F448748

General Info

Members Datasets Scaffolds Average Seq Length
461 217 460 258

Family's Representative Sequence

Representative Sequence 3300025917|Ga0207660_10563898|Ga0207660_105638981
Length 291
Sequence MPRRYAPLLKGNEKKDMRAGCYYRAARRVLLMHSSQKVAVITGAAQGIGRRTAELFAQQGYSLALVDLKPMAATAQAAQNSGAEVLELTGDISNEQSVSHFAASVTDRWGHADVLVNNAGISFISPAEQVSAADFRRVLEVNLVAPFLLAKAFGAMMLSQKSGSIVNVASVAGLLGIADRSAYNASKHGLIGLTRTLASEWGGRGVRVNAVCPGWVKTEMDAADQAGGGYSDADITNRVPMARFASPDDIAKAIAFLADDRLSGYVNGHTLSVDGGWSGDGSWDSLRLRHR

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
80 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
152 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.22
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 5.21
Rhizosphere 91.54
Stem 0
Stem Tuber 0
Unclassified 2.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1001068 3300000546 Bacteria 4287
2 rootL2_10177401 3300003322 Bacteria 1605
3 Ga0065715_10182087 3300005293 Bacteria 1469
4 Ga0070683_100073239 3300005329 Bacteria 3198
5 Ga0070683_100102370 3300005329 Bacteria 2697
6 Ga0070683_100243372 3300005329 Unclassified 1711
7 Ga0070683_100403897 3300005329 Bacteria 1303
8 Ga0070670_100015491 3300005331 Bacteria 6547
9 Ga0068869_100000075 3300005334 Bacteria 44767
10 Ga0068869_100032738 3300005334 Bacteria 3665
11 Ga0070682_100257977 3300005337 Bacteria 1260
12 Ga0068868_100001557 3300005338 Bacteria 15672
13 Ga0068868_100198273 3300005338 Bacteria 1672
14 Ga0068868_100344322 3300005338 Bacteria 1275
15 Ga0070661_100003311 3300005344 Bacteria 11125
16 Ga0070661_100033503 3300005344 Bacteria 3721
17 Ga0070661_100046043 3300005344 Bacteria 3190
18 Ga0070675_100044413 3300005354 Bacteria 3634
19 Ga0070674_100032198 3300005356 Bacteria 3480
20 Ga0070667_100002745 3300005367 Bacteria 15234
21 Ga0070667_100345473 3300005367 Bacteria 1346
22 Ga0070709_10000025 3300005434 Bacteria 129264
23 Ga0070709_10020681 3300005434 Bacteria 3823
24 Ga0070714_100025142 3300005435 Bacteria 4912
25 Ga0070714_100068005 3300005435 Unclassified 3073
26 Ga0070714_100241869 3300005435 Bacteria 1666
27 Ga0070714_100253396 3300005435 Bacteria 1628
28 Ga0070714_100384595 3300005435 Unclassified 1323
29 Ga0070713_100026334 3300005436 Bacteria 4564
30 Ga0070713_100328325 3300005436 Bacteria 1414
31 Ga0070713_100361187 3300005436 Unclassified 1349
32 Ga0070713_100670676 3300005436 Bacteria 988
33 Ga0070711_100188093 3300005439 Bacteria 1585
34 Ga0070711_100264541 3300005439 Unclassified 1355
35 Ga0070711_100477751 3300005439 Bacteria 1024
36 Ga0070663_100041016 3300005455 Bacteria 3244
37 Ga0070663_100052111 3300005455 Bacteria 2918
38 Ga0070663_100086273 3300005455 Bacteria 2318
39 Ga0070678_100116659 3300005456 Bacteria 2098
40 Ga0070662_100133884 3300005457 Bacteria 1914
41 Ga0070681_10004083 3300005458 Bacteria 13792
42 Ga0068867_100115804 3300005459 Bacteria 2065
43 Ga0070679_100011350 3300005530 Bacteria 8490
44 Ga0070679_100263789 3300005530 Bacteria 1677
45 Ga0070684_100000516 3300005535 Bacteria 26542
46 Ga0070684_100046808 3300005535 Bacteria 3748
47 Ga0068853_100000474 3300005539 Bacteria 27401
48 Ga0068853_100002760 3300005539 Bacteria 13257
49 Ga0068853_100589251 3300005539 Bacteria 1055
50 Ga0070672_100435006 3300005543 Bacteria 1128
51 Ga0070696_100073248 3300005546 Bacteria 2413
52 Ga0070665_100001777 3300005548 Bacteria 24558
53 Ga0070665_100012643 3300005548 Bacteria 8501
54 Ga0070665_100121699 3300005548 Bacteria 2611
55 Ga0070704_100012967 3300005549 Bacteria 5157
56 Ga0068855_100001789 3300005563 Bacteria 26855
57 Ga0068855_100002618 3300005563 Bacteria 22183
58 Ga0068855_100003162 3300005563 Bacteria 20152
59 Ga0068855_100132121 3300005563 Bacteria 2850
60 Ga0068855_100476921 3300005563 Bacteria 1358
61 Ga0070664_100092019 3300005564 Bacteria 2625
62 Ga0070664_100607744 3300005564 Bacteria 1014
63 Ga0068857_100007650 3300005577 Bacteria 9304
64 Ga0068857_100011623 3300005577 Bacteria 7658
65 Ga0068857_100019826 3300005577 Bacteria 5909
66 Ga0068857_100022550 3300005577 Bacteria 5539
67 Ga0068857_100450753 3300005577 Bacteria 1203
68 Ga0068854_100049081 3300005578 Bacteria 3014
69 Ga0068854_100136943 3300005578 Bacteria 1875
70 Ga0068854_100328044 3300005578 Unclassified 1246
71 Ga0068856_100001190 3300005614 Bacteria 27408
72 Ga0068856_100002078 3300005614 Bacteria 20771
73 Ga0068856_100006428 3300005614 Bacteria 11533
74 Ga0068856_100007628 3300005614 Bacteria 10558
75 Ga0068856_100016253 3300005614 Bacteria 7200
76 Ga0068856_100261928 3300005614 Bacteria 1744
77 Ga0068852_100000046 3300005616 Bacteria 87937
78 Ga0068852_100000078 3300005616 Bacteria 68720
79 Ga0068852_100083573 3300005616 Bacteria 2839
80 Ga0068859_100020456 3300005617 Bacteria 6642
81 Ga0068864_100002989 3300005618 Bacteria 13980
82 Ga0068866_10022080 3300005718 Bacteria 2941
83 Ga0068851_10012742 3300005834 Bacteria 3971
84 Ga0068851_10020298 3300005834 Bacteria 3216
85 Ga0068851_10048202 3300005834 Bacteria 2159
86 Ga0068851_10048271 3300005834 Bacteria 2157
87 Ga0068863_100009508 3300005841 Bacteria 9482
88 Ga0068863_100010964 3300005841 Bacteria 8789
89 Ga0068863_100519209 3300005841 Bacteria 1174
90 Ga0068858_100010050 3300005842 Bacteria 8985
91 Ga0068858_100240880 3300005842 Bacteria 1716
92 Ga0068860_100009498 3300005843 Bacteria 9659
93 Ga0068860_100014067 3300005843 Bacteria 7850
94 Ga0068862_100019940 3300005844 Bacteria 5597
95 Ga0081540_1027891 3300005983 Bacteria 3187
96 Ga0070717_10042187 3300006028 Bacteria 3721
97 Ga0070717_10069048 3300006028 Bacteria 2942
98 Ga0070717_10220542 3300006028 Bacteria 1667
99 Ga0070716_100049161 3300006173 Bacteria 2388
100 Ga0070716_100092825 3300006173 Bacteria 1831
101 Ga0070712_100376215 3300006175 Bacteria 1168
102 Ga0075367_10217548 3300006178 Bacteria 1195
103 Ga0097621_100061878 3300006237 Bacteria 3071
104 Ga0097621_100063183 3300006237 Bacteria 3042
105 Ga0097621_100072019 3300006237 Bacteria 2858
106 Ga0097621_100082669 3300006237 Bacteria 2675
107 Ga0068871_100001065 3300006358 Bacteria 18417
108 Ga0068871_100001674 3300006358 Bacteria 14903
109 Ga0068871_100003942 3300006358 Bacteria 10243
110 Ga0075433_10090932 3300006852 Bacteria 2698
111 Ga0075433_10131169 3300006852 Bacteria 2226
112 Ga0075434_100013220 3300006871 Bacteria 7846
113 Ga0075434_100713257 3300006871 Bacteria 1020
114 Ga0075436_100012163 3300006914 Bacteria 5896
115 Ga0075436_100022363 3300006914 Bacteria 4342
116 Ga0097620_100020456 3300006931 Bacteria 6642
117 Ga0075435_100012104 3300007076 Bacteria 6377
118 Ga0075435_100138257 3300007076 Bacteria 2042
119 Ga0099795_10050119 3300007788 Bacteria 1517
120 Ga0105240_10000002 3300009093 Bacteria 1924170
121 Ga0105240_10000873 3300009093 Bacteria 54313
122 Ga0105240_10001944 3300009093 Bacteria 34235
123 Ga0105240_10022769 3300009093 Bacteria 8299
124 Ga0105240_10031415 3300009093 Bacteria 6887
125 Ga0105240_10036835 3300009093 Bacteria 6289
126 Ga0105240_10110891 3300009093 Bacteria 3320
127 Ga0111539_10016056 3300009094 Bacteria 9293
128 Ga0111539_10044621 3300009094 Bacteria 5310
129 Ga0105245_10001560 3300009098 Bacteria 20803
130 Ga0105245_10061799 3300009098 Bacteria 3378
131 Ga0105245_10070906 3300009098 Bacteria 3164
132 Ga0105247_10004000 3300009101 Bacteria 9486
133 Ga0114129_10188048 3300009147 Bacteria 2806
134 Ga0105241_10000203 3300009174 Bacteria 44600
135 Ga0105241_10001995 3300009174 Bacteria 15444
136 Ga0105241_10004226 3300009174 Bacteria 10606
137 Ga0105241_10021460 3300009174 Bacteria 4773
138 Ga0105241_10025216 3300009174 Bacteria 4419
139 Ga0105248_10001549 3300009177 Bacteria 25595
140 Ga0105248_10004769 3300009177 Bacteria 15006
141 Ga0105248_10032765 3300009177 Bacteria 5805
