Ga0207658_10299481 | 3300025986 | Bacteria | 1385 |
| 279 | Ga0207677_10000337 | 3300026023 | Bacteria | 33617 |
| 280 | Ga0207677_10044663 | 3300026023 | Bacteria | 2954 |
| 281 | Ga0207703_10006388 | 3300026035 | Bacteria | 9423 |
| 282 | Ga0207703_10236101 | 3300026035 | Unclassified | 1641 |
| 283 | Ga0207639_10000027 | 3300026041 | Bacteria | 197829 |
| 284 | Ga0207639_10014559 | 3300026041 | Bacteria | 5537 |
| 285 | Ga0207639_10392540 | 3300026041 | Bacteria | 1248 |
| 286 | Ga0207678_10030501 | 3300026067 | Bacteria | 4707 |
| 287 | Ga0207678_10077196 | 3300026067 | Bacteria | 2853 |
| 288 | Ga0207678_10097586 | 3300026067 | Bacteria | 2511 |
| 289 | Ga0207678_10111535 | 3300026067 | Bacteria | 2333 |
| 290 | Ga0207678_10432370 | 3300026067 | Bacteria | 1142 |
| 291 | Ga0207702_10000307 | 3300026078 | Bacteria | 55978 |
| 292 | Ga0207702_10000415 | 3300026078 | Bacteria | 48713 |
| 293 | Ga0207702_10001959 | 3300026078 | Bacteria | 20036 |
| 294 | Ga0207702_10021160 | 3300026078 | Bacteria | 5383 |
| 295 | Ga0207702_10066098 | 3300026078 | Bacteria | 3098 |
| 296 | Ga0207702_10249222 | 3300026078 | Bacteria | 1667 |
| 297 | Ga0207641_10001797 | 3300026088 | Bacteria | 20623 |
| 298 | Ga0207676_10006773 | 3300026095 | Bacteria | 8110 |
| 299 | Ga0207674_10001941 | 3300026116 | Bacteria | 26256 |
| 300 | Ga0207674_10002941 | 3300026116 | Bacteria | 21168 |
| 301 | Ga0207674_10005215 | 3300026116 | Bacteria | 15469 |
| 302 | Ga0207674_10121498 | 3300026116 | Bacteria | 2579 |
| 303 | Ga0207674_10361781 | 3300026116 | Bacteria | 1402 |
| 304 | Ga0207698_10000227 | 3300026142 | Bacteria | 35110 |
| 305 | Ga0207698_10004352 | 3300026142 | Bacteria | 8626 |
| 306 | Ga0207698_10039372 | 3300026142 | Bacteria | 3502 |
| 307 | Ga0207698_10051416 | 3300026142 | Bacteria | 3150 |
| 308 | Ga0207698_10292019 | 3300026142 | Bacteria | 1513 |
| 309 | Ga0268266_10000529 | 3300028379 | Bacteria | 53323 |
| 310 | Ga0268266_10000895 | 3300028379 | Bacteria | 38492 |
| 311 | Ga0268266_10001822 | 3300028379 | Bacteria | 24095 |
| 312 | Ga0268266_10010914 | 3300028379 | Bacteria | 7908 |
| 313 | Ga0268266_10203781 | 3300028379 | Bacteria | 1811 |
| 314 | Ga0268266_10693132 | 3300028379 | Bacteria | 981 |
| 315 | Ga0268264_10000765 | 3300028381 | Bacteria | 35738 |
| 316 | Ga0268264_10010808 | 3300028381 | Bacteria | 7541 |
| 317 | Ga0265338_10002893 | 3300028800 | Bacteria | 25011 |
| 318 | Ga0265338_10135720 | 3300028800 | Bacteria | 1935 |
| 319 | Ga0265770_1001113 | 3300030878 | Bacteria | 3705 |
| 320 | Ga0265339_10062370 | 3300031249 | Bacteria | 2004 |
| 321 | Ga0307408_100329055 | 3300031548 | Unclassified | 1290 |
| 322 | Ga0265313_10094950 | 3300031595 | Bacteria | 1331 |
| 323 | Ga0265342_10107156 | 3300031712 | Bacteria | 1585 |
| 324 | Ga0307416_100312480 | 3300032002 | Bacteria | 1569 |
| 325 | Ga0373937_0002940 | 3300036401 | Bacteria | 14257 |
| 326 | Ga0373937_0803673 | 3300036401 | Bacteria | 888 |
| 327 | Ga0395900_0260600 | 3300037418 | Bacteria | 1732 |
| 328 | Ga0436364_0080170 | 3300037853 | Bacteria | 70161 |
| 329 | Ga0436364_0496001 | 3300037853 | Bacteria | 4608 |
| 330 | Ga0436365_0120080 | 3300039437 | Unclassified | 995 |
| 331 | Ga0436365_1065302 | 3300039437 | Bacteria | 17671 |
| 332 | Ga0436360_0512858 | 3300039438 | Bacteria | 1819 |
| 333 | Ga0436360_0925333 | 3300039438 | Bacteria | 1114 |
| 334 | Ga0436361_0237725 | 3300039447 | Bacteria | 20036 |
| 335 | Ga0436361_0623560 | 3300039447 | Bacteria | 4250 |
| 336 | Ga0453683_0001178 | 3300044673 | Bacteria | 23602 |
| 337 | Ga0451576_0122622 | 3300045051 | Bacteria | 2706 |
| 338 | Ga0466958_0044425 | 3300045836 | Bacteria | 2678 |
| 339 | Ga0466958_0319265 | 3300045836 | Bacteria | 998 |
| 340 | Ga0466958_0378862 | 3300045836 | Unclassified | 912 |
| 341 | Ga0466967_0046694 | 3300045976 | Bacteria | 3772 |
| 342 | Ga0466967_0187183 | 3300045976 | Bacteria | 1955 |
| 343 | Ga0495629_0013781 | 3300046459 | Bacteria | 5834 |
| 344 | Ga0495651_0006029 | 3300046462 | Bacteria | 9254 |
| 345 | Ga0495651_0077961 | 3300046462 | Bacteria | 2507 |
| 346 | Ga0495650_0000010 | 3300046471 | Bacteria | 645599 |
| 347 | Ga0495650_0005707 | 3300046471 | Bacteria | 7972 |
| 348 | Ga0495580_0044998 | 3300046472 | Bacteria | 3137 |
| 349 | Ga0495582_0003834 | 3300046473 | Bacteria | 8468 |
| 350 | Ga0495582_0303048 | 3300046473 | Bacteria | 919 |
| 351 | Ga0495639_0197926 | 3300046475 | Bacteria | 983 |
| 352 | Ga0495662_0003951 | 3300046476 | Bacteria | 7475 |
| 353 | Ga0495664_0043167 | 3300046477 | Bacteria | 2671 |
| 354 | Ga0495664_0091258 | 3300046477 | Bacteria | 1831 |
| 355 | Ga0495585_0035704 | 3300046492 | Bacteria | 2808 |
| 356 | Ga0495594_0002915 | 3300046499 | Bacteria | 8895 |
| 357 | Ga0495594_0007367 | 3300046499 | Bacteria | 5659 |
| 358 | Ga0495594_0141726 | 3300046499 | Bacteria | 1364 |
| 359 | Ga0495606_0041436 | 3300046507 | Bacteria | 3088 |
| 360 | Ga0495606_0228697 | 3300046507 | Bacteria | 1044 |
| 361 | Ga0495630_0154509 | 3300046517 | Bacteria | 1747 |
| 362 | Ga0495631_0069328 | 3300046518 | Bacteria | 1525 |
| 363 | Ga0495644_0004869 | 3300046523 | Bacteria | 5271 |
| 364 | Ga0495648_0086813 | 3300046524 | Bacteria | 1764 |
| 365 | Ga0495666_0012892 | 3300046526 | Bacteria | 4166 |
| 366 | Ga0495642_0014636 | 3300046528 | Bacteria | 3041 |
| 367 | Ga0495652_0240768 | 3300046529 | Bacteria | 1346 |
| 368 | Ga0495665_0002480 | 3300046531 | Bacteria | 9972 |
| 369 | Ga0495640_0012769 | 3300046533 | Bacteria | 6411 |
| 370 | Ga0495586_0002812 | 3300046535 | Bacteria | 9398 |
| 371 | Ga0495645_0013453 | 3300046543 | Bacteria | 5786 |
| 372 | Ga0495667_0007815 | 3300046559 | Bacteria | 7245 |
| 373 | Ga0495668_0091757 | 3300046616 | Bacteria | 1664 |
| 374 | Ga0495634_0005777 | 3300046642 | Bacteria | 9451 |
| 375 | Ga0495625_0000796 | 3300046660 | Bacteria | 43709 |
| 376 | Ga0495625_0014897 | 3300046660 | Bacteria | 6183 |
| 377 | Ga0495625_0205256 | 3300046660 | Bacteria | 1298 |
| 378 | Ga0495635_0014265 | 3300046663 | Bacteria | 5561 |
| 379 | Ga0495635_0202301 | 3300046663 | Bacteria | 1347 |
| 380 | Ga0495661_0064187 | 3300046665 | Bacteria | 2168 |
| 381 | Ga0495623_0148011 | 3300046679 | Bacteria | 1391 |
| 382 | Ga0495623_0215379 | 3300046679 | Bacteria | 1097 |
| 383 | Ga0495646_0002085 | 3300046680 | Bacteria | 12119 |
| 384 | Ga0495647_0075777 | 3300046681 | Bacteria | 1355 |
| 385 | Ga0495658_0153283 | 3300046683 | Bacteria | 1417 |
| 386 | Ga0495669_0010506 | 3300046684 | Bacteria | 3912 |
| 387 | Ga0495669_0078084 | 3300046684 | Bacteria | 1517 |
| 388 | Ga0495613_0006321 | 3300046689 | Bacteria | 8858 |
| 389 | Ga0495600_0011002 | 3300046809 | Bacteria | 5629 |
| 390 | Ga0495581_0018953 | 3300047315 | Bacteria | 3993 |
| 391 | Ga0495604_0079233 | 3300047317 | Bacteria | 2464 |
| 392 | Ga0495604_0149569 | 3300047317 | Bacteria | 1660 |
| 393 | Ga0495636_0172295 | 3300047318 | Bacteria | 979 |
| 394 | Ga0495674_0042682 | 3300047319 | Bacteria | 4043 |
| 395 | Ga0495674_0099394 | 3300047319 | Bacteria | 2477 |
| 396 | Ga0495672_0028315 | 3300047320 | Bacteria | 3547 |
| 397 | Ga0495676_0002278 | 3300047321 | Bacteria | 17036 |
| 398 | Ga0495680_0024070 | 3300047322 | Bacteria | 5056 |
| 399 | Ga0495675_0014850 | 3300047444 | Bacteria | 4924 |
| 400 | Ga0495673_0052751 | 3300047469 | Bacteria | 1776 |
| 401 | Ga0495684_0179660 | 3300047471 | Bacteria | 1569 |
| 402 | Ga0495686_0005986 | 3300047472 | Bacteria | 9464 |
| 403 | Ga0495686_0030521 | 3300047472 | Bacteria | 3500 |
| 404 | Ga0495614_0000696 | 3300048089 | Bacteria | 14121 |
| 405 | Ga0496102_0009812 | 3300048905 | Bacteria | 8232 |
| 406 | Ga0496102_0265270 | 3300048905 | Bacteria | 1619 |
| 407 | Ga0496104_0003612 | 3300048907 | Bacteria | 13359 |
| 408 | Ga0496104_0054630 | 3300048907 | Bacteria | 3775 |
| 409 | Ga0496104_0097222 | 3300048907 | Bacteria | 2818 |
| 410 | Ga0496104_0152528 | 3300048907 | Bacteria | 2217 |
| 411 | Ga0496104_0240603 | 3300048907 | Bacteria | 1722 |
| 412 | Ga0496104_0286653 | 3300048907 | Bacteria | 1559 |
| 413 | Ga0496104_0315761 | 3300048907 | Unclassified | 1476 |
| 414 | Ga0496109_0078235 | 3300048912 | Bacteria | 3045 |
| 415 | Ga0496109_0220546 | 3300048912 | Bacteria | 1783 |
| 416 | Ga0496109_0318859 | 3300048912 | Bacteria | 1467 |
| 417 | Ga0496110_0312502 | 3300048913 | Bacteria | 1431 |
| 418 | Ga0496111_0137744 | 3300048914 | Bacteria | 1809 |
| 419 | Ga0496112_0000022 | 3300048915 | Bacteria | 156255 |
| 420 | Ga0496112_0157395 | 3300048915 | Bacteria | 2239 |
| 421 | Ga0496112_0179426 | 3300048915 | Bacteria | 2081 |
| 422 | Ga0496112_0243201 | 3300048915 | Bacteria | 1752 |
| 423 | Ga0496112_0449735 | 3300048915 | Bacteria | 1226 |
| 424 | Ga0496113_0065399 | 3300048916 | Bacteria | 2752 |
| 425 | Ga0496114_0051613 | 3300048917 | Bacteria | 3424 |
| 426 | Ga0496115_0072991 | 3300048918 | Bacteria | 2785 |
| 427 | Ga0496115_0183955 | 3300048918 | Bacteria | 1727 |
| 428 | Ga0496115_0366589 | 3300048918 | Bacteria | 1173 |
| 429 | Ga0496126_0002036 | 3300048929 | Bacteria | 28475 |
| 430 | Ga0496126_0006120 | 3300048929 | Bacteria | 13496 |
| 431 | Ga0496126_0030729 | 3300048929 | Bacteria | 5086 |
| 432 | Ga0496126_0118011 | 3300048929 | Bacteria | 2304 |
| 433 | Ga0501031_0071799 | 3300049568 | Bacteria | 2254 |
| 434 | Ga0501032_0003687 | 3300049569 | Bacteria | 11634 |
| 435 | Ga0501033_0020581 | 3300049570 | Bacteria | 4985 |
| 436 | Ga0501034_0299663 | 3300049571 | Bacteria | 1544 |
| 437 | Ga0501036_0001302 | 3300049572 | Bacteria | 19115 |
| 438 | Ga0501037_0011654 | 3300049573 | Bacteria | 6473 |
| 439 | Ga0501038_0002468 | 3300049574 | Bacteria | 17200 |
| 440 | Ga0501043_0040827 | 3300049579 | Bacteria | 3646 |
| 441 | Ga0501046_0001610 | 3300049580 | Bacteria | 21590 |
| 442 | Ga0501047_0010938 | 3300049581 | Bacteria | 8585 |
| 443 | Ga0501048_0289243 | 3300049582 | Bacteria | 1165 |
| 444 | Ga0501068_0101568 | 3300049584 | Bacteria | 1783 |
| 445 | Ga0501073_0001768 | 3300049589 | Bacteria | 16069 |
| 446 | Ga0501035_0006048 | 3300049822 | Bacteria | 11397 |
| 447 | Ga0501044_0002842 | 3300049823 | Bacteria | 19709 |
| 448 | Ga0501044_0123765 | 3300049823 | Bacteria | 2584 |
| 449 | nmdc:mga05p37_154354_c1 | 3300050507 | Bacteria | 2806 |
| 450 | nmdc:mga08y16_67217_c1 | 3300050511 | Bacteria | 3739 |
| 451 | nmdc:mga0n895_15354_c1 | 3300050512 | Bacteria | 6980 |
| 452 | nmdc:mga0n895_182808_c1 | 3300050512 | Bacteria | 2128 |
| 453 | nmdc:mga0n895_21254_c1 | 3300050512 | Bacteria | 6064 |
| 454 | nmdc:mga0n895_357913_c1 | 3300050512 | Bacteria | 1478 |
| 455 | nmdc:mga0rr50_339657_c1 | 3300050513 | Bacteria | 1262 |
| 456 | nmdc:mga08x19_3532_c1 | 3300050514 | Bacteria | 9298 |
| 457 | nmdc:mga08x19_8576_c1 | 3300050514 | Bacteria | 6091 |
| 458 | nmdc:mga0a205_15421_c1 | 3300050515 | Bacteria | 7141 |
| 459 | Ga0495601_0144803 | 3300053077 | Bacteria | 1551 |
| 460 | Ga0500651_0000129 | 3300053093 | Bacteria | 46606 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025939 | Ga0207665_10215010 | Ga0207665_102150102 | 215 |
| 2 | 3300048915 | Ga0496112_0000022 | Ga0496112_0000022_4808_5578 | 219 |
| 3 | 3300005459 | Ga0068867_100115804 | Ga0068867_1001158042 | 231 |
| 4 | 3300005578 | Ga0068854_100328044 | Ga0068854_1003280442 | 231 |
| 5 | 3300009177 | Ga0105248_10108689 | Ga0105248_101086893 | 231 |
| 6 | 3300014969 | Ga0157376_10281361 | Ga0157376_102813612 | 231 |
| 7 | 3300025981 | Ga0207640_10335944 | Ga0207640_103359442 | 231 |