142 Ga0105248_10108689 3300009177 Bacteria 3127
143 Ga0105248_10119433 3300009177 Bacteria 2973
144 Ga0105248_10308262 3300009177 Bacteria 1783
145 Ga0105248_10839608 3300009177 Bacteria 1037
146 Ga0105237_10001830 3300009545 Bacteria 27399
147 Ga0105237_10097030 3300009545 Bacteria 2938
148 Ga0105237_10445348 3300009545 Bacteria 1301
149 Ga0105238_10002145 3300009551 Bacteria 19942
150 Ga0105238_10004627 3300009551 Bacteria 13627
151 Ga0105238_10009579 3300009551 Bacteria 9691
152 Ga0105238_10014419 3300009551 Bacteria 7989
153 Ga0105238_10053031 3300009551 Bacteria 4076
154 Ga0105238_10094688 3300009551 Bacteria 2974
155 Ga0105238_10196658 3300009551 Bacteria 1992
156 Ga0105238_10409799 3300009551 Bacteria 1349
157 Ga0105238_10489522 3300009551 Unclassified 1230
158 Ga0105239_10003190 3300010375 Bacteria 20298
159 Ga0105239_10030067 3300010375 Bacteria 5974
160 Ga0105239_10054980 3300010375 Bacteria 4366
161 Ga0105239_10069944 3300010375 Bacteria 3855
162 Ga0105239_10292327 3300010375 Bacteria 1835
163 Ga0105246_10009119 3300011119 Bacteria 6109
164 Ga0157370_10001044 3300013104 Bacteria 34837
165 Ga0157370_10073074 3300013104 Bacteria 3236
166 Ga0157369_10000182 3300013105 Bacteria 87266
167 Ga0157369_10000309 3300013105 Bacteria 65396
168 Ga0157369_10001053 3300013105 Bacteria 34829
169 Ga0157369_10006652 3300013105 Bacteria 13357
170 Ga0157369_10013201 3300013105 Bacteria 9350
171 Ga0157369_10037774 3300013105 Bacteria 5286
172 Ga0157369_10078882 3300013105 Bacteria 3527
173 Ga0157374_10013124 3300013296 Bacteria 7226
174 Ga0157374_10023455 3300013296 Bacteria 5519
175 Ga0157374_10070034 3300013296 Bacteria 3304
176 Ga0157374_10080117 3300013296 Bacteria 3096
177 Ga0157378_10000080 3300013297 Bacteria 88903
178 Ga0157378_10005574 3300013297 Bacteria 11019
179 Ga0157378_10040291 3300013297 Unclassified 4141
180 Ga0157378_10050323 3300013297 Bacteria 3708
181 Ga0163162_10007164 3300013306 Bacteria 10827
182 Ga0163162_10068594 3300013306 Bacteria 3598
183 Ga0163162_10101829 3300013306 Bacteria 2965
184 Ga0157372_10000768 3300013307 Bacteria 34833
185 Ga0157372_10001317 3300013307 Bacteria 26883
186 Ga0157372_10023937 3300013307 Bacteria 6627
187 Ga0157372_10028704 3300013307 Bacteria 6074
188 Ga0157372_10042036 3300013307 Bacteria 5054
189 Ga0157372_10106201 3300013307 Bacteria 3212
190 Ga0157372_10138745 3300013307 Unclassified 2800
191 Ga0157372_10265175 3300013307 Bacteria 1994
192 Ga0157372_10474828 3300013307 Bacteria 1458
193 Ga0157375_10001385 3300013308 Bacteria 20924
194 Ga0157375_10488144 3300013308 Bacteria 1396
195 Ga0163163_10001619 3300014325 Bacteria 18937
196 Ga0163163_10057250 3300014325 Bacteria 3853
197 Ga0163163_10292130 3300014325 Bacteria 1682
198 Ga0157379_10003945 3300014968 Bacteria 12651
199 Ga0157379_10370259 3300014968 Bacteria 1314
200 Ga0157376_10000060 3300014969 Bacteria 95745
201 Ga0157376_10002245 3300014969 Bacteria 13027
202 Ga0157376_10040741 3300014969 Bacteria 3798
203 Ga0157376_10281361 3300014969 Bacteria 1567
204 Ga0163161_10471983 3300017792 Bacteria 1017
205 Ga0213872_10001956 3300021361 Bacteria 12567
206 Ga0213874_10072254 3300021377 Bacteria 1103
207 Ga0213876_10222069 3300021384 Bacteria 1004
208 Ga0213875_10000005 3300021388 Bacteria 595146
209 Ga0209233_1005731 3300025261 Bacteria 4095
210 Ga0207656_10018024 3300025321 Bacteria 2774
211 Ga0207710_10000905 3300025900 Bacteria 15868
212 Ga0207647_10019216 3300025904 Bacteria 4600
213 Ga0207699_10000036 3300025906 Bacteria 129236
214 Ga0207699_10007094 3300025906 Bacteria 5462
215 Ga0207654_10000019 3300025911 Bacteria 171031
216 Ga0207654_10000334 3300025911 Bacteria 28260
217 Ga0207654_10000384 3300025911 Bacteria 25716
218 Ga0207707_10038066 3300025912 Bacteria 4203
219 Ga0207695_10000002 3300025913 Bacteria 2188391
220 Ga0207695_10000188 3300025913 Bacteria 178721
221 Ga0207695_10000332 3300025913 Bacteria 112161
222 Ga0207695_10000989 3300025913 Bacteria 50393
223 Ga0207695_10001708 3300025913 Bacteria 35163
224 Ga0207695_10023237 3300025913 Bacteria 7013
225 Ga0207695_10027992 3300025913 Bacteria 6263
226 Ga0207695_10204456 3300025913 Bacteria 1888
227 Ga0207695_10245338 3300025913 Bacteria 1691
228 Ga0207671_10000449 3300025914 Bacteria 56932
229 Ga0207671_10000506 3300025914 Bacteria 52834
230 Ga0207671_10101972 3300025914 Bacteria 2175
231 Ga0207671_10330775 3300025914 Bacteria 1206
232 Ga0207660_10563898 3300025917 Bacteria 927
233 Ga0207649_10002605 3300025920 Bacteria 10014
234 Ga0207649_10020982 3300025920 Bacteria 3753
235 Ga0207652_10014880 3300025921 Bacteria 6308
236 Ga0207652_10381294 3300025921 Bacteria 1272
237 Ga0207694_10000076 3300025924 Bacteria 113436
238 Ga0207694_10000102 3300025924 Bacteria 94003
239 Ga0207694_10002367 3300025924 Bacteria 15419
240 Ga0207694_10008422 3300025924 Bacteria 7783
241 Ga0207694_10040882 3300025924 Bacteria 3572
242 Ga0207694_10442091 3300025924 Bacteria 1085
243 Ga0207650_10004058 3300025925 Bacteria 10010
244 Ga0207650_10205859 3300025925 Bacteria 1578
245 Ga0207687_10009056 3300025927 Bacteria 6508
246 Ga0207687_10082799 3300025927 Bacteria 2322
247 Ga0207687_10292001 3300025927 Bacteria 1310
248 Ga0207700_10204949 3300025928 Bacteria 1664
249 Ga0207664_10022722 3300025929 Bacteria 4688
250 Ga0207664_10153069 3300025929 Bacteria 1960
251 Ga0207664_10184798 3300025929 Unclassified 1791
252 Ga0207664_10285424 3300025929 Bacteria 1449
253 Ga0207664_10618283 3300025929 Bacteria 973
254 Ga0207644_10044485 3300025931 Bacteria 3154
255 Ga0207644_10448290 3300025931 Bacteria 1060
256 Ga0207706_10044673 3300025933 Bacteria 3927
257 Ga0207665_10011705 3300025939 Bacteria 5764
258 Ga0207665_10215010 3300025939 Bacteria 1406
259 Ga0207665_10441451 3300025939 Bacteria 997
260 Ga0207711_10003748 3300025941 Bacteria 13098
261 Ga0207711_10285874 3300025941 Bacteria 1519
262 Ga0207689_10000954 3300025942 Bacteria 27817
263 Ga0207689_10070351 3300025942 Bacteria 2874
264 Ga0207661_10010552 3300025944 Bacteria 6654
265 Ga0207661_10018981 3300025944 Bacteria 5117
266 Ga0207661_10156826 3300025944 Bacteria 1972
267 Ga0207679_10217170 3300025945 Bacteria 1607
268 Ga0207679_10229982 3300025945 Bacteria 1565
269 Ga0207679_10734431 3300025945 Bacteria 897
270 Ga0207667_10000442 3300025949 Bacteria 55598
271 Ga0207667_10010139 3300025949 Bacteria 11033
272 Ga0207667_10011777 3300025949 Bacteria 10134
273 Ga0207667_10067914 3300025949 Bacteria 3713
274 Ga0207667_10122829 3300025949 Bacteria 2675
275 Ga0207640_10024932 3300025981 Bacteria 3614
276 Ga0207640_10335944 3300025981 Bacteria 1208
277 Ga0207658_10001428 3300025986 Bacteria 18626
278 Ga0207658_10299481 3300025986 Bacteria 1385
279 Ga0207677_10000337 3300026023 Bacteria 33617
280 Ga0207677_10044663 3300026023 Bacteria 2954
281 Ga0207703_10006388 3300026035 Bacteria 9423
282 Ga0207703_10236101 3300026035 Unclassified 1641
283 Ga0207639_10000027 3300026041 Bacteria 197829
284 Ga0207639_10014559 3300026041 Bacteria 5537
285 Ga0207639_10392540 3300026041 Bacteria 1248
286 Ga0207678_10030501 3300026067 Bacteria 4707
287 Ga0207678_10077196 3300026067 Bacteria 2853
288 Ga0207678_10097586 3300026067 Bacteria 2511
289 Ga0207678_10111535 3300026067 Bacteria 2333
290 Ga0207678_10432370 3300026067 Bacteria 1142
291 Ga0207702_10000307 3300026078 Bacteria 55978
292 Ga0207702_10000415 3300026078 Bacteria 48713
293 Ga0207702_10001959 3300026078 Bacteria 20036
294 Ga0207702_10021160 3300026078 Bacteria 5383
295 Ga0207702_10066098 3300026078 Bacteria 3098
296 Ga0207702_10249222 3300026078 Bacteria 1667
297 Ga0207641_10001797 3300026088 Bacteria 20623
298 Ga0207676_10006773 3300026095 Bacteria 8110
299 Ga0207674_10001941 3300026116 Bacteria 26256