| 8 | 3300048912 | Ga0496109_0220546 | Ga0496109_0220546_14_715 | 232 |
| 9 | 3300007788 | Ga0099795_10050119 | Ga0099795_100501192 | 236 |
| 10 | 3300045836 | Ga0466958_0319265 | Ga0466958_0319265_139_909 | 236 |
| 11 | 3300048907 | Ga0496104_0054630 | Ga0496104_0054630_1336_2166 | 236 |
| 12 | 3300050512 | nmdc:mga0n895_182808_c1 | nmdc:mga0n895_182808_c1_832_1701 | 236 |
| 13 | 3300050512 | nmdc:mga0n895_357913_c1 | nmdc:mga0n895_357913_c1_567_1277 | 236 |
| 14 | 3300025906 | Ga0207699_10007094 | Ga0207699_100070945 | 237 |
| 15 | 3300049568 | Ga0501031_0071799 | Ga0501031_0071799_539_1294 | 240 |
| 16 | 3300049569 | Ga0501032_0003687 | Ga0501032_0003687_1768_2523 | 240 |
| 17 | 3300049570 | Ga0501033_0020581 | Ga0501033_0020581_4042_4797 | 240 |
| 18 | 3300049571 | Ga0501034_0299663 | Ga0501034_0299663_575_1330 | 240 |
| 19 | 3300049572 | Ga0501036_0001302 | Ga0501036_0001302_10688_11443 | 240 |
| 20 | 3300049573 | Ga0501037_0011654 | Ga0501037_0011654_5170_5925 | 240 |
| 21 | 3300049574 | Ga0501038_0002468 | Ga0501038_0002468_15945_16700 | 240 |
| 22 | 3300049579 | Ga0501043_0040827 | Ga0501043_0040827_1751_2506 | 240 |
| 23 | 3300049580 | Ga0501046_0001610 | Ga0501046_0001610_2058_2813 | 240 |
| 24 | 3300049581 | Ga0501047_0010938 | Ga0501047_0010938_2651_3406 | 240 |
| 25 | 3300049582 | Ga0501048_0289243 | Ga0501048_0289243_61_816 | 240 |
| 26 | 3300049584 | Ga0501068_0101568 | Ga0501068_0101568_617_1372 | 240 |
| 27 | 3300049589 | Ga0501073_0001768 | Ga0501073_0001768_1088_1843 | 240 |
| 28 | 3300049822 | Ga0501035_0006048 | Ga0501035_0006048_5584_6339 | 240 |
| 29 | 3300049823 | Ga0501044_0002842 | Ga0501044_0002842_14911_15666 | 240 |
| 30 | 3300049823 | Ga0501044_0123765 | Ga0501044_0123765_1747_2502 | 240 |
| 31 | 3300014325 | Ga0163163_10057250 | Ga0163163_100572504 | 243 |
| 32 | 3300005334 | Ga0068869_100032738 | Ga0068869_1000327383 | 244 |
| 33 | 3300006173 | Ga0070716_100092825 | Ga0070716_1000928251 | 244 |
| 34 | 3300025942 | Ga0207689_10070351 | Ga0207689_100703513 | 244 |
| 35 | 3300032002 | Ga0307416_100312480 | Ga0307416_1003124802 | 246 |
| 36 | 3300048929 | Ga0496126_0118011 | Ga0496126_0118011_107_883 | 246 |
| 37 | 3300003322 | rootL2_10177401 | rootL2_101774012 | 247 |
| 38 | iso_pu_bacteria | 2884215851 | 2884217301 | 247 |
| 39 | 3300006852 | Ga0075433_10131169 | Ga0075433_101311694 | 248 |
| 40 | 3300007076 | Ga0075435_100138257 | Ga0075435_1001382571 | 248 |
| 41 | 3300026067 | Ga0207678_10030501 | Ga0207678_100305012 | 248 |
| 42 | 3300037853 | Ga0436364_0496001 | Ga0436364_0496001_287_1069 | 248 |
| 43 | 3300045051 | Ga0451576_0122622 | Ga0451576_0122622_1635_2435 | 248 |
| 44 | 3300050515 | nmdc:mga0a205_15421_c1 | nmdc:mga0a205_15421_c1_4542_5342 | 248 |
| 45 | 3300005337 | Ga0070682_100257977 | Ga0070682_1002579771 | 249 |
| 46 | 3300009177 | Ga0105248_10839608 | Ga0105248_108396081 | 249 |
| 47 | 3300026067 | Ga0207678_10097586 | Ga0207678_100975861 | 249 |
| 48 | 3300005841 | Ga0068863_100009508 | Ga0068863_1000095085 | 250 |
| 49 | 3300009177 | Ga0105248_10032765 | Ga0105248_100327654 | 250 |
| 50 | 3300025925 | Ga0207650_10205859 | Ga0207650_102058592 | 250 |
| 51 | 3300046459 | Ga0495629_0013781 | Ga0495629_0013781_2327_3100 | 250 |
| 52 | 3300046462 | Ga0495651_0006029 | Ga0495651_0006029_407_1180 | 250 |
| 53 | 3300046471 | Ga0495650_0000010 | Ga0495650_0000010_149943_150695 | 250 |
| 54 | 3300046472 | Ga0495580_0044998 | Ga0495580_0044998_1822_2595 | 250 |
| 55 | 3300046473 | Ga0495582_0003834 | Ga0495582_0003834_4118_4891 | 250 |
| 56 | 3300046475 | Ga0495639_0197926 | Ga0495639_0197926_22_795 | 250 |
| 57 | 3300046476 | Ga0495662_0003951 | Ga0495662_0003951_2280_3053 | 250 |
| 58 | 3300046477 | Ga0495664_0043167 | Ga0495664_0043167_85_858 | 250 |
| 59 | 3300046492 | Ga0495585_0035704 | Ga0495585_0035704_356_1129 | 250 |
| 60 | 3300046499 | Ga0495594_0002915 | Ga0495594_0002915_2812_3585 | 250 |
| 61 | 3300046499 | Ga0495594_0007367 | Ga0495594_0007367_4520_5293 | 250 |
| 62 | 3300046507 | Ga0495606_0041436 | Ga0495606_0041436_1000_1773 | 250 |
| 63 | 3300046517 | Ga0495630_0154509 | Ga0495630_0154509_347_1120 | 250 |
| 64 | 3300046518 | Ga0495631_0069328 | Ga0495631_0069328_649_1422 | 250 |
| 65 | 3300046523 | Ga0495644_0004869 | Ga0495644_0004869_4217_4990 | 250 |
| 66 | 3300046526 | Ga0495666_0012892 | Ga0495666_0012892_224_997 | 250 |
| 67 | 3300046528 | Ga0495642_0014636 | Ga0495642_0014636_1336_2109 | 250 |
| 68 | 3300046529 | Ga0495652_0240768 | Ga0495652_0240768_192_965 | 250 |
| 69 | 3300046531 | Ga0495665_0002480 | Ga0495665_0002480_3837_4610 | 250 |
| 70 | 3300046533 | Ga0495640_0012769 | Ga0495640_0012769_5556_6329 | 250 |
| 71 | 3300046535 | Ga0495586_0002812 | Ga0495586_0002812_1435_2208 | 250 |
| 72 | 3300046559 | Ga0495667_0007815 | Ga0495667_0007815_3303_4076 | 250 |
| 73 | 3300046616 | Ga0495668_0091757 | Ga0495668_0091757_533_1306 | 250 |
| 74 | 3300046642 | Ga0495634_0005777 | Ga0495634_0005777_379_1152 | 250 |
| 75 | 3300046660 | Ga0495625_0014897 | Ga0495625_0014897_1472_2224 | 250 |
| 76 | 3300046660 | Ga0495625_0205256 | Ga0495625_0205256_30_803 | 250 |
| 77 | 3300046663 | Ga0495635_0014265 | Ga0495635_0014265_194_967 | 250 |
| 78 | 3300046665 | Ga0495661_0064187 | Ga0495661_0064187_1091_1843 | 250 |
| 79 | 3300046680 | Ga0495646_0002085 | Ga0495646_0002085_6635_7408 | 250 |
| 80 | 3300046681 | Ga0495647_0075777 | Ga0495647_0075777_358_1131 | 250 |
| 81 | 3300046683 | Ga0495658_0153283 | Ga0495658_0153283_565_1338 | 250 |
| 82 | 3300046684 | Ga0495669_0010506 | Ga0495669_0010506_2692_3465 | 250 |
| 83 | 3300046689 | Ga0495613_0006321 | Ga0495613_0006321_541_1314 | 250 |
| 84 | 3300046809 | Ga0495600_0011002 | Ga0495600_0011002_2089_2862 | 250 |
| 85 | 3300047315 | Ga0495581_0018953 | Ga0495581_0018953_367_1140 | 250 |
| 86 | 3300047317 | Ga0495604_0149569 | Ga0495604_0149569_665_1438 | 250 |
| 87 | 3300047318 | Ga0495636_0172295 | Ga0495636_0172295_117_890 | 250 |
| 88 | 3300047319 | Ga0495674_0042682 | Ga0495674_0042682_223_996 | 250 |
| 89 | 3300047321 | Ga0495676_0002278 | Ga0495676_0002278_15724_16497 | 250 |
| 90 | 3300047322 | Ga0495680_0024070 | Ga0495680_0024070_4130_4903 | 250 |
| 91 | 3300047444 | Ga0495675_0014850 | Ga0495675_0014850_223_996 | 250 |
| 92 | 3300047469 | Ga0495673_0052751 | Ga0495673_0052751_180_953 | 250 |
| 93 | 3300047471 | Ga0495684_0179660 | Ga0495684_0179660_366_1139 | 250 |
| 94 | 3300048089 | Ga0495614_0000696 | Ga0495614_0000696_7271_8044 | 250 |
| 95 | 3300048929 | Ga0496126_0002036 | Ga0496126_0002036_23556_24308 | 250 |
| 96 | 3300053093 | Ga0500651_0000129 | Ga0500651_0000129_16845_17597 | 250 |
| 97 | 3300005367 | Ga0070667_100345473 | Ga0070667_1003454732 | 251 |
| 98 | 3300005543 | Ga0070672_100435006 | Ga0070672_1004350062 | 251 |
| 99 | 3300005548 | Ga0070665_100121699 | Ga0070665_1001216991 | 251 |
| 100 | 3300009177 | Ga0105248_10308262 | Ga0105248_103082622 | 251 |
| 101 | 3300013306 | Ga0163162_10007164 | Ga0163162_100071644 | 251 |
| 102 | 3300025914 | Ga0207671_10101972 | Ga0207671_101019722 | 251 |
| 103 | 3300025941 | Ga0207711_10285874 | Ga0207711_102858742 | 251 |
| 104 | 3300025986 | Ga0207658_10299481 | Ga0207658_102994812 | 251 |
| 105 | 3300028379 | Ga0268266_10000895 | Ga0268266_100008957 | 251 |
| 106 | 3300028379 | Ga0268266_10001822 | Ga0268266_1000182223 | 251 |
| 107 | 3300028379 | Ga0268266_10693132 | Ga0268266_106931321 | 251 |
| 108 | 3300046462 | Ga0495651_0077961 | Ga0495651_0077961_1693_2448 | 251 |
| 109 | 3300046471 | Ga0495650_0005707 | Ga0495650_0005707_2467_3243 | 251 |
| 110 | 3300046477 | Ga0495664_0091258 | Ga0495664_0091258_671_1426 | 251 |
| 111 | 3300046507 | Ga0495606_0228697 | Ga0495606_0228697_75_848 | 251 |
| 112 | 3300046524 | Ga0495648_0086813 | Ga0495648_0086813_736_1509 | 251 |
| 113 | 3300046660 | Ga0495625_0000796 | Ga0495625_0000796_42230_43006 | 251 |
| 114 | 3300046663 | Ga0495635_0202301 | Ga0495635_0202301_218_973 | 251 |
| 115 | 3300046679 | Ga0495623_0148011 | Ga0495623_0148011_81_836 | 251 |
| 116 | 3300047317 | Ga0495604_0079233 | Ga0495604_0079233_994_1749 | 251 |
| 117 | 3300047319 | Ga0495674_0099394 | Ga0495674_0099394_266_1021 | 251 |
| 118 | 3300047320 | Ga0495672_0028315 | Ga0495672_0028315_408_1163 | 251 |
| 119 | 3300048907 | Ga0496104_0097222 | Ga0496104_0097222_894_1649 | 251 |
| 120 | 3300048918 | Ga0496115_0072991 | Ga0496115_0072991_505_1260 | 251 |
| 121 | 3300005354 | Ga0070675_100044413 | Ga0070675_1000444132 | 252 |
| 122 | 3300006028 | Ga0070717_10220542 | Ga0070717_102205421 | 252 |
| 123 | 3300009094 | Ga0111539_10016056 | Ga0111539_1001605610 | 252 |
| 124 | 3300030878 | Ga0265770_1001113 | Ga0265770_10011132 | 252 |
| 125 | 3300045836 | Ga0466958_0378862 | Ga0466958_0378862_74_832 | 252 |
| 126 | 3300045976 | Ga0466967_0187183 | Ga0466967_0187183_139_897 | 252 |
| 127 | 3300005329 | Ga0070683_100243372 | Ga0070683_1002433722 | 254 |
| 128 | 3300005338 | Ga0068868_100198273 | Ga0068868_1001982732 | 254 |
| 129 | 3300005436 | Ga0070713_100361187 | Ga0070713_1003611871 | 254 |
| 130 | 3300005458 | Ga0070681_10004083 | Ga0070681_100040832 | 254 |
| 131 | 3300005563 | Ga0068855_100001789 | Ga0068855_1000017892 | 254 |
| 132 | 3300005564 | Ga0070664_100092019 | Ga0070664_1000920192 | 254 |
| 133 | 3300005577 | Ga0068857_100011623 | Ga0068857_1000116232 | 254 |
| 134 | 3300005578 | Ga0068854_100136943 | Ga0068854_1001369432 | 254 |
| 135 | 3300005614 | Ga0068856_100261928 | Ga0068856_1002619282 | 254 |
| 136 | 3300005842 | Ga0068858_100240880 | Ga0068858_1002408802 | 254 |
| 137 | 3300006237 | Ga0097621_100061878 | Ga0097621_1000618782 | 254 |
| 138 | 3300006358 | Ga0068871_100001674 | Ga0068871_1000016742 | 254 |
| 139 | 3300009545 | Ga0105237_10097030 | Ga0105237_100970302 | 254 |
| 140 | 3300010375 | Ga0105239_10069944 | Ga0105239_100699443 | 254 |
| 141 | 3300013105 | Ga0157369_10000309 | Ga0157369_1000030961 | 254 |
| 142 | 3300013296 | Ga0157374_10070034 | Ga0157374_100700342 | 254 |
| 143 | 3300013297 | Ga0157378_10050323 | Ga0157378_100503233 | 254 |
| 144 | 3300013307 | Ga0157372_10001317 | Ga0157372_100013172 | 254 |
| 145 | 3300013308 | Ga0157375_10488144 | Ga0157375_104881442 | 254 |
| 146 | 3300025912 | Ga0207707_10038066 | Ga0207707_100380662 | 254 |
| 147 | 3300025928 | Ga0207700_10204949 | Ga0207700_102049492 | 254 |
| 148 | 3300025945 | Ga0207679_10217170 | Ga0207679_102171702 | 254 |
| 149 | 3300025949 | Ga0207667_10067914 | Ga0207667_100679143 | 254 |
| 150 | 3300025981 | Ga0207640_10024932 | Ga0207640_100249322 | 254 |
| 151 | 3300026023 | Ga0207677_10044663 | Ga0207677_100446631 | 254 |
| 152 | 3300026035 | Ga0207703_10236101 | Ga0207703_102361012 | 254 |
| 153 | 3300026078 | Ga0207702_10066098 | Ga0207702_100660982 | 254 |
| 154 | 3300026116 | Ga0207674_10005215 | Ga0207674_100052152 | 254 |
| 155 | 3300048907 | Ga0496104_0315761 | Ga0496104_0315761_174_977 | 254 |
| 156 | 3300048912 | Ga0496109_0318859 | Ga0496109_0318859_477_1280 | 254 |
| 157 | 3300048915 | Ga0496112_0157395 | Ga0496112_0157395_1036_1839 | 254 |
| 158 | 3300005841 | Ga0068863_100519209 | Ga0068863_1005192092 | 255 |
| 159 | 3300009177 | Ga0105248_10119433 | Ga0105248_101194332 | 255 |
| 160 | 3300014968 | Ga0157379_10370259 | Ga0157379_103702592 | 255 |
| 161 | 3300021384 | Ga0213876_10222069 | Ga0213876_102220691 | 255 |
| 162 | 3300031548 | Ga0307408_100329055 | Ga0307408_1003290552 | 255 |
| 163 | 3300039437 | Ga0436365_1065302 | Ga0436365_1065302_201_977 | 255 |
| 164 | 3300000546 | LJNas_1001068 | LJNas_10010683 | 256 |