300 Ga0207674_10002941 3300026116 Bacteria 21168
301 Ga0207674_10005215 3300026116 Bacteria 15469
302 Ga0207674_10121498 3300026116 Bacteria 2579
303 Ga0207674_10361781 3300026116 Bacteria 1402
304 Ga0207698_10000227 3300026142 Bacteria 35110
305 Ga0207698_10004352 3300026142 Bacteria 8626
306 Ga0207698_10039372 3300026142 Bacteria 3502
307 Ga0207698_10051416 3300026142 Bacteria 3150
308 Ga0207698_10292019 3300026142 Bacteria 1513
309 Ga0268266_10000529 3300028379 Bacteria 53323
310 Ga0268266_10000895 3300028379 Bacteria 38492
311 Ga0268266_10001822 3300028379 Bacteria 24095
312 Ga0268266_10010914 3300028379 Bacteria 7908
313 Ga0268266_10203781 3300028379 Bacteria 1811
314 Ga0268266_10693132 3300028379 Bacteria 981
315 Ga0268264_10000765 3300028381 Bacteria 35738
316 Ga0268264_10010808 3300028381 Bacteria 7541
317 Ga0265338_10002893 3300028800 Bacteria 25011
318 Ga0265338_10135720 3300028800 Bacteria 1935
319 Ga0265770_1001113 3300030878 Bacteria 3705
320 Ga0265339_10062370 3300031249 Bacteria 2004
321 Ga0307408_100329055 3300031548 Unclassified 1290
322 Ga0265313_10094950 3300031595 Bacteria 1331
323 Ga0265342_10107156 3300031712 Bacteria 1585
324 Ga0307416_100312480 3300032002 Bacteria 1569
325 Ga0373937_0002940 3300036401 Bacteria 14257
326 Ga0373937_0803673 3300036401 Bacteria 888
327 Ga0395900_0260600 3300037418 Bacteria 1732
328 Ga0436364_0080170 3300037853 Bacteria 70161
329 Ga0436364_0496001 3300037853 Bacteria 4608
330 Ga0436365_0120080 3300039437 Unclassified 995
331 Ga0436365_1065302 3300039437 Bacteria 17671
332 Ga0436360_0512858 3300039438 Bacteria 1819
333 Ga0436360_0925333 3300039438 Bacteria 1114
334 Ga0436361_0237725 3300039447 Bacteria 20036
335 Ga0436361_0623560 3300039447 Bacteria 4250
336 Ga0453683_0001178 3300044673 Bacteria 23602
337 Ga0451576_0122622 3300045051 Bacteria 2706
338 Ga0466958_0044425 3300045836 Bacteria 2678
339 Ga0466958_0319265 3300045836 Bacteria 998
340 Ga0466958_0378862 3300045836 Unclassified 912
341 Ga0466967_0046694 3300045976 Bacteria 3772
342 Ga0466967_0187183 3300045976 Bacteria 1955
343 Ga0495629_0013781 3300046459 Bacteria 5834
344 Ga0495651_0006029 3300046462 Bacteria 9254
345 Ga0495651_0077961 3300046462 Bacteria 2507
346 Ga0495650_0000010 3300046471 Bacteria 645599
347 Ga0495650_0005707 3300046471 Bacteria 7972
348 Ga0495580_0044998 3300046472 Bacteria 3137
349 Ga0495582_0003834 3300046473 Bacteria 8468
350 Ga0495582_0303048 3300046473 Bacteria 919
351 Ga0495639_0197926 3300046475 Bacteria 983
352 Ga0495662_0003951 3300046476 Bacteria 7475
353 Ga0495664_0043167 3300046477 Bacteria 2671
354 Ga0495664_0091258 3300046477 Bacteria 1831
355 Ga0495585_0035704 3300046492 Bacteria 2808
356 Ga0495594_0002915 3300046499 Bacteria 8895
357 Ga0495594_0007367 3300046499 Bacteria 5659
358 Ga0495594_0141726 3300046499 Bacteria 1364
359 Ga0495606_0041436 3300046507 Bacteria 3088
360 Ga0495606_0228697 3300046507 Bacteria 1044
361 Ga0495630_0154509 3300046517 Bacteria 1747
362 Ga0495631_0069328 3300046518 Bacteria 1525
363 Ga0495644_0004869 3300046523 Bacteria 5271
364 Ga0495648_0086813 3300046524 Bacteria 1764
365 Ga0495666_0012892 3300046526 Bacteria 4166
366 Ga0495642_0014636 3300046528 Bacteria 3041
367 Ga0495652_0240768 3300046529 Bacteria 1346
368 Ga0495665_0002480 3300046531 Bacteria 9972
369 Ga0495640_0012769 3300046533 Bacteria 6411
370 Ga0495586_0002812 3300046535 Bacteria 9398
371 Ga0495645_0013453 3300046543 Bacteria 5786
372 Ga0495667_0007815 3300046559 Bacteria 7245
373 Ga0495668_0091757 3300046616 Bacteria 1664
374 Ga0495634_0005777 3300046642 Bacteria 9451
375 Ga0495625_0000796 3300046660 Bacteria 43709
376 Ga0495625_0014897 3300046660 Bacteria 6183
377 Ga0495625_0205256 3300046660 Bacteria 1298
378 Ga0495635_0014265 3300046663 Bacteria 5561
379 Ga0495635_0202301 3300046663 Bacteria 1347
380 Ga0495661_0064187 3300046665 Bacteria 2168
381 Ga0495623_0148011 3300046679 Bacteria 1391
382 Ga0495623_0215379 3300046679 Bacteria 1097
383 Ga0495646_0002085 3300046680 Bacteria 12119
384 Ga0495647_0075777 3300046681 Bacteria 1355
385 Ga0495658_0153283 3300046683 Bacteria 1417
386 Ga0495669_0010506 3300046684 Bacteria 3912
387 Ga0495669_0078084 3300046684 Bacteria 1517
388 Ga0495613_0006321 3300046689 Bacteria 8858
389 Ga0495600_0011002 3300046809 Bacteria 5629
390 Ga0495581_0018953 3300047315 Bacteria 3993
391 Ga0495604_0079233 3300047317 Bacteria 2464
392 Ga0495604_0149569 3300047317 Bacteria 1660
393 Ga0495636_0172295 3300047318 Bacteria 979
394 Ga0495674_0042682 3300047319 Bacteria 4043
395 Ga0495674_0099394 3300047319 Bacteria 2477
396 Ga0495672_0028315 3300047320 Bacteria 3547
397 Ga0495676_0002278 3300047321 Bacteria 17036
398 Ga0495680_0024070 3300047322 Bacteria 5056
399 Ga0495675_0014850 3300047444 Bacteria 4924
400 Ga0495673_0052751 3300047469 Bacteria 1776
401 Ga0495684_0179660 3300047471 Bacteria 1569
402 Ga0495686_0005986 3300047472 Bacteria 9464
403 Ga0495686_0030521 3300047472 Bacteria 3500
404 Ga0495614_0000696 3300048089 Bacteria 14121
405 Ga0496102_0009812 3300048905 Bacteria 8232
406 Ga0496102_0265270 3300048905 Bacteria 1619
407 Ga0496104_0003612 3300048907 Bacteria 13359
408 Ga0496104_0054630 3300048907 Bacteria 3775
409 Ga0496104_0097222 3300048907 Bacteria 2818
410 Ga0496104_0152528 3300048907 Bacteria 2217
411 Ga0496104_0240603 3300048907 Bacteria 1722
412 Ga0496104_0286653 3300048907 Bacteria 1559
413 Ga0496104_0315761 3300048907 Unclassified 1476
414 Ga0496109_0078235 3300048912 Bacteria 3045
415 Ga0496109_0220546 3300048912 Bacteria 1783
416 Ga0496109_0318859 3300048912 Bacteria 1467
417 Ga0496110_0312502 3300048913 Bacteria 1431
418 Ga0496111_0137744 3300048914 Bacteria 1809
419 Ga0496112_0000022 3300048915 Bacteria 156255
420 Ga0496112_0157395 3300048915 Bacteria 2239
421 Ga0496112_0179426 3300048915 Bacteria 2081
422 Ga0496112_0243201 3300048915 Bacteria 1752
423 Ga0496112_0449735 3300048915 Bacteria 1226
424 Ga0496113_0065399 3300048916 Bacteria 2752
425 Ga0496114_0051613 3300048917 Bacteria 3424
426 Ga0496115_0072991 3300048918 Bacteria 2785
427 Ga0496115_0183955 3300048918 Bacteria 1727
428 Ga0496115_0366589 3300048918 Bacteria 1173
429 Ga0496126_0002036 3300048929 Bacteria 28475
430 Ga0496126_0006120 3300048929 Bacteria 13496
431 Ga0496126_0030729 3300048929 Bacteria 5086
432 Ga0496126_0118011 3300048929 Bacteria 2304
433 Ga0501031_0071799 3300049568 Bacteria 2254
434 Ga0501032_0003687 3300049569 Bacteria 11634
435 Ga0501033_0020581 3300049570 Bacteria 4985
436 Ga0501034_0299663 3300049571 Bacteria 1544
437 Ga0501036_0001302 3300049572 Bacteria 19115
438 Ga0501037_0011654 3300049573 Bacteria 6473
439 Ga0501038_0002468 3300049574 Bacteria 17200
440 Ga0501043_0040827 3300049579 Bacteria 3646
441 Ga0501046_0001610 3300049580 Bacteria 21590
442 Ga0501047_0010938 3300049581 Bacteria 8585
443 Ga0501048_0289243 3300049582 Bacteria 1165
444 Ga0501068_0101568 3300049584 Bacteria 1783
445 Ga0501073_0001768 3300049589 Bacteria 16069
446 Ga0501035_0006048 3300049822 Bacteria 11397
447 Ga0501044_0002842 3300049823 Bacteria 19709
448 Ga0501044_0123765 3300049823 Bacteria 2584
449 nmdc:mga05p37_154354_c1 3300050507 Bacteria 2806
450 nmdc:mga08y16_67217_c1 3300050511 Bacteria 3739
451 nmdc:mga0n895_15354_c1 3300050512 Bacteria 6980
452 nmdc:mga0n895_182808_c1 3300050512 Bacteria 2128
453 nmdc:mga0n895_21254_c1 3300050512 Bacteria 6064
454 nmdc:mga0n895_357913_c1 3300050512 Bacteria 1478
455 nmdc:mga0rr50_339657_c1 3300050513 Bacteria 1262
456 nmdc:mga08x19_3532_c1 3300050514 Bacteria 9298
457 nmdc:mga08x19_8576_c1 3300050514 Bacteria 6091
458 nmdc:mga0a205_15421_c1 3300050515 Bacteria 7141
459 Ga0495601_0144803 3300053077 Bacteria 1551
460 Ga0500651_0000129 3300053093 Bacteria 46606

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025939 Ga0207665_10215010 Ga0207665_102150102 215
2 3300048915 Ga0496112_0000022 Ga0496112_0000022_4808_5578 219
3 3300005459 Ga0068867_100115804 Ga0068867_1001158042 231
4 3300005578 Ga0068854_100328044 Ga0068854_1003280442 231
5 3300009177 Ga0105248_10108689 Ga0105248_101086893 231
6 3300014969 Ga0157376_10281361 Ga0157376_102813612 231
7 3300025981 Ga0207640_10335944 Ga0207640_103359442 231
8 3300048912 Ga0496109_0220546 Ga0496109_0220546_14_715 232
9 3300007788 Ga0099795_10050119 Ga0099795_100501192 236
10 3300045836 Ga0466958_0319265 Ga0466958_0319265_139_909 236
11 3300048907 Ga0496104_0054630 Ga0496104_0054630_1336_2166 236
12 3300050512 nmdc:mga0n895_182808_c1 nmdc:mga0n895_182808_c1_832_1701 236
13 3300050512 nmdc:mga0n895_357913_c1 nmdc:mga0n895_357913_c1_567_1277 236
14 3300025906 Ga0207699_10007094 Ga0207699_100070945 237
15 3300049568 Ga0501031_0071799 Ga0501031_0071799_539_1294 240
16 3300049569 Ga0501032_0003687 Ga0501032_0003687_1768_2523 240
17 3300049570 Ga0501033_0020581 Ga0501033_0020581_4042_4797 240
18 3300049571 Ga0501034_0299663 Ga0501034_0299663_575_1330 240
19 3300049572 Ga0501036_0001302 Ga0501036_0001302_10688_11443 240
20 3300049573 Ga0501037_0011654 Ga0501037_0011654_5170_5925 240
21 3300049574 Ga0501038_0002468 Ga0501038_0002468_15945_16700 240
22 3300049579 Ga0501043_0040827 Ga0501043_0040827_1751_2506 240
23 3300049580 Ga0501046_0001610 Ga0501046_0001610_2058_2813 240
24 3300049581 Ga0501047_0010938 Ga0501047_0010938_2651_3406 240
25 3300049582 Ga0501048_0289243 Ga0501048_0289243_61_816 240
26 3300049584 Ga0501068_0101568 Ga0501068_0101568_617_1372 240
27 3300049589 Ga0501073_0001768 Ga0501073_0001768_1088_1843 240
28 3300049822 Ga0501035_0006048 Ga0501035_0006048_5584_6339 240
29 3300049823 Ga0501044_0002842 Ga0501044_0002842_14911_15666 240
30 3300049823 Ga0501044_0123765 Ga0501044_0123765_1747_2502 240
31 3300014325 Ga0163163_10057250 Ga0163163_100572504 243
32 3300005334 Ga0068869_100032738 Ga0068869_1000327383 244
33 3300006173 Ga0070716_100092825 Ga0070716_1000928251 244
34 3300025942 Ga0207689_10070351 Ga0207689_100703513 244
35 3300032002 Ga0307416_100312480 Ga0307416_1003124802 246
36 3300048929 Ga0496126_0118011 Ga0496126_0118011_107_883 246
37 3300003322 rootL2_10177401 rootL2_101774012 247
38 iso_pu_bacteria 2884215851 2884217301 247
39 3300006852 Ga0075433_10131169 Ga0075433_101311694 248
40 3300007076 Ga0075435_100138257 Ga0075435_1001382571 248
41 3300026067 Ga0207678_10030501 Ga0207678_100305012 248
42 3300037853 Ga0436364_0496001 Ga0436364_0496001_287_1069 248
43 3300045051 Ga0451576_0122622 Ga0451576_0122622_1635_2435 248
44 3300050515 nmdc:mga0a205_15421_c1 nmdc:mga0a205_15421_c1_4542_5342 248
45 3300005337 Ga0070682_100257977 Ga0070682_1002579771 249
46 3300009177 Ga0105248_10839608 Ga0105248_108396081 249
47 3300026067 Ga0207678_10097586 Ga0207678_100975861 249
48 3300005841 Ga0068863_100009508 Ga0068863_1000095085 250
49 3300009177 Ga0105248_10032765 Ga0105248_100327654 250
50 3300025925 Ga0207650_10205859 Ga0207650_102058592 250
51 3300046459 Ga0495629_0013781 Ga0495629_0013781_2327_3100 250
52 3300046462 Ga0495651_0006029 Ga0495651_0006029_407_1180 250
53 3300046471 Ga0495650_0000010 Ga0495650_0000010_149943_150695 250
54 3300046472 Ga0495580_0044998 Ga0495580_0044998_1822_2595 250
55 3300046473 Ga0495582_0003834 Ga0495582_0003834_4118_4891 250
56 3300046475 Ga0495639_0197926 Ga0495639_0197926_22_795 250
57 3300046476 Ga0495662_0003951 Ga0495662_0003951_2280_3053 250
58 3300046477 Ga0495664_0043167 Ga0495664_0043167_85_858 250
59 3300046492 Ga0495585_0035704 Ga0495585_0035704_356_1129 250
60 3300046499 Ga0495594_0002915 Ga0495594_0002915_2812_3585 250
61 3300046499 Ga0495594_0007367 Ga0495594_0007367_4520_5293 250
62 3300046507 Ga0495606_0041436 Ga0495606_0041436_1000_1773 250
63 3300046517 Ga0495630_0154509 Ga0495630_0154509_347_1120 250
64 3300046518 Ga0495631_0069328 Ga0495631_0069328_649_1422 250
65 3300046523 Ga0495644_0004869 Ga0495644_0004869_4217_4990 250
66 3300046526 Ga0495666_0012892 Ga0495666_0012892_224_997 250
67 3300046528 Ga0495642_0014636 Ga0495642_0014636_1336_2109 250
68 3300046529 Ga0495652_0240768 Ga0495652_0240768_192_965 250
69 3300046531 Ga0495665_0002480 Ga0495665_0002480_3837_4610 250
70 3300046533 Ga0495640_0012769 Ga0495640_0012769_5556_6329 250
71 3300046535 Ga0495586_0002812 Ga0495586_0002812_1435_2208 250
72 3300046559 Ga0495667_0007815 Ga0495667_0007815_3303_4076 250
73 3300046616 Ga0495668_0091757 Ga0495668_0091757_533_1306 250
74 3300046642 Ga0495634_0005777 Ga0495634_0005777_379_1152 250
75 3300046660 Ga0495625_0014897 Ga0495625_0014897_1472_2224 250
76 3300046660 Ga0495625_0205256 Ga0495625_0205256_30_803 250
77 3300046663 Ga0495635_0014265 Ga0495635_0014265_194_967 250
78 3300046665 Ga0495661_0064187 Ga0495661_0064187_1091_1843 250
79 3300046680 Ga0495646_0002085 Ga0495646_0002085_6635_7408 250
80 3300046681 Ga0495647_0075777 Ga0495647_0075777_358_1131 250
81 3300046683 Ga0495658_0153283 Ga0495658_0153283_565_1338 250
82 3300046684 Ga0495669_0010506 Ga0495669_0010506_2692_3465 250
83 3300046689 Ga0495613_0006321 Ga0495613_0006321_541_1314 250
84 3300046809 Ga0495600_0011002 Ga0495600_0011002_2089_2862 250
85 3300047315 Ga0495581_0018953 Ga0495581_0018953_367_1140 250
86 3300047317 Ga0495604_0149569 Ga0495604_0149569_665_1438 250
87 3300047318 Ga0495636_0172295 Ga0495636_0172295_117_890 250
88 3300047319 Ga0495674_0042682 Ga0495674_0042682_223_996 250
89 3300047321 Ga0495676_0002278 Ga0495676_0002278_15724_16497 250
90 3300047322 Ga0495680_0024070 Ga0495680_0024070_4130_4903 250
91 3300047444 Ga0495675_0014850 Ga0495675_0014850_223_996 250
92 3300047469 Ga0495673_0052751 Ga0495673_0052751_180_953 250
93 3300047471 Ga0495684_0179660 Ga0495684_0179660_366_1139 250
94 3300048089 Ga0495614_0000696 Ga0495614_0000696_7271_8044 250
95 3300048929 Ga0496126_0002036 Ga0496126_0002036_23556_24308 250
96 3300053093 Ga0500651_0000129 Ga0500651_0000129_16845_17597 250
97 3300005367 Ga0070667_100345473 Ga0070667_1003454732 251
98 3300005543 Ga0070672_100435006 Ga0070672_1004350062 251
99 3300005548 Ga0070665_100121699 Ga0070665_1001216991 251
100 3300009177 Ga0105248_10308262 Ga0105248_103082622 251
101 3300013306 Ga0163162_10007164 Ga0163162_100071644 251
102 3300025914 Ga0207671_10101972 Ga0207671_101019722 251
103 3300025941 Ga0207711_10285874 Ga0207711_102858742 251
104 3300025986 Ga0207658_10299481 Ga0207658_102994812 251
105 3300028379 Ga0268266_10000895 Ga0268266_100008957 251
106 3300028379 Ga0268266_10001822 Ga0268266_1000182223 251
107 3300028379 Ga0268266_10693132 Ga0268266_106931321 251
108 3300046462 Ga0495651_0077961 Ga0495651_0077961_1693_2448 251
109 3300046471 Ga0495650_0005707 Ga0495650_0005707_2467_3243 251
110 3300046477 Ga0495664_0091258 Ga0495664_0091258_671_1426 251
111 3300046507 Ga0495606_0228697 Ga0495606_0228697_75_848 251
112 3300046524 Ga0495648_0086813 Ga0495648_0086813_736_1509 251