| 165 | 3300005293 | Ga0065715_10182087 | Ga0065715_101820871 | 256 |
| 166 | 3300005329 | Ga0070683_100073239 | Ga0070683_1000732392 | 256 |
| 167 | 3300005329 | Ga0070683_100102370 | Ga0070683_1001023702 | 256 |
| 168 | 3300005329 | Ga0070683_100403897 | Ga0070683_1004038972 | 256 |
| 169 | 3300005331 | Ga0070670_100015491 | Ga0070670_1000154912 | 256 |
| 170 | 3300005334 | Ga0068869_100000075 | Ga0068869_10000007511 | 256 |
| 171 | 3300005338 | Ga0068868_100001557 | Ga0068868_10000155716 | 256 |
| 172 | 3300005338 | Ga0068868_100344322 | Ga0068868_1003443221 | 256 |
| 173 | 3300005344 | Ga0070661_100003311 | Ga0070661_1000033119 | 256 |
| 174 | 3300005344 | Ga0070661_100033503 | Ga0070661_1000335032 | 256 |
| 175 | 3300005344 | Ga0070661_100046043 | Ga0070661_1000460434 | 256 |
| 176 | 3300005356 | Ga0070674_100032198 | Ga0070674_1000321984 | 256 |
| 177 | 3300005367 | Ga0070667_100002745 | Ga0070667_10000274514 | 256 |
| 178 | 3300005434 | Ga0070709_10000025 | Ga0070709_1000002523 | 256 |
| 179 | 3300005434 | Ga0070709_10020681 | Ga0070709_100206814 | 256 |
| 180 | 3300005435 | Ga0070714_100025142 | Ga0070714_1000251422 | 256 |
| 181 | 3300005435 | Ga0070714_100068005 | Ga0070714_1000680053 | 256 |
| 182 | 3300005435 | Ga0070714_100241869 | Ga0070714_1002418693 | 256 |
| 183 | 3300005435 | Ga0070714_100253396 | Ga0070714_1002533961 | 256 |
| 184 | 3300005435 | Ga0070714_100384595 | Ga0070714_1003845952 | 256 |
| 185 | 3300005436 | Ga0070713_100026334 | Ga0070713_1000263344 | 256 |
| 186 | 3300005436 | Ga0070713_100328325 | Ga0070713_1003283251 | 256 |
| 187 | 3300005436 | Ga0070713_100670676 | Ga0070713_1006706761 | 256 |
| 188 | 3300005439 | Ga0070711_100188093 | Ga0070711_1001880933 | 256 |
| 189 | 3300005439 | Ga0070711_100264541 | Ga0070711_1002645411 | 256 |
| 190 | 3300005439 | Ga0070711_100477751 | Ga0070711_1004777511 | 256 |
| 191 | 3300005455 | Ga0070663_100041016 | Ga0070663_1000410161 | 256 |
| 192 | 3300005455 | Ga0070663_100052111 | Ga0070663_1000521113 | 256 |
| 193 | 3300005455 | Ga0070663_100086273 | Ga0070663_1000862732 | 256 |
| 194 | 3300005456 | Ga0070678_100116659 | Ga0070678_1001166592 | 256 |
| 195 | 3300005457 | Ga0070662_100133884 | Ga0070662_1001338842 | 256 |
| 196 | 3300005530 | Ga0070679_100011350 | Ga0070679_1000113504 | 256 |
| 197 | 3300005530 | Ga0070679_100263789 | Ga0070679_1002637891 | 256 |
| 198 | 3300005535 | Ga0070684_100000516 | Ga0070684_1000005169 | 256 |
| 199 | 3300005535 | Ga0070684_100046808 | Ga0070684_1000468085 | 256 |
| 200 | 3300005539 | Ga0068853_100000474 | Ga0068853_1000004747 | 256 |
| 201 | 3300005539 | Ga0068853_100002760 | Ga0068853_1000027604 | 256 |
| 202 | 3300005539 | Ga0068853_100589251 | Ga0068853_1005892512 | 256 |
| 203 | 3300005546 | Ga0070696_100073248 | Ga0070696_1000732483 | 256 |
| 204 | 3300005548 | Ga0070665_100001777 | Ga0070665_1000017778 | 256 |
| 205 | 3300005548 | Ga0070665_100012643 | Ga0070665_1000126434 | 256 |
| 206 | 3300005549 | Ga0070704_100012967 | Ga0070704_1000129674 | 256 |
| 207 | 3300005563 | Ga0068855_100002618 | Ga0068855_10000261817 | 256 |
| 208 | 3300005563 | Ga0068855_100003162 | Ga0068855_10000316215 | 256 |
| 209 | 3300005563 | Ga0068855_100132121 | Ga0068855_1001321214 | 256 |
| 210 | 3300005563 | Ga0068855_100476921 | Ga0068855_1004769212 | 256 |
| 211 | 3300005564 | Ga0070664_100607744 | Ga0070664_1006077442 | 256 |
| 212 | 3300005577 | Ga0068857_100007650 | Ga0068857_10000765010 | 256 |
| 213 | 3300005577 | Ga0068857_100019826 | Ga0068857_1000198265 | 256 |
| 214 | 3300005577 | Ga0068857_100022550 | Ga0068857_1000225503 | 256 |
| 215 | 3300005577 | Ga0068857_100450753 | Ga0068857_1004507531 | 256 |
| 216 | 3300005578 | Ga0068854_100049081 | Ga0068854_1000490812 | 256 |
| 217 | 3300005614 | Ga0068856_100001190 | Ga0068856_1000011908 | 256 |
| 218 | 3300005614 | Ga0068856_100002078 | Ga0068856_10000207820 | 256 |
| 219 | 3300005614 | Ga0068856_100006428 | Ga0068856_1000064285 | 256 |
| 220 | 3300005614 | Ga0068856_100007628 | Ga0068856_1000076289 | 256 |
| 221 | 3300005614 | Ga0068856_100016253 | Ga0068856_1000162538 | 256 |
| 222 | 3300005616 | Ga0068852_100000046 | Ga0068852_10000004657 | 256 |
| 223 | 3300005616 | Ga0068852_100000078 | Ga0068852_10000007846 | 256 |
| 224 | 3300005616 | Ga0068852_100083573 | Ga0068852_1000835733 | 256 |
| 225 | 3300005617 | Ga0068859_100020456 | Ga0068859_1000204568 | 256 |
| 226 | 3300005618 | Ga0068864_100002989 | Ga0068864_1000029895 | 256 |
| 227 | 3300005718 | Ga0068866_10022080 | Ga0068866_100220803 | 256 |
| 228 | 3300005834 | Ga0068851_10012742 | Ga0068851_100127421 | 256 |
| 229 | 3300005834 | Ga0068851_10020298 | Ga0068851_100202983 | 256 |
| 230 | 3300005834 | Ga0068851_10048202 | Ga0068851_100482022 | 256 |
| 231 | 3300005834 | Ga0068851_10048271 | Ga0068851_100482713 | 256 |
| 232 | 3300005841 | Ga0068863_100010964 | Ga0068863_10001096411 | 256 |
| 233 | 3300005842 | Ga0068858_100010050 | Ga0068858_1000100505 | 256 |
| 234 | 3300005843 | Ga0068860_100009498 | Ga0068860_1000094986 | 256 |
| 235 | 3300005843 | Ga0068860_100014067 | Ga0068860_1000140674 | 256 |
| 236 | 3300005844 | Ga0068862_100019940 | Ga0068862_1000199402 | 256 |
| 237 | 3300005983 | Ga0081540_1027891 | Ga0081540_10278913 | 256 |
| 238 | 3300006028 | Ga0070717_10042187 | Ga0070717_100421874 | 256 |
| 239 | 3300006028 | Ga0070717_10069048 | Ga0070717_100690482 | 256 |
| 240 | 3300006173 | Ga0070716_100049161 | Ga0070716_1000491613 | 256 |
| 241 | 3300006175 | Ga0070712_100376215 | Ga0070712_1003762152 | 256 |
| 242 | 3300006178 | Ga0075367_10217548 | Ga0075367_102175482 | 256 |
| 243 | 3300006237 | Ga0097621_100063183 | Ga0097621_1000631832 | 256 |
| 244 | 3300006237 | Ga0097621_100072019 | Ga0097621_1000720192 | 256 |