113 3300046660 Ga0495625_0000796 Ga0495625_0000796_42230_43006 251
114 3300046663 Ga0495635_0202301 Ga0495635_0202301_218_973 251
115 3300046679 Ga0495623_0148011 Ga0495623_0148011_81_836 251
116 3300047317 Ga0495604_0079233 Ga0495604_0079233_994_1749 251
117 3300047319 Ga0495674_0099394 Ga0495674_0099394_266_1021 251
118 3300047320 Ga0495672_0028315 Ga0495672_0028315_408_1163 251
119 3300048907 Ga0496104_0097222 Ga0496104_0097222_894_1649 251
120 3300048918 Ga0496115_0072991 Ga0496115_0072991_505_1260 251
121 3300005354 Ga0070675_100044413 Ga0070675_1000444132 252
122 3300006028 Ga0070717_10220542 Ga0070717_102205421 252
123 3300009094 Ga0111539_10016056 Ga0111539_1001605610 252
124 3300030878 Ga0265770_1001113 Ga0265770_10011132 252
125 3300045836 Ga0466958_0378862 Ga0466958_0378862_74_832 252
126 3300045976 Ga0466967_0187183 Ga0466967_0187183_139_897 252
127 3300005329 Ga0070683_100243372 Ga0070683_1002433722 254
128 3300005338 Ga0068868_100198273 Ga0068868_1001982732 254
129 3300005436 Ga0070713_100361187 Ga0070713_1003611871 254
130 3300005458 Ga0070681_10004083 Ga0070681_100040832 254
131 3300005563 Ga0068855_100001789 Ga0068855_1000017892 254
132 3300005564 Ga0070664_100092019 Ga0070664_1000920192 254
133 3300005577 Ga0068857_100011623 Ga0068857_1000116232 254
134 3300005578 Ga0068854_100136943 Ga0068854_1001369432 254
135 3300005614 Ga0068856_100261928 Ga0068856_1002619282 254
136 3300005842 Ga0068858_100240880 Ga0068858_1002408802 254
137 3300006237 Ga0097621_100061878 Ga0097621_1000618782 254
138 3300006358 Ga0068871_100001674 Ga0068871_1000016742 254
139 3300009545 Ga0105237_10097030 Ga0105237_100970302 254
140 3300010375 Ga0105239_10069944 Ga0105239_100699443 254
141 3300013105 Ga0157369_10000309 Ga0157369_1000030961 254
142 3300013296 Ga0157374_10070034 Ga0157374_100700342 254
143 3300013297 Ga0157378_10050323 Ga0157378_100503233 254
144 3300013307 Ga0157372_10001317 Ga0157372_100013172 254
145 3300013308 Ga0157375_10488144 Ga0157375_104881442 254
146 3300025912 Ga0207707_10038066 Ga0207707_100380662 254
147 3300025928 Ga0207700_10204949 Ga0207700_102049492 254
148 3300025945 Ga0207679_10217170 Ga0207679_102171702 254
149 3300025949 Ga0207667_10067914 Ga0207667_100679143 254
150 3300025981 Ga0207640_10024932 Ga0207640_100249322 254
151 3300026023 Ga0207677_10044663 Ga0207677_100446631 254
152 3300026035 Ga0207703_10236101 Ga0207703_102361012 254
153 3300026078 Ga0207702_10066098 Ga0207702_100660982 254
154 3300026116 Ga0207674_10005215 Ga0207674_100052152 254
155 3300048907 Ga0496104_0315761 Ga0496104_0315761_174_977 254
156 3300048912 Ga0496109_0318859 Ga0496109_0318859_477_1280 254
157 3300048915 Ga0496112_0157395 Ga0496112_0157395_1036_1839 254
158 3300005841 Ga0068863_100519209 Ga0068863_1005192092 255
159 3300009177 Ga0105248_10119433 Ga0105248_101194332 255
160 3300014968 Ga0157379_10370259 Ga0157379_103702592 255
161 3300021384 Ga0213876_10222069 Ga0213876_102220691 255
162 3300031548 Ga0307408_100329055 Ga0307408_1003290552 255
163 3300039437 Ga0436365_1065302 Ga0436365_1065302_201_977 255
164 3300000546 LJNas_1001068 LJNas_10010683 256
165 3300005293 Ga0065715_10182087 Ga0065715_101820871 256
166 3300005329 Ga0070683_100073239 Ga0070683_1000732392 256
167 3300005329 Ga0070683_100102370 Ga0070683_1001023702 256
168 3300005329 Ga0070683_100403897 Ga0070683_1004038972 256
169 3300005331 Ga0070670_100015491 Ga0070670_1000154912 256
170 3300005334 Ga0068869_100000075 Ga0068869_10000007511 256
171 3300005338 Ga0068868_100001557 Ga0068868_10000155716 256
172 3300005338 Ga0068868_100344322 Ga0068868_1003443221 256
173 3300005344 Ga0070661_100003311 Ga0070661_1000033119 256
174 3300005344 Ga0070661_100033503 Ga0070661_1000335032 256
175 3300005344 Ga0070661_100046043 Ga0070661_1000460434 256
176 3300005356 Ga0070674_100032198 Ga0070674_1000321984 256
177 3300005367 Ga0070667_100002745 Ga0070667_10000274514 256
178 3300005434 Ga0070709_10000025 Ga0070709_1000002523 256
179 3300005434 Ga0070709_10020681 Ga0070709_100206814 256
180 3300005435 Ga0070714_100025142 Ga0070714_1000251422 256
181 3300005435 Ga0070714_100068005 Ga0070714_1000680053 256
182 3300005435 Ga0070714_100241869 Ga0070714_1002418693 256
183 3300005435 Ga0070714_100253396 Ga0070714_1002533961 256
184 3300005435 Ga0070714_100384595 Ga0070714_1003845952 256
185 3300005436 Ga0070713_100026334 Ga0070713_1000263344 256
186 3300005436 Ga0070713_100328325 Ga0070713_1003283251 256
187 3300005436 Ga0070713_100670676 Ga0070713_1006706761 256
188 3300005439 Ga0070711_100188093 Ga0070711_1001880933 256
189 3300005439 Ga0070711_100264541 Ga0070711_1002645411 256
190 3300005439 Ga0070711_100477751 Ga0070711_1004777511 256
191 3300005455 Ga0070663_100041016 Ga0070663_1000410161 256
192 3300005455 Ga0070663_100052111 Ga0070663_1000521113 256
193 3300005455 Ga0070663_100086273 Ga0070663_1000862732 256
194 3300005456 Ga0070678_100116659 Ga0070678_1001166592 256
195 3300005457 Ga0070662_100133884 Ga0070662_1001338842 256
196 3300005530 Ga0070679_100011350 Ga0070679_1000113504 256
197 3300005530 Ga0070679_100263789 Ga0070679_1002637891 256
198 3300005535 Ga0070684_100000516 Ga0070684_1000005169 256
199 3300005535 Ga0070684_100046808 Ga0070684_1000468085 256
200 3300005539 Ga0068853_100000474 Ga0068853_1000004747 256
201 3300005539 Ga0068853_100002760 Ga0068853_1000027604 256
202 3300005539 Ga0068853_100589251 Ga0068853_1005892512 256
203 3300005546 Ga0070696_100073248 Ga0070696_1000732483 256
204 3300005548 Ga0070665_100001777 Ga0070665_1000017778 256
205 3300005548 Ga0070665_100012643 Ga0070665_1000126434 256
206 3300005549 Ga0070704_100012967 Ga0070704_1000129674 256
207 3300005563 Ga0068855_100002618 Ga0068855_10000261817 256
208 3300005563 Ga0068855_100003162 Ga0068855_10000316215 256
209 3300005563 Ga0068855_100132121 Ga0068855_1001321214 256
210 3300005563 Ga0068855_100476921 Ga0068855_1004769212 256
211 3300005564 Ga0070664_100607744 Ga0070664_1006077442 256
212 3300005577 Ga0068857_100007650 Ga0068857_10000765010 256
213 3300005577 Ga0068857_100019826 Ga0068857_1000198265 256
214 3300005577 Ga0068857_100022550 Ga0068857_1000225503 256
215 3300005577 Ga0068857_100450753 Ga0068857_1004507531 256
216 3300005578 Ga0068854_100049081 Ga0068854_1000490812 256
217 3300005614 Ga0068856_100001190 Ga0068856_1000011908 256
218 3300005614 Ga0068856_100002078 Ga0068856_10000207820 256
219 3300005614 Ga0068856_100006428 Ga0068856_1000064285 256
220 3300005614 Ga0068856_100007628 Ga0068856_1000076289 256
221 3300005614 Ga0068856_100016253 Ga0068856_1000162538 256
222 3300005616 Ga0068852_100000046 Ga0068852_10000004657 256
223 3300005616 Ga0068852_100000078 Ga0068852_10000007846 256
224 3300005616 Ga0068852_100083573 Ga0068852_1000835733 256
225 3300005617 Ga0068859_100020456 Ga0068859_1000204568 256
226 3300005618 Ga0068864_100002989 Ga0068864_1000029895 256
227 3300005718 Ga0068866_10022080 Ga0068866_100220803 256
228 3300005834 Ga0068851_10012742 Ga0068851_100127421 256
229 3300005834 Ga0068851_10020298 Ga0068851_100202983 256
230 3300005834 Ga0068851_10048202 Ga0068851_100482022 256
231 3300005834 Ga0068851_10048271 Ga0068851_100482713 256
232 3300005841 Ga0068863_100010964 Ga0068863_10001096411 256
233 3300005842 Ga0068858_100010050 Ga0068858_1000100505 256
234 3300005843 Ga0068860_100009498 Ga0068860_1000094986 256
235 3300005843 Ga0068860_100014067 Ga0068860_1000140674 256
236 3300005844 Ga0068862_100019940 Ga0068862_1000199402 256
237 3300005983 Ga0081540_1027891 Ga0081540_10278913 256
238 3300006028 Ga0070717_10042187 Ga0070717_100421874 256
239 3300006028 Ga0070717_10069048 Ga0070717_100690482 256
240 3300006173 Ga0070716_100049161 Ga0070716_1000491613 256
241 3300006175 Ga0070712_100376215 Ga0070712_1003762152 256
242 3300006178 Ga0075367_10217548 Ga0075367_102175482 256
243 3300006237 Ga0097621_100063183 Ga0097621_1000631832 256
244 3300006237 Ga0097621_100072019 Ga0097621_1000720192 256
245 3300006237 Ga0097621_100082669 Ga0097621_1000826692 256
246 3300006358 Ga0068871_100001065 Ga0068871_1000010655 256
247 3300006358 Ga0068871_100003942 Ga0068871_10000394211 256
248 3300006852 Ga0075433_10090932 Ga0075433_100909322 256
249 3300006871 Ga0075434_100013220 Ga0075434_1000132206 256
250 3300006871 Ga0075434_100713257 Ga0075434_1007132571 256
251 3300006914 Ga0075436_100012163 Ga0075436_1000121637 256
252 3300006914 Ga0075436_100022363 Ga0075436_1000223634 256
253 3300006931 Ga0097620_100020456 Ga0097620_1000204562 256
254 3300007076 Ga0075435_100012104 Ga0075435_1000121047 256
255 3300009093 Ga0105240_10000002 Ga0105240_100000021260 256
256 3300009093 Ga0105240_10000873 Ga0105240_1000087345 256
257 3300009093 Ga0105240_10001944 Ga0105240_1000194413 256
258 3300009093 Ga0105240_10022769 Ga0105240_100227693 256
259 3300009093 Ga0105240_10031415 Ga0105240_100314153 256
260 3300009093 Ga0105240_10036835 Ga0105240_100368354 256
261 3300009093 Ga0105240_10110891 Ga0105240_101108913 256
262 3300009094 Ga0111539_10044621 Ga0111539_100446213 256
263 3300009098 Ga0105245_10001560 Ga0105245_1000156020 256
264 3300009098 Ga0105245_10061799 Ga0105245_100617993 256
265 3300009098 Ga0105245_10070906 Ga0105245_100709063 256
266 3300009101 Ga0105247_10004000 Ga0105247_1000400011 256
267 3300009147 Ga0114129_10188048 Ga0114129_101880482 256
268 3300009174 Ga0105241_10000203 Ga0105241_1000020322 256
269 3300009174 Ga0105241_10001995 Ga0105241_100019959 256
270 3300009174 Ga0105241_10004226 Ga0105241_100042264 256
271 3300009174 Ga0105241_10021460 Ga0105241_100214603 256
272 3300009174 Ga0105241_10025216 Ga0105241_100252163 256
273 3300009177 Ga0105248_10001549 Ga0105248_1000154913 256
274 3300009177 Ga0105248_10004769 Ga0105248_1000476916 256
275 3300009545 Ga0105237_10001830 Ga0105237_1000183020 256
276 3300009545 Ga0105237_10445348 Ga0105237_104453482 256
277 3300009551 Ga0105238_10002145 Ga0105238_1000214520 256
278 3300009551 Ga0105238_10004627 Ga0105238_100046275 256
279 3300009551 Ga0105238_10009579 Ga0105238_100095797 256
280 3300009551 Ga0105238_10014419 Ga0105238_100144193 256
281 3300009551 Ga0105238_10053031 Ga0105238_100530313 256
282 3300009551 Ga0105238_10094688 Ga0105238_100946882 256
283 3300009551 Ga0105238_10196658 Ga0105238_101966582 256
284 3300009551 Ga0105238_10409799 Ga0105238_104097992 256
285 3300009551 Ga0105238_10489522 Ga0105238_104895222 256
286 3300010375 Ga0105239_10003190 Ga0105239_1000319014 256
287 3300010375 Ga0105239_10030067 Ga0105239_100300672 256
288 3300010375 Ga0105239_10054980 Ga0105239_100549807 256
289 3300010375 Ga0105239_10292327 Ga0105239_102923273 256
290 3300011119 Ga0105246_10009119 Ga0105246_100091192 256
291 3300013104 Ga0157370_10001044 Ga0157370_1000104417 256
292 3300013104 Ga0157370_10073074 Ga0157370_100730743 256
293 3300013105 Ga0157369_10000182 Ga0157369_1000018210 256
294 3300013105 Ga0157369_10001053 Ga0157369_1000105321 256
295 3300013105 Ga0157369_10006652 Ga0157369_1000665210 256
296 3300013105 Ga0157369_10013201 Ga0157369_100132014 256
297 3300013105 Ga0157369_10037774 Ga0157369_100377745 256
298 3300013105 Ga0157369_10078882 Ga0157369_100788825 256
299 3300013296 Ga0157374_10013124 Ga0157374_1001312410 256
300 3300013296 Ga0157374_10023455 Ga0157374_100234554 256
301 3300013296 Ga0157374_10080117 Ga0157374_100801175 256
302 3300013297 Ga0157378_10000080 Ga0157378_1000008025 256
303 3300013297 Ga0157378_10005574 Ga0157378_1000557411 256
304 3300013297 Ga0157378_10040291 Ga0157378_100402915 256
305 3300013306 Ga0163162_10068594 Ga0163162_100685943 256
306 3300013306 Ga0163162_10101829 Ga0163162_101018293 256
307 3300013307 Ga0157372_10000768 Ga0157372_1000076821 256
308 3300013307 Ga0157372_10023937 Ga0157372_100239374 256
309 3300013307 Ga0157372_10028704 Ga0157372_100287046 256
310 3300013307 Ga0157372_10042036 Ga0157372_100420363 256
311 3300013307 Ga0157372_10106201 Ga0157372_101062012 256
312 3300013307 Ga0157372_10138745 Ga0157372_101387452 256
313 3300013307 Ga0157372_10265175 Ga0157372_102651753 256
314 3300013307 Ga0157372_10474828 Ga0157372_104748281 256
315 3300013308 Ga0157375_10001385 Ga0157375_100013855 256
316 3300014325 Ga0163163_10001619 Ga0163163_100016194 256
317 3300014325 Ga0163163_10292130 Ga0163163_102921302 256
318 3300014968 Ga0157379_10003945 Ga0157379_100039452 256
319 3300014969 Ga0157376_10000060 Ga0157376_1000006060 256
320 3300014969 Ga0157376_10002245 Ga0157376_1000224512 256
321 3300014969 Ga0157376_10040741 Ga0157376_100407411 256
322 3300017792 Ga0163161_10471983 Ga0163161_104719831 256
323 3300021361 Ga0213872_10001956 Ga0213872_100019566 256
324 3300021377 Ga0213874_10072254 Ga0213874_100722541 256
325 3300021388 Ga0213875_10000005 Ga0213875_100000058 256
326 3300025261 Ga0209233_1005731 Ga0209233_10057313 256
327 3300025321 Ga0207656_10018024 Ga0207656_100180242 256
328 3300025900 Ga0207710_10000905 Ga0207710_100009058 256
329 3300025904 Ga0207647_10019216 Ga0207647_100192165 256
330 3300025906 Ga0207699_10000036 Ga0207699_1000003623 256
331 3300025911 Ga0207654_10000019 Ga0207654_10000019133 256
332 3300025911 Ga0207654_10000334 Ga0207654_1000033422 256
333 3300025911 Ga0207654_10000384 Ga0207654_100003846 256
334 3300025913 Ga0207695_10000002 Ga0207695_100000021263 256
335 3300025913 Ga0207695_10000188 Ga0207695_1000018846 256
336 3300025913 Ga0207695_10000332 Ga0207695_1000033255 256
337 3300025913 Ga0207695_10000989 Ga0207695_1000098936 256
338 3300025913 Ga0207695_10001708 Ga0207695_1000170818 256
339 3300025913 Ga0207695_10023237 Ga0207695_100232372 256
340 3300025913 Ga0207695_10027992 Ga0207695_100279924 256
341 3300025913 Ga0207695_10204456 Ga0207695_102044562 256
342 3300025913 Ga0207695_10245338 Ga0207695_102453382 256
343 3300025914 Ga0207671_10000449 Ga0207671_1000044942 256
344 3300025914 Ga0207671_10000506 Ga0207671_100005064 256
345 3300025914 Ga0207671_10330775 Ga0207671_103307752 256
346 3300025917 Ga0207660_10563898 Ga0207660_105638981 256
347 3300025920 Ga0207649_10002605 Ga0207649_100026057 256
348 3300025920 Ga0207649_10020982 Ga0207649_100209822 256