| 245 | 3300006237 | Ga0097621_100082669 | Ga0097621_1000826692 | 256 |
| 246 | 3300006358 | Ga0068871_100001065 | Ga0068871_1000010655 | 256 |
| 247 | 3300006358 | Ga0068871_100003942 | Ga0068871_10000394211 | 256 |
| 248 | 3300006852 | Ga0075433_10090932 | Ga0075433_100909322 | 256 |
| 249 | 3300006871 | Ga0075434_100013220 | Ga0075434_1000132206 | 256 |
| 250 | 3300006871 | Ga0075434_100713257 | Ga0075434_1007132571 | 256 |
| 251 | 3300006914 | Ga0075436_100012163 | Ga0075436_1000121637 | 256 |
| 252 | 3300006914 | Ga0075436_100022363 | Ga0075436_1000223634 | 256 |
| 253 | 3300006931 | Ga0097620_100020456 | Ga0097620_1000204562 | 256 |
| 254 | 3300007076 | Ga0075435_100012104 | Ga0075435_1000121047 | 256 |
| 255 | 3300009093 | Ga0105240_10000002 | Ga0105240_100000021260 | 256 |
| 256 | 3300009093 | Ga0105240_10000873 | Ga0105240_1000087345 | 256 |
| 257 | 3300009093 | Ga0105240_10001944 | Ga0105240_1000194413 | 256 |
| 258 | 3300009093 | Ga0105240_10022769 | Ga0105240_100227693 | 256 |
| 259 | 3300009093 | Ga0105240_10031415 | Ga0105240_100314153 | 256 |
| 260 | 3300009093 | Ga0105240_10036835 | Ga0105240_100368354 | 256 |
| 261 | 3300009093 | Ga0105240_10110891 | Ga0105240_101108913 | 256 |
| 262 | 3300009094 | Ga0111539_10044621 | Ga0111539_100446213 | 256 |
| 263 | 3300009098 | Ga0105245_10001560 | Ga0105245_1000156020 | 256 |
| 264 | 3300009098 | Ga0105245_10061799 | Ga0105245_100617993 | 256 |
| 265 | 3300009098 | Ga0105245_10070906 | Ga0105245_100709063 | 256 |
| 266 | 3300009101 | Ga0105247_10004000 | Ga0105247_1000400011 | 256 |
| 267 | 3300009147 | Ga0114129_10188048 | Ga0114129_101880482 | 256 |
| 268 | 3300009174 | Ga0105241_10000203 | Ga0105241_1000020322 | 256 |
| 269 | 3300009174 | Ga0105241_10001995 | Ga0105241_100019959 | 256 |
| 270 | 3300009174 | Ga0105241_10004226 | Ga0105241_100042264 | 256 |
| 271 | 3300009174 | Ga0105241_10021460 | Ga0105241_100214603 | 256 |
| 272 | 3300009174 | Ga0105241_10025216 | Ga0105241_100252163 | 256 |
| 273 | 3300009177 | Ga0105248_10001549 | Ga0105248_1000154913 | 256 |
| 274 | 3300009177 | Ga0105248_10004769 | Ga0105248_1000476916 | 256 |
| 275 | 3300009545 | Ga0105237_10001830 | Ga0105237_1000183020 | 256 |
| 276 | 3300009545 | Ga0105237_10445348 | Ga0105237_104453482 | 256 |
| 277 | 3300009551 | Ga0105238_10002145 | Ga0105238_1000214520 | 256 |
| 278 | 3300009551 | Ga0105238_10004627 | Ga0105238_100046275 | 256 |
| 279 | 3300009551 | Ga0105238_10009579 | Ga0105238_100095797 | 256 |
| 280 | 3300009551 | Ga0105238_10014419 | Ga0105238_100144193 | 256 |
| 281 | 3300009551 | Ga0105238_10053031 | Ga0105238_100530313 | 256 |
| 282 | 3300009551 | Ga0105238_10094688 | Ga0105238_100946882 | 256 |
| 283 | 3300009551 | Ga0105238_10196658 | Ga0105238_101966582 | 256 |
| 284 | 3300009551 | Ga0105238_10409799 | Ga0105238_104097992 | 256 |
| 285 | 3300009551 | Ga0105238_10489522 | Ga0105238_104895222 | 256 |
| 286 | 3300010375 | Ga0105239_10003190 | Ga0105239_1000319014 | 256 |
| 287 | 3300010375 | Ga0105239_10030067 | Ga0105239_100300672 | 256 |
| 288 | 3300010375 | Ga0105239_10054980 | Ga0105239_100549807 | 256 |
| 289 | 3300010375 | Ga0105239_10292327 | Ga0105239_102923273 | 256 |
| 290 | 3300011119 | Ga0105246_10009119 | Ga0105246_100091192 | 256 |
| 291 | 3300013104 | Ga0157370_10001044 | Ga0157370_1000104417 | 256 |
| 292 | 3300013104 | Ga0157370_10073074 | Ga0157370_100730743 | 256 |
| 293 | 3300013105 | Ga0157369_10000182 | Ga0157369_1000018210 | 256 |
| 294 | 3300013105 | Ga0157369_10001053 | Ga0157369_1000105321 | 256 |
| 295 | 3300013105 | Ga0157369_10006652 | Ga0157369_1000665210 | 256 |
| 296 | 3300013105 | Ga0157369_10013201 | Ga0157369_100132014 | 256 |
| 297 | 3300013105 | Ga0157369_10037774 | Ga0157369_100377745 | 256 |
| 298 | 3300013105 | Ga0157369_10078882 | Ga0157369_100788825 | 256 |
| 299 | 3300013296 | Ga0157374_10013124 | Ga0157374_1001312410 | 256 |
| 300 | 3300013296 | Ga0157374_10023455 | Ga0157374_100234554 | 256 |
| 301 | 3300013296 | Ga0157374_10080117 | Ga0157374_100801175 | 256 |
| 302 | 3300013297 | Ga0157378_10000080 | Ga0157378_1000008025 | 256 |
| 303 | 3300013297 | Ga0157378_10005574 | Ga0157378_1000557411 | 256 |
| 304 | 3300013297 | Ga0157378_10040291 | Ga0157378_100402915 | 256 |
| 305 | 3300013306 | Ga0163162_10068594 | Ga0163162_100685943 | 256 |
| 306 | 3300013306 | Ga0163162_10101829 | Ga0163162_101018293 | 256 |
| 307 | 3300013307 | Ga0157372_10000768 | Ga0157372_1000076821 | 256 |
| 308 | 3300013307 | Ga0157372_10023937 | Ga0157372_100239374 | 256 |
| 309 | 3300013307 | Ga0157372_10028704 | Ga0157372_100287046 | 256 |
| 310 | 3300013307 | Ga0157372_10042036 | Ga0157372_100420363 | 256 |
| 311 | 3300013307 | Ga0157372_10106201 | Ga0157372_101062012 | 256 |
| 312 | 3300013307 | Ga0157372_10138745 | Ga0157372_101387452 | 256 |
| 313 | 3300013307 | Ga0157372_10265175 | Ga0157372_102651753 | 256 |
| 314 | 3300013307 | Ga0157372_10474828 | Ga0157372_104748281 | 256 |
| 315 | 3300013308 | Ga0157375_10001385 | Ga0157375_100013855 | 256 |
| 316 | 3300014325 | Ga0163163_10001619 | Ga0163163_100016194 | 256 |
| 317 | 3300014325 | Ga0163163_10292130 | Ga0163163_102921302 | 256 |
| 318 | 3300014968 | Ga0157379_10003945 | Ga0157379_100039452 | 256 |
| 319 | 3300014969 | Ga0157376_10000060 | Ga0157376_1000006060 | 256 |
| 320 | 3300014969 | Ga0157376_10002245 | Ga0157376_1000224512 | 256 |
| 321 | 3300014969 | Ga0157376_10040741 | Ga0157376_100407411 | 256 |
| 322 | 3300017792 | Ga0163161_10471983 | Ga0163161_104719831 | 256 |
| 323 | 3300021361 | Ga0213872_10001956 | Ga0213872_100019566 | 256 |
| 324 | 3300021377 | Ga0213874_10072254 | Ga0213874_100722541 | 256 |
| 325 | 3300021388 | Ga0213875_10000005 | Ga0213875_100000058 | 256 |
| 326 | 3300025261 | Ga0209233_1005731 | Ga0209233_10057313 | 256 |
| 327 | 3300025321 | Ga0207656_10018024 | Ga0207656_100180242 | 256 |
| 328 | 3300025900 | Ga0207710_10000905 | Ga0207710_100009058 | 256 |
| 329 | 3300025904 | Ga0207647_10019216 | Ga0207647_100192165 | 256 |
| 330 | 3300025906 | Ga0207699_10000036 | Ga0207699_1000003623 | 256 |
| 331 | 3300025911 | Ga0207654_10000019 | Ga0207654_10000019133 | 256 |
| 332 | 3300025911 | Ga0207654_10000334 | Ga0207654_1000033422 | 256 |
| 333 | 3300025911 | Ga0207654_10000384 | Ga0207654_100003846 | 256 |
| 334 | 3300025913 | Ga0207695_10000002 | Ga0207695_100000021263 | 256 |
| 335 | 3300025913 | Ga0207695_10000188 | Ga0207695_1000018846 | 256 |
| 336 | 3300025913 | Ga0207695_10000332 | Ga0207695_1000033255 | 256 |
| 337 | 3300025913 | Ga0207695_10000989 | Ga0207695_1000098936 | 256 |
| 338 | 3300025913 | Ga0207695_10001708 | Ga0207695_1000170818 | 256 |
| 339 | 3300025913 | Ga0207695_10023237 | Ga0207695_100232372 | 256 |
| 340 | 3300025913 | Ga0207695_10027992 | Ga0207695_100279924 | 256 |
| 341 | 3300025913 | Ga0207695_10204456 | Ga0207695_102044562 | 256 |
| 342 | 3300025913 | Ga0207695_10245338 | Ga0207695_102453382 | 256 |
| 343 | 3300025914 | Ga0207671_10000449 | Ga0207671_1000044942 | 256 |
| 344 | 3300025914 | Ga0207671_10000506 | Ga0207671_100005064 | 256 |
| 345 | 3300025914 | Ga0207671_10330775 | Ga0207671_103307752 | 256 |
| 346 | 3300025917 | Ga0207660_10563898 | Ga0207660_105638981 | 256 |
| 347 | 3300025920 | Ga0207649_10002605 | Ga0207649_100026057 | 256 |
| 348 | 3300025920 | Ga0207649_10020982 | Ga0207649_100209822 | 256 |
| 349 | 3300025921 | Ga0207652_10014880 | Ga0207652_100148804 | 256 |
| 350 | 3300025921 | Ga0207652_10381294 | Ga0207652_103812942 | 256 |
| 351 | 3300025924 | Ga0207694_10000076 | Ga0207694_1000007693 | 256 |
| 352 | 3300025924 | Ga0207694_10000102 | Ga0207694_1000010263 | 256 |
| 353 | 3300025924 | Ga0207694_10002367 | Ga0207694_1000236710 | 256 |
| 354 | 3300025924 | Ga0207694_10008422 | Ga0207694_100084228 | 256 |
| 355 | 3300025924 | Ga0207694_10040882 | Ga0207694_100408822 | 256 |
| 356 | 3300025924 | Ga0207694_10442091 | Ga0207694_104420911 | 256 |
| 357 | 3300025925 | Ga0207650_10004058 | Ga0207650_1000405811 | 256 |
| 358 | 3300025927 | Ga0207687_10009056 | Ga0207687_100090562 | 256 |
| 359 | 3300025927 | Ga0207687_10082799 | Ga0207687_100827992 | 256 |
| 360 | 3300025927 | Ga0207687_10292001 | Ga0207687_102920012 | 256 |
| 361 | 3300025929 | Ga0207664_10022722 | Ga0207664_100227224 | 256 |
| 362 | 3300025929 | Ga0207664_10153069 | Ga0207664_101530693 | 256 |
| 363 | 3300025929 | Ga0207664_10184798 | Ga0207664_101847982 | 256 |
| 364 | 3300025929 | Ga0207664_10285424 | Ga0207664_102854242 | 256 |
| 365 | 3300025929 | Ga0207664_10618283 | Ga0207664_106182831 | 256 |
| 366 | 3300025931 | Ga0207644_10044485 | Ga0207644_100444853 | 256 |
| 367 | 3300025931 | Ga0207644_10448290 | Ga0207644_104482901 | 256 |
| 368 | 3300025933 | Ga0207706_10044673 | Ga0207706_100446735 | 256 |
| 369 | 3300025939 | Ga0207665_10011705 | Ga0207665_100117052 | 256 |
| 370 | 3300025939 | Ga0207665_10441451 | Ga0207665_104414511 | 256 |
| 371 | 3300025941 | Ga0207711_10003748 | Ga0207711_1000374816 | 256 |
| 372 | 3300025942 | Ga0207689_10000954 | Ga0207689_1000095416 | 256 |
| 373 | 3300025944 | Ga0207661_10010552 | Ga0207661_100105522 | 256 |
| 374 | 3300025944 | Ga0207661_10018981 | Ga0207661_100189812 | 256 |
| 375 | 3300025944 | Ga0207661_10156826 | Ga0207661_101568261 | 256 |
| 376 | 3300025945 | Ga0207679_10229982 | Ga0207679_102299822 | 256 |
| 377 | 3300025945 | Ga0207679_10734431 | Ga0207679_107344311 | 256 |
| 378 | 3300025949 | Ga0207667_10000442 | Ga0207667_100004424 | 256 |
| 379 | 3300025949 | Ga0207667_10010139 | Ga0207667_100101399 | 256 |
| 380 | 3300025949 | Ga0207667_10011777 | Ga0207667_100117778 | 256 |
| 381 | 3300025949 | Ga0207667_10122829 | Ga0207667_101228291 | 256 |
| 382 | 3300025986 | Ga0207658_10001428 | Ga0207658_100014288 | 256 |
| 383 | 3300026023 | Ga0207677_10000337 | Ga0207677_1000033711 | 256 |
| 384 | 3300026035 | Ga0207703_10006388 | Ga0207703_1000638811 | 256 |
| 385 | 3300026041 | Ga0207639_10000027 | Ga0207639_10000027149 | 256 |
| 386 | 3300026041 | Ga0207639_10014559 | Ga0207639_100145594 | 256 |
| 387 | 3300026041 | Ga0207639_10392540 | Ga0207639_103925401 | 256 |
| 388 | 3300026067 | Ga0207678_10077196 | Ga0207678_100771962 | 256 |
| 389 | 3300026067 | Ga0207678_10111535 | Ga0207678_101115352 | 256 |
| 390 | 3300026067 | Ga0207678_10432370 | Ga0207678_104323701 | 256 |
| 391 | 3300026078 | Ga0207702_10000307 | Ga0207702_100003078 | 256 |
| 392 | 3300026078 | Ga0207702_10000415 | Ga0207702_1000041538 | 256 |
| 393 | 3300026078 | Ga0207702_10001959 | Ga0207702_1000195916 | 256 |
| 394 | 3300026078 | Ga0207702_10021160 | Ga0207702_100211605 | 256 |
| 395 | 3300026078 | Ga0207702_10249222 | Ga0207702_102492222 | 256 |
| 396 | 3300026088 | Ga0207641_10001797 | Ga0207641_1000179721 | 256 |
| 397 | 3300026095 | Ga0207676_10006773 | Ga0207676_100067734 | 256 |
| 398 | 3300026116 | Ga0207674_10001941 | Ga0207674_1000194118 | 256 |
| 399 | 3300026116 | Ga0207674_10002941 | Ga0207674_100029414 | 256 |
| 400 | 3300026116 | Ga0207674_10121498 | Ga0207674_101214982 | 256 |
| 401 | 3300026116 | Ga0207674_10361781 | Ga0207674_103617812 | 256 |
| 402 | 3300026142 | Ga0207698_10000227 | Ga0207698_1000022720 | 256 |
| 403 | 3300026142 | Ga0207698_10004352 | Ga0207698_100043528 | 256 |
| 404 | 3300026142 | Ga0207698_10039372 | Ga0207698_100393723 | 256 |
| 405 | 3300026142 | Ga0207698_10051416 | Ga0207698_100514162 | 256 |
| 406 | 3300026142 | Ga0207698_10292019 | Ga0207698_102920191 | 256 |
| 407 | 3300028379 | Ga0268266_10000529 | Ga0268266_1000052926 | 256 |
| 408 | 3300028379 | Ga0268266_10010914 | Ga0268266_100109143 | 256 |