349 3300025921 Ga0207652_10014880 Ga0207652_100148804 256
350 3300025921 Ga0207652_10381294 Ga0207652_103812942 256
351 3300025924 Ga0207694_10000076 Ga0207694_1000007693 256
352 3300025924 Ga0207694_10000102 Ga0207694_1000010263 256
353 3300025924 Ga0207694_10002367 Ga0207694_1000236710 256
354 3300025924 Ga0207694_10008422 Ga0207694_100084228 256
355 3300025924 Ga0207694_10040882 Ga0207694_100408822 256
356 3300025924 Ga0207694_10442091 Ga0207694_104420911 256
357 3300025925 Ga0207650_10004058 Ga0207650_1000405811 256
358 3300025927 Ga0207687_10009056 Ga0207687_100090562 256
359 3300025927 Ga0207687_10082799 Ga0207687_100827992 256
360 3300025927 Ga0207687_10292001 Ga0207687_102920012 256
361 3300025929 Ga0207664_10022722 Ga0207664_100227224 256
362 3300025929 Ga0207664_10153069 Ga0207664_101530693 256
363 3300025929 Ga0207664_10184798 Ga0207664_101847982 256
364 3300025929 Ga0207664_10285424 Ga0207664_102854242 256
365 3300025929 Ga0207664_10618283 Ga0207664_106182831 256
366 3300025931 Ga0207644_10044485 Ga0207644_100444853 256
367 3300025931 Ga0207644_10448290 Ga0207644_104482901 256
368 3300025933 Ga0207706_10044673 Ga0207706_100446735 256
369 3300025939 Ga0207665_10011705 Ga0207665_100117052 256
370 3300025939 Ga0207665_10441451 Ga0207665_104414511 256
371 3300025941 Ga0207711_10003748 Ga0207711_1000374816 256
372 3300025942 Ga0207689_10000954 Ga0207689_1000095416 256
373 3300025944 Ga0207661_10010552 Ga0207661_100105522 256
374 3300025944 Ga0207661_10018981 Ga0207661_100189812 256
375 3300025944 Ga0207661_10156826 Ga0207661_101568261 256
376 3300025945 Ga0207679_10229982 Ga0207679_102299822 256
377 3300025945 Ga0207679_10734431 Ga0207679_107344311 256
378 3300025949 Ga0207667_10000442 Ga0207667_100004424 256
379 3300025949 Ga0207667_10010139 Ga0207667_100101399 256
380 3300025949 Ga0207667_10011777 Ga0207667_100117778 256
381 3300025949 Ga0207667_10122829 Ga0207667_101228291 256
382 3300025986 Ga0207658_10001428 Ga0207658_100014288 256
383 3300026023 Ga0207677_10000337 Ga0207677_1000033711 256
384 3300026035 Ga0207703_10006388 Ga0207703_1000638811 256
385 3300026041 Ga0207639_10000027 Ga0207639_10000027149 256
386 3300026041 Ga0207639_10014559 Ga0207639_100145594 256
387 3300026041 Ga0207639_10392540 Ga0207639_103925401 256
388 3300026067 Ga0207678_10077196 Ga0207678_100771962 256
389 3300026067 Ga0207678_10111535 Ga0207678_101115352 256
390 3300026067 Ga0207678_10432370 Ga0207678_104323701 256
391 3300026078 Ga0207702_10000307 Ga0207702_100003078 256
392 3300026078 Ga0207702_10000415 Ga0207702_1000041538 256
393 3300026078 Ga0207702_10001959 Ga0207702_1000195916 256
394 3300026078 Ga0207702_10021160 Ga0207702_100211605 256
395 3300026078 Ga0207702_10249222 Ga0207702_102492222 256
396 3300026088 Ga0207641_10001797 Ga0207641_1000179721 256
397 3300026095 Ga0207676_10006773 Ga0207676_100067734 256
398 3300026116 Ga0207674_10001941 Ga0207674_1000194118 256
399 3300026116 Ga0207674_10002941 Ga0207674_100029414 256
400 3300026116 Ga0207674_10121498 Ga0207674_101214982 256
401 3300026116 Ga0207674_10361781 Ga0207674_103617812 256
402 3300026142 Ga0207698_10000227 Ga0207698_1000022720 256
403 3300026142 Ga0207698_10004352 Ga0207698_100043528 256
404 3300026142 Ga0207698_10039372 Ga0207698_100393723 256
405 3300026142 Ga0207698_10051416 Ga0207698_100514162 256
406 3300026142 Ga0207698_10292019 Ga0207698_102920191 256
407 3300028379 Ga0268266_10000529 Ga0268266_1000052926 256
408 3300028379 Ga0268266_10010914 Ga0268266_100109143 256
409 3300028379 Ga0268266_10203781 Ga0268266_102037812 256
410 3300028381 Ga0268264_10000765 Ga0268264_1000076517 256
411 3300028381 Ga0268264_10010808 Ga0268264_100108084 256
412 3300028800 Ga0265338_10002893 Ga0265338_100028934 256
413 3300028800 Ga0265338_10135720 Ga0265338_101357202 256
414 3300031249 Ga0265339_10062370 Ga0265339_100623702 256
415 3300031595 Ga0265313_10094950 Ga0265313_100949502 256
416 3300031712 Ga0265342_10107156 Ga0265342_101071562 256
417 3300036401 Ga0373937_0002940 Ga0373937_0002940_2443_3219 256
418 3300036401 Ga0373937_0803673 Ga0373937_0803673_51_833 256
419 3300037418 Ga0395900_0260600 Ga0395900_0260600_594_1364 256
420 3300037853 Ga0436364_0080170 Ga0436364_0080170_5709_6485 256
421 3300039437 Ga0436365_0120080 Ga0436365_0120080_134_919 256
422 3300039438 Ga0436360_0512858 Ga0436360_0512858_694_1476 256
423 3300039438 Ga0436360_0925333 Ga0436360_0925333_287_1069 256
424 3300039447 Ga0436361_0237725 Ga0436361_0237725_12559_13341 256
425 3300039447 Ga0436361_0623560 Ga0436361_0623560_2846_3628 256
426 3300044673 Ga0453683_0001178 Ga0453683_0001178_20802_21572 256
427 3300045836 Ga0466958_0044425 Ga0466958_0044425_1782_2642 256
428 3300045976 Ga0466967_0046694 Ga0466967_0046694_2438_3220 256
429 3300046473 Ga0495582_0303048 Ga0495582_0303048_90_878 256
430 3300046499 Ga0495594_0141726 Ga0495594_0141726_507_1286 256
431 3300046543 Ga0495645_0013453 Ga0495645_0013453_2423_3193 256
432 3300046679 Ga0495623_0215379 Ga0495623_0215379_22_798 256
433 3300046684 Ga0495669_0078084 Ga0495669_0078084_545_1339 256
434 3300047472 Ga0495686_0005986 Ga0495686_0005986_3979_4749 256
435 3300047472 Ga0495686_0030521 Ga0495686_0030521_2153_2923 256
436 3300048905 Ga0496102_0009812 Ga0496102_0009812_524_1306 256
437 3300048905 Ga0496102_0265270 Ga0496102_0265270_485_1279 256
438 3300048907 Ga0496104_0003612 Ga0496104_0003612_10940_11710 256
439 3300048907 Ga0496104_0152528 Ga0496104_0152528_815_1609 256
440 3300048907 Ga0496104_0240603 Ga0496104_0240603_643_1419 256
441 3300048907 Ga0496104_0286653 Ga0496104_0286653_262_1044 256
442 3300048912 Ga0496109_0078235 Ga0496109_0078235_1315_2109 256
443 3300048913 Ga0496110_0312502 Ga0496110_0312502_143_937 256
444 3300048914 Ga0496111_0137744 Ga0496111_0137744_391_1185 256
445 3300048915 Ga0496112_0179426 Ga0496112_0179426_465_1259 256
446 3300048915 Ga0496112_0243201 Ga0496112_0243201_525_1301 256
447 3300048915 Ga0496112_0449735 Ga0496112_0449735_186_968 256
448 3300048916 Ga0496113_0065399 Ga0496113_0065399_1239_2033 256
449 3300048917 Ga0496114_0051613 Ga0496114_0051613_2336_3136 256
450 3300048918 Ga0496115_0183955 Ga0496115_0183955_185_967 256
451 3300048918 Ga0496115_0366589 Ga0496115_0366589_339_1133 256
452 3300048929 Ga0496126_0006120 Ga0496126_0006120_4049_4819 256
453 3300048929 Ga0496126_0030729 Ga0496126_0030729_3192_3980 256
454 3300050507 nmdc:mga05p37_154354_c1 nmdc:mga05p37_154354_c1_1098_1880 256
455 3300050511 nmdc:mga08y16_67217_c1 nmdc:mga08y16_67217_c1_2090_2875 256
456 3300050512 nmdc:mga0n895_15354_c1 nmdc:mga0n895_15354_c1_2649_3428 256
457 3300050512 nmdc:mga0n895_21254_c1 nmdc:mga0n895_21254_c1_781_1551 256
458 3300050513 nmdc:mga0rr50_339657_c1 nmdc:mga0rr50_339657_c1_344_1123 256
459 3300050514 nmdc:mga08x19_3532_c1 nmdc:mga08x19_3532_c1_7478_8266 256
460 3300050514 nmdc:mga08x19_8576_c1 nmdc:mga08x19_8576_c1_4428_5216 256
461 3300053077 Ga0495601_0144803 Ga0495601_0144803_312_1082 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

37

227

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

43

278

0.95

PF08659

KR

KR domain

38

212

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ew8-assembly1.cif.gz_D crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.9744 2 242
2ew8-assembly1.cif.gz_C crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.9702 2 242
2ewm-assembly1.cif.gz_A-2 crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.9682 2 242
4za2-assembly1.cif.gz_C crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d-gluconate dehydrogenase complexed with nad+ 0.9677 2 242
8jf9-assembly1.cif.gz_C crystal structure of 3-oxoacyl-acp reductase fabg from helicobacter pylori 0.9647 1 242
ID Description Score Start End Superfamily
af_Q54N15_5_159_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9672 54 173 3.40.50.720
4y98A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9627 2 179 3.40.50.720
2ewmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.96 2 242 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9596 2 179 3.40.50.720
4yxfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9581 1 242 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2W6T3P7-F1-model_v4 Short-chain dehydrogenase 0.9764 2 178 GO:0016491
AF-A0A7C7JRJ5-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9754 2 138
AF-A0A383B9X5-F1-model_v4 Uncharacterized protein 0.9738 2 118 GO:0016616
AF-A0A1F4BCM0-F1-model_v4 3-oxoacyl-ACP reductase 0.9715 2 183 GO:0016491
AF-A8L1M9-F1-model_v4 deleted 0.9712 2 243

Feature Viewer

pLDDT pTM Quality
94.06 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map