| 409 | 3300028379 | Ga0268266_10203781 | Ga0268266_102037812 | 256 |
| 410 | 3300028381 | Ga0268264_10000765 | Ga0268264_1000076517 | 256 |
| 411 | 3300028381 | Ga0268264_10010808 | Ga0268264_100108084 | 256 |
| 412 | 3300028800 | Ga0265338_10002893 | Ga0265338_100028934 | 256 |
| 413 | 3300028800 | Ga0265338_10135720 | Ga0265338_101357202 | 256 |
| 414 | 3300031249 | Ga0265339_10062370 | Ga0265339_100623702 | 256 |
| 415 | 3300031595 | Ga0265313_10094950 | Ga0265313_100949502 | 256 |
| 416 | 3300031712 | Ga0265342_10107156 | Ga0265342_101071562 | 256 |
| 417 | 3300036401 | Ga0373937_0002940 | Ga0373937_0002940_2443_3219 | 256 |
| 418 | 3300036401 | Ga0373937_0803673 | Ga0373937_0803673_51_833 | 256 |
| 419 | 3300037418 | Ga0395900_0260600 | Ga0395900_0260600_594_1364 | 256 |
| 420 | 3300037853 | Ga0436364_0080170 | Ga0436364_0080170_5709_6485 | 256 |
| 421 | 3300039437 | Ga0436365_0120080 | Ga0436365_0120080_134_919 | 256 |
| 422 | 3300039438 | Ga0436360_0512858 | Ga0436360_0512858_694_1476 | 256 |
| 423 | 3300039438 | Ga0436360_0925333 | Ga0436360_0925333_287_1069 | 256 |
| 424 | 3300039447 | Ga0436361_0237725 | Ga0436361_0237725_12559_13341 | 256 |
| 425 | 3300039447 | Ga0436361_0623560 | Ga0436361_0623560_2846_3628 | 256 |
| 426 | 3300044673 | Ga0453683_0001178 | Ga0453683_0001178_20802_21572 | 256 |
| 427 | 3300045836 | Ga0466958_0044425 | Ga0466958_0044425_1782_2642 | 256 |
| 428 | 3300045976 | Ga0466967_0046694 | Ga0466967_0046694_2438_3220 | 256 |
| 429 | 3300046473 | Ga0495582_0303048 | Ga0495582_0303048_90_878 | 256 |
| 430 | 3300046499 | Ga0495594_0141726 | Ga0495594_0141726_507_1286 | 256 |
| 431 | 3300046543 | Ga0495645_0013453 | Ga0495645_0013453_2423_3193 | 256 |
| 432 | 3300046679 | Ga0495623_0215379 | Ga0495623_0215379_22_798 | 256 |
| 433 | 3300046684 | Ga0495669_0078084 | Ga0495669_0078084_545_1339 | 256 |
| 434 | 3300047472 | Ga0495686_0005986 | Ga0495686_0005986_3979_4749 | 256 |
| 435 | 3300047472 | Ga0495686_0030521 | Ga0495686_0030521_2153_2923 | 256 |
| 436 | 3300048905 | Ga0496102_0009812 | Ga0496102_0009812_524_1306 | 256 |
| 437 | 3300048905 | Ga0496102_0265270 | Ga0496102_0265270_485_1279 | 256 |
| 438 | 3300048907 | Ga0496104_0003612 | Ga0496104_0003612_10940_11710 | 256 |
| 439 | 3300048907 | Ga0496104_0152528 | Ga0496104_0152528_815_1609 | 256 |
| 440 | 3300048907 | Ga0496104_0240603 | Ga0496104_0240603_643_1419 | 256 |
| 441 | 3300048907 | Ga0496104_0286653 | Ga0496104_0286653_262_1044 | 256 |
| 442 | 3300048912 | Ga0496109_0078235 | Ga0496109_0078235_1315_2109 | 256 |
| 443 | 3300048913 | Ga0496110_0312502 | Ga0496110_0312502_143_937 | 256 |
| 444 | 3300048914 | Ga0496111_0137744 | Ga0496111_0137744_391_1185 | 256 |
| 445 | 3300048915 | Ga0496112_0179426 | Ga0496112_0179426_465_1259 | 256 |
| 446 | 3300048915 | Ga0496112_0243201 | Ga0496112_0243201_525_1301 | 256 |
| 447 | 3300048915 | Ga0496112_0449735 | Ga0496112_0449735_186_968 | 256 |
| 448 | 3300048916 | Ga0496113_0065399 | Ga0496113_0065399_1239_2033 | 256 |
| 449 | 3300048917 | Ga0496114_0051613 | Ga0496114_0051613_2336_3136 | 256 |
| 450 | 3300048918 | Ga0496115_0183955 | Ga0496115_0183955_185_967 | 256 |
| 451 | 3300048918 | Ga0496115_0366589 | Ga0496115_0366589_339_1133 | 256 |
| 452 | 3300048929 | Ga0496126_0006120 | Ga0496126_0006120_4049_4819 | 256 |
| 453 | 3300048929 | Ga0496126_0030729 | Ga0496126_0030729_3192_3980 | 256 |
| 454 | 3300050507 | nmdc:mga05p37_154354_c1 | nmdc:mga05p37_154354_c1_1098_1880 | 256 |
| 455 | 3300050511 | nmdc:mga08y16_67217_c1 | nmdc:mga08y16_67217_c1_2090_2875 | 256 |
| 456 | 3300050512 | nmdc:mga0n895_15354_c1 | nmdc:mga0n895_15354_c1_2649_3428 | 256 |
| 457 | 3300050512 | nmdc:mga0n895_21254_c1 | nmdc:mga0n895_21254_c1_781_1551 | 256 |
| 458 | 3300050513 | nmdc:mga0rr50_339657_c1 | nmdc:mga0rr50_339657_c1_344_1123 | 256 |
| 459 | 3300050514 | nmdc:mga08x19_3532_c1 | nmdc:mga08x19_3532_c1_7478_8266 | 256 |
| 460 | 3300050514 | nmdc:mga08x19_8576_c1 | nmdc:mga08x19_8576_c1_4428_5216 | 256 |
| 461 | 3300053077 | Ga0495601_0144803 | Ga0495601_0144803_312_1082 | 256 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ew8-assembly1.cif.gz_D | crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 | 0.9744 | 2 | 242 |
| 2ew8-assembly1.cif.gz_C | crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 | 0.9702 | 2 | 242 |
| 2ewm-assembly1.cif.gz_A-2 | crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 | 0.9682 | 2 | 242 |
| 4za2-assembly1.cif.gz_C | crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d-gluconate dehydrogenase complexed with nad+ | 0.9677 | 2 | 242 |
| 8jf9-assembly1.cif.gz_C | crystal structure of 3-oxoacyl-acp reductase fabg from helicobacter pylori | 0.9647 | 1 | 242 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54N15_5_159_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9672 | 54 | 173 | 3.40.50.720 |
| 4y98A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9627 | 2 | 179 | 3.40.50.720 |
| 2ewmB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.96 | 2 | 242 | 3.40.50.720 |
| af_Q6PKH6_18_219_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9596 | 2 | 179 | 3.40.50.720 |
| 4yxfB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9581 | 1 | 242 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W6T3P7-F1-model_v4 | Short-chain dehydrogenase | 0.9764 | 2 | 178 |
GO:0016491
|
| AF-A0A7C7JRJ5-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9754 | 2 | 138 |
|
| AF-A0A383B9X5-F1-model_v4 | Uncharacterized protein | 0.9738 | 2 | 118 |
GO:0016616
|
| AF-A0A1F4BCM0-F1-model_v4 | 3-oxoacyl-ACP reductase | 0.9715 | 2 | 183 |
GO:0016491
|
| AF-A8L1M9-F1-model_v4 | deleted | 0.9712 | 2 | 243 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar