F448712

General Info

Members Datasets Scaffolds Average Seq Length
461 230 848 224

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100009061|Ga0075436_1000090613
Length 229
Sequence MLGVLYDVHGNLPALEAVLAEAESEDVDEWLLGGDYCAFGPWPVETLARLRELPNATWIRGNGERWLVDPPQDLPTEALEFIHAALASSIAQLPAADVDWLIGLPAFADREDAFYCHGSPRSDVDSFAPDPRDDDERLLAGVKERQVVFGHSHVQFRRPGPNDTDLVNPGSVGMPLDGDTRAAWAVRPTNGDIELRRTAYDVAPAVEKMREYDWGERVAQRLLNGRDPG

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
130 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
131 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
132 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
133 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
134 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
135 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
136 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
137 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
138 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
139 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
140 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
158 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
165 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.36
Rhizosphere 87.2
Stem 0
Stem Tuber 0
Unclassified 6.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100009061 3300006914 Bacteria 6809
2 JGI25407J50210_10000476 3300003373 Bacteria 7941
3 Ga0070676_10501122 3300005328 Bacteria 862
4 Ga0070683_100042256 3300005329 Bacteria 4197
5 Ga0070683_100091951 3300005329 Bacteria 2849
6 Ga0068869_100172635 3300005334 Bacteria 1690
7 Ga0070682_100163790 3300005337 Bacteria 1538
8 Ga0068868_100037067 3300005338 Bacteria 3778
9 Ga0070660_100172476 3300005339 Bacteria 1747
10 Ga0070689_100760376 3300005340 Bacteria 850
11 Ga0070692_10034578 3300005345 Bacteria 2553
12 Ga0070675_100404860 3300005354 Bacteria 1218
13 Ga0070671_100039515 3300005355 Bacteria 3916
14 Ga0070674_100199960 3300005356 Bacteria 1543
15 Ga0070673_100080448 3300005364 Bacteria 2640
16 Ga0070667_100817285 3300005367 Bacteria 866
17 Ga0070703_10144808 3300005406 Bacteria 887
18 Ga0070709_10108429 3300005434 Bacteria 1862
19 Ga0070709_10139453 3300005434 Bacteria 1664
20 Ga0070709_10174496 3300005434 Unclassified 1505
21 Ga0070709_10305828 3300005434 Bacteria 1162
22 Ga0070709_10459491 3300005434 Bacteria 960
23 Ga0070714_100062291 3300005435 Bacteria 3205
24 Ga0070714_100229543 3300005435 Bacteria 1709
25 Ga0070714_100541685 3300005435 Bacteria 1113
26 Ga0070714_100653144 3300005435 Bacteria 1013
27 Ga0070713_100315463 3300005436 Bacteria 1443
28 Ga0070710_10083192 3300005437 Bacteria 1872
29 Ga0070710_10157006 3300005437 Bacteria 1407
30 Ga0070710_10161067 3300005437 Unclassified 1391
31 Ga0070701_10093682 3300005438 Bacteria 1651
32 Ga0070711_100036314 3300005439 Bacteria 3301
33 Ga0070711_100101632 3300005439 Bacteria 2092
34 Ga0070711_100330184 3300005439 Bacteria 1221
35 Ga0070705_100011964 3300005440 Archaea 4395
36 Ga0070705_100034439 3300005440 Bacteria 2831
37 Ga0070705_100041314 3300005440 Bacteria 2628
38 Ga0070700_100012175 3300005441 Bacteria 4790
39 Ga0070694_100005563 3300005444 Bacteria 7632
40 Ga0070708_100016917 3300005445 Bacteria 6065
41 Ga0070708_100034985 3300005445 Bacteria 4374
42 Ga0070708_100170239 3300005445 Unclassified 2033
43 Ga0070708_100203542 3300005445 Bacteria 1854
44 Ga0070663_100063398 3300005455 Bacteria 2668
45 Ga0070678_100071811 3300005456 Bacteria 2592
46 Ga0070678_100073814 3300005456 Bacteria 2561
47 Ga0070678_100142630 3300005456 Bacteria 1919
48 Ga0070662_100032082 3300005457 Bacteria 3691
49 Ga0070662_100038302 3300005457 Bacteria 3406
50 Ga0070662_100218693 3300005457 Bacteria 1519
51 Ga0068867_100047016 3300005459 Bacteria 3171
52 Ga0070706_100023834 3300005467 Bacteria 5634
53 Ga0070706_100159415 3300005467 Unclassified 2107
54 Ga0070707_100002932 3300005468 Bacteria 16176
55 Ga0070707_100243905 3300005468 Bacteria 1748
56 Ga0070698_100035746 3300005471 Bacteria 5134
57 Ga0070698_100188431 3300005471 Bacteria 2001
58 Ga0070699_100085497 3300005518 Bacteria 2752
59 Ga0070699_100169761 3300005518 Bacteria 1933
60 Ga0070679_101030971 3300005530 Bacteria 767
61 Ga0070684_100001986 3300005535 Bacteria 15040
62 Ga0070684_100141154 3300005535 Bacteria 2178
63 Ga0070697_100149759 3300005536 Bacteria 1966
64 Ga0070697_100388107 3300005536 Bacteria 1210
65 Ga0070697_100823620 3300005536 Bacteria 822
66 Ga0068853_100696214 3300005539 Bacteria 969
67 Ga0068853_100835798 3300005539 Bacteria 883
68 Ga0070686_100326918 3300005544 Bacteria 1145
69 Ga0070695_100036309 3300005545 Bacteria 3100
70 Ga0070695_100128705 3300005545 Bacteria 1742
71 Ga0070696_100051458 3300005546 Bacteria 2865
72 Ga0070696_100061971 3300005546 Bacteria 2617
73 Ga0070696_100069296 3300005546 Bacteria 2478
74 Ga0070696_100220904 3300005546 Bacteria 1422
75 Ga0070693_100064766 3300005547 Bacteria 2135
76 Ga0070693_100179519 3300005547 Bacteria 1362
77 Ga0070693_100295073 3300005547 Unclassified 1091
78 Ga0070704_100017972 3300005549 Bacteria 4510
79 Ga0070704_100045921 3300005549 Bacteria 3042
80 Ga0070704_100101093 3300005549 Bacteria 2172
81 Ga0068855_100029159 3300005563 Bacteria 6599
82 Ga0068855_100427661 3300005563 Bacteria 1448
83 Ga0068857_100047021 3300005577 Bacteria 3830
84 Ga0068854_100303032 3300005578 Bacteria 1293
85 Ga0070702_100186217 3300005615 Bacteria 1362
86 Ga0068852_100160825 3300005616 Bacteria 2097
87 Ga0068866_10134848 3300005718 Bacteria 1409
88 Ga0068861_100198982 3300005719 Bacteria 1681
89 Ga0068861_100464430 3300005719 Unclassified 1137
90 Ga0068860_100262728 3300005843 Bacteria 1683
91 Ga0081455_10004665 3300005937 Bacteria 15258
92 Ga0081538_10000100 3300005981 Bacteria 83917
93 Ga0081540_1004132 3300005983 Bacteria 11195
94 Ga0081540_1012143 3300005983 Bacteria 5696
95 Ga0081540_1035062 3300005983 Bacteria 2696
96 Ga0070717_10433832 3300006028 Bacteria 1183
97 Ga0075432_10046374 3300006058 Unclassified 1526
98 Ga0075432_10107537 3300006058 Bacteria 1036
99 Ga0075432_10109655 3300006058 Unclassified 1027
100 Ga0070715_10005649 3300006163 Bacteria 4189
101 Ga0070715_10192453 3300006163 Bacteria 1031
102 Ga0070716_100068663 3300006173 Bacteria 2074
103 Ga0070716_100090561 3300006173 Bacteria 1850
104 Ga0070712_100007113 3300006175 Bacteria 6983
105 Ga0070712_100053002 3300006175 Bacteria 2831
106 Ga0070712_100073669 3300006175 Bacteria 2450
107 Ga0070712_100321410 3300006175 Bacteria 1258
108 Ga0097621_100045705 3300006237 Bacteria 3538
109 Ga0097621_100560123 3300006237 Bacteria 1041
110 Ga0068871_100022759 3300006358 Bacteria 4836
111 Ga0075428_100104204 3300006844 Bacteria 3093
112 Ga0075430_100138135 3300006846 Bacteria 2030
113 Ga0075433_10036298 3300006852 Bacteria 4245
114 Ga0075433_10075303 3300006852 Bacteria 2970
115 Ga0075433_10088963 3300006852 Bacteria 2729
116 Ga0075434_100039451 3300006871 Bacteria 4679
117 Ga0075434_100059368 3300006871 Bacteria 3802
118 Ga0075434_100171567 3300006871 Bacteria 2189
119 Ga0075434_100325113 3300006871 Unclassified 1558
120 Ga0075429_100045632 3300006880 Bacteria 3813
121 Ga0068865_100110088 3300006881 Bacteria 2030
122 Ga0075436_100004199 3300006914 Bacteria 9884
123 Ga0075436_100078828 3300006914 Bacteria 2281
124 Ga0075436_100141984 3300006914 Bacteria 1688
125 Ga0075435_100042274 3300007076 Bacteria 3646
126 Ga0075435_100059453 3300007076 Bacteria 3098
127 Ga0075435_100070504 3300007076 Unclassified 2853
128 Ga0075435_100123700 3300007076 Bacteria 2160
129 Ga0075435_100158013 3300007076 Bacteria 1908
130 Ga0111539_10071956 3300009094 Bacteria 4079
131 Ga0111539_10117174 3300009094 Bacteria 3122
132 Ga0111539_10125504 3300009094 Bacteria 3007
133 Ga0111539_10424687 3300009094 Bacteria 1548
134 Ga0105245_10039198 3300009098 Bacteria 4217
135 Ga0105245_10106238 3300009098 Bacteria 2605
136 Ga0114129_10111421 3300009147 Bacteria 3776
137 Ga0114129_10196953 3300009147 Bacteria 2731
138 Ga0114129_11108187 3300009147 Bacteria 991
139 Ga0105243_10175922 3300009148 Unclassified 1857
140 Ga0105243_10233256 3300009148 Unclassified 1634
141 Ga0105243_10283626 3300009148 Bacteria 1493
142 Ga0105241_10174542 3300009174 Bacteria 1777
143 Ga0105242_10860695 3300009176 Bacteria 903
144 Ga0105248_10079950 3300009177 Bacteria 3674
145 Ga0105238_10170312 3300009551 Bacteria 2153
146 Ga0105249_10488939 3300009553 Bacteria 1274
147 Ga0105239_10024547 3300010375 Bacteria 6641
148 Ga0105239_10661688 3300010375 Unclassified 1193
149 Ga0105246_10292192 3300011119 Bacteria 1312
150 Ga0157320_1003340 3300012481 Bacteria 967
151 Ga0157371_10067452 3300013102 Bacteria 2532
152 Ga0157374_10081675 3300013296 Bacteria 3067
153 Ga0157378_10064968 3300013297 Bacteria 3265
154 Ga0157378_10281842 3300013297 Bacteria 1602
155 Ga0157372_10006256 3300013307 Bacteria 12663
156 Ga0157372_10369985 3300013307 Bacteria 1670
157 Ga0157375_10279885 3300013308 Bacteria 1831
158 Ga0157380_10256881 3300014326 Bacteria 1585
159 Ga0182008_10176089 3300014497 Bacteria 1081
160 Ga0157376_10063066 3300014969 Bacteria 3121
161 Ga0157376_10431925 3300014969 Bacteria 1280
162 Ga0207653_10001262 3300025885 Bacteria 8253
163 Ga0207653_10043493 3300025885 Bacteria 1479
164 Ga0207692_10125215 3300025898 Bacteria 1444
165 Ga0207692_10178328 3300025898 Bacteria 1236
166 Ga0207642_10035140 3300025899 Bacteria 2137
167 Ga0207685_10040129 3300025905 Bacteria 1743
168 Ga0207685_10099354 3300025905 Bacteria 1241
169 Ga0207699_10030425 3300025906 Bacteria 3021
170 Ga0207699_10086037 3300025906 Bacteria 1962
171 Ga0207645_10272216 3300025907 Bacteria 1123
172 Ga0207684_10349155 3300025910 Bacteria 1273
173 Ga0207684_10546705 3300025910 Unclassified 991
174 Ga0207693_10001565 3300025915 Bacteria 20201
175 Ga0207693_10014532 3300025915 Bacteria 6327
176 Ga0207693_10014545 3300025915 Bacteria 6324
177 Ga0207693_10025569 3300025915 Bacteria 4680
178 Ga0207693_10032554 3300025915 Bacteria 4114
179 Ga0207663_10009469 3300025916 Bacteria 5145
180 Ga0207663_10067453 3300025916 Bacteria 2294
181 Ga0207660_10217723 3300025917 Bacteria 1497
182 Ga0207660_10245704 3300025917 Bacteria 1411
183 Ga0207657_10195079 3300025919 Bacteria 1632
184 Ga0207646_10219130 3300025922 Bacteria 1719
185 Ga0207646_10355959 3300025922 Unclassified 1322
186 Ga0207681_10075851 3300025923 Bacteria 2360
187 Ga0207687_10028163 3300025927 Bacteria 3774
188 Ga0207687_10067345 3300025927 Bacteria 2547
189 Ga0207687_10193951 3300025927 Bacteria 1583
190 Ga0207700_10038735 3300025928 Bacteria 3463
191 Ga0207700_10485943 3300025928 Bacteria 1091
192 Ga0207664_10061083 3300025929 Bacteria 3005
193 Ga0207664_10118083 3300025929 Bacteria 2215
194 Ga0207664_10220869 3300025929 Bacteria 1643
195 Ga0207644_10053837 3300025931 Bacteria 2897
196 Ga0207644_10410051 3300025931 Bacteria 1109
197 Ga0207706_10010201 3300025933 Bacteria 8593
198 Ga0207669_10508880 3300025937 Bacteria 965
199 Ga0207665_10010951 3300025939 Bacteria 5953
200 Ga0207665_10033583 3300025939 Bacteria 3402
201 Ga0207665_10039148 3300025939 Bacteria 3160
202 Ga0207665_10078531 3300025939 Bacteria 2267
203 Ga0207711_10125920 3300025941 Bacteria 2292
204 Ga0207689_10363775 3300025942 Bacteria 1203
205 Ga0207661_10023368 3300025944 Bacteria 4670
206 Ga0207661_10244731 3300025944 Bacteria 1592
207 Ga0207679_10696465 3300025945 Bacteria 922
208 Ga0207667_10248263 3300025949 Bacteria 1821
209 Ga0207651_10145146 3300025960 Bacteria 1839
210 Ga0207712_10486320 3300025961 Bacteria 1053
211 Ga0207668_10075480 3300025972 Bacteria 2424
212 Ga0207677_10024371 3300026023 Bacteria 3758
213 Ga0207677_10048281 3300026023 Bacteria 2865
214 Ga0207677_10192684 3300026023 Bacteria 1613
215 Ga0207678_10014118 3300026067 Bacteria 7025
216 Ga0207708_10000684 3300026075 Bacteria 25753
217 Ga0207702_10078050 3300026078 Bacteria 2866
218 Ga0207702_10215414 3300026078 Bacteria 1787
219 Ga0207702_10275154 3300026078 Unclassified 1589
220 Ga0207648_10011247 3300026089 Bacteria 8438
221 Ga0207674_10006781 3300026116 Bacteria 13436
222 Ga0207674_10098356 3300026116 Bacteria 2909
223 Ga0207675_100053037 3300026118 Bacteria 3785
224 Ga0207675_100099823 3300026118 Unclassified 2734
225 Ga0207683_10002760 3300026121 Bacteria 15343
226 Ga0207683_10016327 3300026121 Bacteria 6320
227 Ga0207683_10108394 3300026121 Bacteria 2485
228 Ga0207698_10895446 3300026142 Unclassified 894
229 Ga0209966_1017751 3300027695 Unclassified 1358
230 Ga0207428_10035504 3300027907 Bacteria 4075
231 Ga0207428_10038504 3300027907 Bacteria 3887
232 Ga0207428_10179539 3300027907 Bacteria 1600
233 Ga0268264_10017058 3300028381 Bacteria 5946
234 Ga0373948_0032060 3300034817 Bacteria 1064
235 Ga0373950_0001343 3300034818 Bacteria 3191
236 Ga0373950_0012224 3300034818 Bacteria 1416
237 Ga0373958_0000492 3300034819 Bacteria 4871
238 Ga0373928_0016191 3300035084 Bacteria 1524
239 Ga0373929_0003009 3300035085 Bacteria 3069
240 Ga0373940_0003956 3300035088 Bacteria 3087
241 Ga0373949_0020155 3300035090 Bacteria 1524
242 Ga0373949_0035824 3300035090 Bacteria 1201
243 Ga0373951_0006568 3300035091 Bacteria 2659
244 Ga0373951_0071013 3300035091 Bacteria 887
245 Ga0373952_0039281 3300035092 Bacteria 1087
246 Ga0373939_0037726 3300035114 Bacteria 1437
247 Ga0373939_0040898 3300035114 Bacteria 1395
248 Ga0373939_0156712 3300035114 Unclassified 833
249 Ga0373941_0037895 3300035115 Bacteria 1473
250 Ga0373941_0048210 3300035115 Bacteria 1344
251 Ga0373960_0065102 3300035121 Bacteria 1114
252 Ga0373943_0000198 3300035170 Bacteria 24537
253 Ga0373946_0183766 3300035171 Unclassified 993
254 Ga0373942_0008675 3300035207 Bacteria 2373
255 Ga0373961_0065866 3300035241 Bacteria 1110
256 Ga0373961_0093820 3300035241 Bacteria 962
257 Ga0373962_0005846 3300035242 Bacteria 2969
258 Ga0373927_0085134 3300035695 Bacteria 2051
259 Ga0373947_0000463 3300035725 Bacteria 23167
260 Ga0373947_0160722 3300035725 Bacteria 1453
261 Ga0373925_0032727 3300037068 Bacteria 3828
262 Ga0395899_0004359 3300037312 Bacteria 11035
263 Ga0395899_0073697 3300037312 Bacteria 2496
264 Ga0395900_0017598 3300037418 Bacteria 7292
265 Ga0395900_0073556 3300037418 Bacteria 3514
266 Ga0395900_0077058 3300037418 Bacteria 3425
267 Ga0395900_0116164 3300037418 Bacteria 2745
268 Ga0395900_0139786 3300037418 Bacteria 2480
269 Ga0395900_0230394 3300037418 Bacteria 1863
270 Ga0395898_0010803 3300037466 Bacteria 9540
271 Ga0395898_0033673 3300037466 Bacteria 5110
272 Ga0395898_0055641 3300037466 Bacteria 3858
273 Ga0395898_0252268 3300037466 Bacteria 1683
274 Ga0395898_0311588 3300037466 Unclassified 1501
275 Ga0395898_0412415 3300037466 Unclassified 1288
276 Ga0395905_0015724 3300037471 Bacteria 7189
277 Ga0395905_0016260 3300037471 Bacteria 7068
278 Ga0395905_0039848 3300037471 Bacteria 4408
279 Ga0395905_0074025 3300037471 Bacteria 3192
280 Ga0395905_0113422 3300037471 Bacteria 2546
281 Ga0395905_0246072 3300037471 Bacteria 1671
282 Ga0395905_0452865 3300037471 Bacteria 1181
283 Ga0395901_0002954 3300038443 Bacteria 17159
284 Ga0395901_0011023 3300038443 Bacteria 9157
285 Ga0395901_0039196 3300038443 Bacteria 4903
286 Ga0395901_0167338 3300038443 Bacteria 2307
287 Ga0395901_0191189 3300038443 Bacteria 2147
288 Ga0395901_0242001 3300038443 Bacteria 1882
289 Ga0395901_0250663 3300038443 Bacteria 1844
290 Ga0395901_1097271 3300038443 Bacteria 766
291 Ga0451802_1855425 3300041460 Bacteria 1585
292 Ga0451853_0919351 3300041512 Bacteria 8713
293 Ga0451853_3749003 3300041512 Bacteria 2113
294 Ga0439448_0002189 3300042005 Bacteria 5280
295 Ga0439448_0004023 3300042005 Bacteria 4130
296 Ga0439455_0026258 3300042012 Bacteria 1421
297 Ga0466965_0087193 3300044683 Bacteria 1584
298 Ga0466964_0087368 3300044706 Bacteria 1350
299 Ga0466968_0082465 3300044735 Bacteria 1415
300 Ga0466960_0011020 3300044901 Bacteria 3767
301 Ga0466960_0016233 3300044901 Bacteria 3225
302 Ga0466960_0188907 3300044901 Bacteria 1120
303 Ga0466967_0025521 3300045976 Bacteria 4875
304 Ga0495603_0000081 3300046455 Bacteria 42501
305 Ga0495591_104933 3300046458 Bacteria 698
306 Ga0495641_0124610 3300046461 Bacteria 1149
307 Ga0495582_0039845 3300046473 Bacteria 2586
308 Ga0495585_0081498 3300046492 Bacteria 1753
309 Ga0495622_0104528 3300046557 Unclassified 1297
310 Ga0495588_0092186 3300046674 Bacteria 1587
311 Ga0495647_0025272 3300046681 Bacteria 2169
312 Ga0495658_0027270 3300046683 Bacteria 3072
313 Ga0495676_0002817 3300047321 Bacteria 15665
314 Ga0496100_0140463 3300048903 Bacteria 1711
315 Ga0496100_0181672 3300048903 Bacteria 1522
316 Ga0496100_0346799 3300048903 Bacteria 1120
317 Ga0496100_0402641 3300048903 Bacteria 1042
318 Ga0496101_0088133 3300048904 Bacteria 2304
319 Ga0496101_0179150 3300048904 Bacteria 1631
320 Ga0496101_0315987 3300048904 Bacteria 1225
321 Ga0496101_0332570 3300048904 Bacteria 1192
322 Ga0496102_0018999 3300048905 Bacteria 6047
323 Ga0496103_0066267 3300048906 Bacteria 2253
324 Ga0496103_0250646 3300048906 Bacteria 1139
325 Ga0496104_0134160 3300048907 Bacteria 2378
326 Ga0496104_0376364 3300048907 Bacteria 1332
327 Ga0496104_0497760 3300048907 Bacteria 1130
328 Ga0496105_0004904 3300048908 Bacteria 10116
329 Ga0496105_0071165 3300048908 Bacteria 2874
330 Ga0496105_0079531 3300048908 Bacteria 2707
331 Ga0496106_0185526 3300048909 Bacteria 1652
332 Ga0496106_0190711 3300048909 Bacteria 1629
333 Ga0496106_0278574 3300048909 Bacteria 1340
334 Ga0496106_0304837 3300048909 Bacteria 1277
335 Ga0496107_0058611 3300048910 Bacteria 2784
336 Ga0496107_0073761 3300048910 Bacteria 2482
337 Ga0496107_0239092 3300048910 Bacteria 1351
338 Ga0496108_0253047 3300048911 Bacteria 1532
339 Ga0496108_0362966 3300048911 Bacteria 1264
340 Ga0496108_0528738 3300048911 Bacteria 1029
341 Ga0496109_0013595 3300048912 Bacteria 7068
342 Ga0496109_0037330 3300048912 Bacteria 4389
343 Ga0496109_0068731 3300048912 Unclassified 3247
344 Ga0496109_0134636 3300048912 Archaea 2308
345 Ga0496109_0273560 3300048912 Bacteria 1591
346 Ga0496110_0210110 3300048913 Bacteria 1769
347 Ga0496110_0416724 3300048913 Bacteria 1224
348 Ga0496110_0521900 3300048913 Bacteria 1080
349 Ga0496111_0003399 3300048914 Bacteria 9843
350 Ga0496111_0051053 3300048914 Bacteria 2986
351 Ga0496111_0094918 3300048914 Bacteria 2188
352 Ga0496111_0437086 3300048914 Bacteria 966
353 Ga0496111_0562074 3300048914 Bacteria 837
354 Ga0496112_0011968 3300048915 Bacteria 7952
355 Ga0496112_0020763 3300048915 Bacteria 6232
356 Ga0496112_0080915 3300048915 Bacteria 3212
357 Ga0496112_0224126 3300048915 Bacteria 1836
358 Ga0496112_0458933 3300048915 Bacteria 1211
359 Ga0496113_0001530 3300048916 Bacteria 12949
360 Ga0496113_0020831 3300048916 Bacteria 4617
361 Ga0496113_0141722 3300048916 Bacteria 1892
362 Ga0496113_0423367 3300048916 Bacteria 1069
363 Ga0496114_0113783 3300048917 Bacteria 2320
364 Ga0496114_0119291 3300048917 Bacteria 2267
365 Ga0496114_0267771 3300048917 Bacteria 1505
366 Ga0496115_0009459 3300048918 Bacteria 7239
367 Ga0501031_0003333 3300049568 Bacteria 10307
368 Ga0501032_0001554 3300049569 Bacteria 18314
369 Ga0501033_0000899 3300049570 Bacteria 27196
370 Ga0501036_0028150 3300049572 Bacteria 4750
371 Ga0501037_0068246 3300049573 Bacteria 2588
372 Ga0501038_0003802 3300049574 Bacteria 14046
373 Ga0501039_0009033 3300049575 Bacteria 7594
374 Ga0501040_0002266 3300049576 Bacteria 12360
375 Ga0501041_0000474 3300049577 Bacteria 20418
376 Ga0501042_0000930 3300049578 Bacteria 16501
377 Ga0501043_0000693 3300049579 Bacteria 29791
378 Ga0501046_0003310 3300049580 Bacteria 14805
379 Ga0501048_0000867 3300049582 Bacteria 22328
380 Ga0501068_0007288 3300049584 Bacteria 6127
381 Ga0501069_0000605 3300049585 Bacteria 16589
382 Ga0501069_0002145 3300049585 Bacteria 9937
383 Ga0501070_0001149 3300049586 Bacteria 23709
384 Ga0501071_0000677 3300049587 Bacteria 17791
385 Ga0501071_0465785 3300049587 Unclassified 968
386 Ga0501072_0087924 3300049588 Bacteria 2465
387 Ga0501073_0003204 3300049589 Bacteria 12288
388 Ga0501074_0020219 3300049590 Bacteria 4837
389 Ga0501075_0003562 3300049591 Bacteria 10426
390 Ga0501075_0216235 3300049591 Bacteria 1462
391 Ga0501076_0042546 3300049592 Bacteria 3576
392 Ga0501077_0008185 3300049593 Bacteria 6465
393 Ga0501079_0025541 3300049741 Bacteria 4528
394 Ga0501080_0021752 3300049742 Bacteria 5941
395 Ga0501081_0002176 3300049743 Bacteria 12311
396 Ga0501083_0001492 3300049744 Bacteria 15962
397 Ga0501035_0001594 3300049822 Bacteria 22969
398 Ga0501044_0042132 3300049823 Bacteria 4751
399 Ga0501045_0005255 3300049824 Bacteria 8957
400 nmdc:mga05p37_239245_c1 3300050507 Bacteria 2184
401 nmdc:mga05p37_296507_c1 3300050507 Bacteria 1923
402 nmdc:mga05p37_34008_c1 3300050507 Bacteria 6244
403 nmdc:mga09592_147306_c1 3300050508 Bacteria 2030
404 nmdc:mga0qj67_66404_c1 3300050509 Bacteria 2873
405 nmdc:mga06r32_199096_c1 3300050510 Bacteria 1991
406 nmdc:mga06r32_301786_c1 3300050510 Bacteria 1587
407 nmdc:mga08y16_237999_c1 3300050511 Bacteria 1882
408 nmdc:mga08y16_30022_c1 3300050511 Bacteria 5725
409 nmdc:mga0n895_22631_c1 3300050512 Bacteria 5894
410 nmdc:mga0n895_416853_c1 3300050512 Bacteria 1358
411 nmdc:mga0n895_51885_c1 3300050512 Bacteria 4025
412 nmdc:mga0rr50_142337_c1 3300050513 Bacteria 1931
413 nmdc:mga0rr50_26218_c1 3300050513 Bacteria 4063
414 nmdc:mga0rr50_27403_c1 3300050513 Bacteria 3989
415 nmdc:mga08x19_36478_c1 3300050514 Bacteria 3114
416 nmdc:mga08x19_58179_c1 3300050514 Bacteria 2500
417 nmdc:mga0a205_163092_c1 3300050515 Bacteria 2125
418 nmdc:mga0a205_45720_c1 3300050515 Bacteria 4222
419 nmdc:mga0a205_54167_c1 3300050515 Archaea 3873
420 nmdc:mga0a205_67654_c1 3300050515 Bacteria 3451
421 Ga0501084_0158783 3300054114 Bacteria 1907
422 Ga0501082_0033951 3300060353 Bacteria 4400
423 Ga0501082_0276692 3300060353 Bacteria 1461
424 Ga0530510_0011066 3300061734 Bacteria 6328
425 Ga0075436_100009061
426 JGI25407J50210_10000476
427 Ga0070676_10501122
428 Ga0070683_100042256
429 Ga0070683_100091951
430 Ga0068869_100172635
431 Ga0070682_100163790
432 Ga0068868_100037067
433 Ga0070660_100172476
434 Ga0070689_100760376
435 Ga0070692_10034578
436 Ga0070675_100404860
437 Ga0070671_100039515
438 Ga0070674_100199960
439 Ga0070673_100080448
440 Ga0070667_100817285
441 Ga0070703_10144808
442 Ga0070709_10108429
443 Ga0070709_10139453
444 Ga0070709_10174496
445 Ga0070709_10305828
446 Ga0070709_10459491
447 Ga0070714_100062291
448 Ga0070714_100229543
449 Ga0070714_100541685
450 Ga0070714_100653144
451 Ga0070713_100315463
452 Ga0070710_10083192
453 Ga0070710_10157006
454 Ga0070710_10161067
455 Ga0070701_10093682
456 Ga0070711_100036314
457 Ga0070711_100101632
458 Ga0070711_100330184
459 Ga0070705_100011964
460 Ga0070705_100034439
461 Ga0070705_100041314
462 Ga0070700_100012175
463 Ga0070694_100005563
464 Ga0070708_100016917
465 Ga0070708_100034985
466 Ga0070708_100170239
467 Ga0070708_100203542
468 Ga0070663_100063398
469 Ga0070678_100071811
470 Ga0070678_100073814
471 Ga0070678_100142630
472 Ga0070662_100032082
473 Ga0070662_100038302
474 Ga0070662_100218693
475 Ga0068867_100047016
476 Ga0070706_100023834
477 Ga0070706_100159415
478 Ga0070707_100002932
479 Ga0070707_100243905
480 Ga0070698_100035746
481 Ga0070698_100188431
482 Ga0070699_100085497
483 Ga0070699_100169761
484 Ga0070679_101030971
485 Ga0070684_100001986
486 Ga0070684_100141154
487 Ga0070697_100149759
488 Ga0070697_100388107
489 Ga0070697_100823620
490 Ga0068853_100696214
491 Ga0068853_100835798
492 Ga0070686_100326918
493 Ga0070695_100036309
494 Ga0070695_100128705
495 Ga0070696_100051458
496 Ga0070696_100061971
497 Ga0070696_100069296
498 Ga0070696_100220904
499 Ga0070693_100064766
500 Ga0070693_100179519
501 Ga0070693_100295073
502 Ga0070704_100017972
503 Ga0070704_100045921
504 Ga0070704_100101093
505 Ga0068855_100029159
506 Ga0068855_100427661
507 Ga0068857_100047021
508 Ga0068854_100303032
509 Ga0070702_100186217
510 Ga0068852_100160825
511 Ga0068866_10134848
512 Ga0068861_100198982
513 Ga0068861_100464430
514 Ga0068860_100262728
515 Ga0081455_10004665
516 Ga0081538_10000100
517 Ga0081540_1004132
518 Ga0081540_1012143
519 Ga0081540_1035062
520 Ga0070717_10433832
521 Ga0075432_10046374
522 Ga0075432_10107537
523 Ga0075432_10109655
524 Ga0070715_10005649
525 Ga0070715_10192453
526 Ga0070716_100068663
527 Ga0070716_100090561
528 Ga0070712_100007113
529 Ga0070712_100053002
530 Ga0070712_100073669
531 Ga0070712_100321410
532 Ga0097621_100045705
533 Ga0097621_100560123
534 Ga0068871_100022759
535 Ga0075428_100104204
536 Ga0075430_100138135
537 Ga0075433_10036298
538 Ga0075433_10075303
539 Ga0075433_10088963
540 Ga0075434_100039451
541 Ga0075434_100059368
542 Ga0075434_100171567
543 Ga0075434_100325113
544 Ga0075429_100045632
545 Ga0068865_100110088
546 Ga0075436_100004199
547 Ga0075436_100078828
548 Ga0075436_100141984
549 Ga0075435_100042274
550 Ga0075435_100059453
551 Ga0075435_100070504
552 Ga0075435_100123700
553 Ga0075435_100158013
554 Ga0111539_10071956
555 Ga0111539_10117174
556 Ga0111539_10125504
557 Ga0111539_10424687
558 Ga0105245_10039198
559 Ga0105245_10106238
560 Ga0114129_10111421
561 Ga0114129_10196953
562 Ga0114129_11108187
563 Ga0105243_10175922
564 Ga0105243_10233256
565 Ga0105243_10283626
566 Ga0105241_10174542
567 Ga0105242_10860695
568 Ga0105248_10079950
569 Ga0105238_10170312
570 Ga0105249_10488939
571 Ga0105239_10024547
572 Ga0105239_10661688
573 Ga0105246_10292192
574 Ga0157320_1003340
575 Ga0157371_10067452
576 Ga0157374_10081675
577 Ga0157378_10064968
578 Ga0157378_10281842
579 Ga0157372_10006256
580 Ga0157372_10369985
581 Ga0157375_10279885
582 Ga0157380_10256881
583 Ga0182008_10176089
584 Ga0157376_10063066
585 Ga0157376_10431925
586 Ga0207653_10001262
587 Ga0207653_10043493
588 Ga0207692_10125215
589 Ga0207692_10178328
590 Ga0207642_10035140
591 Ga0207685_10040129
592 Ga0207685_10099354
593 Ga0207699_10030425
594 Ga0207699_10086037
595 Ga0207645_10272216
596 Ga0207684_10349155
597 Ga0207684_10546705
598 Ga0207693_10001565
599 Ga0207693_10014532
600 Ga0207693_10014545
601 Ga0207693_10025569
602 Ga0207693_10032554
603 Ga0207663_10009469
604 Ga0207663_10067453
605 Ga0207660_10217723
606 Ga0207660_10245704
607 Ga0207657_10195079
608 Ga0207646_10219130
609 Ga0207646_10355959
610 Ga0207681_10075851
611 Ga0207687_10028163
612 Ga0207687_10067345
613 Ga0207687_10193951
614 Ga0207700_10038735
615 Ga0207700_10485943
616 Ga0207664_10061083
617 Ga0207664_10118083
618 Ga0207664_10220869
619 Ga0207644_10053837
620 Ga0207644_10410051
621 Ga0207706_10010201
622 Ga0207669_10508880
623 Ga0207665_10010951
624 Ga0207665_10033583
625 Ga0207665_10039148
626 Ga0207665_10078531
627 Ga0207711_10125920
628 Ga0207689_10363775
629 Ga0207661_10023368
630 Ga0207661_10244731
631 Ga0207679_10696465
632 Ga0207667_10248263
633 Ga0207651_10145146
634 Ga0207712_10486320
635 Ga0207668_10075480
636 Ga0207677_10024371
637 Ga0207677_10048281
638 Ga0207677_10192684
639 Ga0207678_10014118
640 Ga0207708_10000684
641 Ga0207702_10078050
642 Ga0207702_10215414
643 Ga0207702_10275154
644 Ga0207648_10011247
645 Ga0207674_10006781
646 Ga0207674_10098356
647 Ga0207675_100053037
648 Ga0207675_100099823
649 Ga0207683_10002760
650 Ga0207683_10016327
651 Ga0207683_10108394
652 Ga0207698_10895446
653 Ga0209966_1017751
654 Ga0207428_10035504
655 Ga0207428_10038504
656 Ga0207428_10179539
657 Ga0268264_10017058
658 Ga0373948_0032060
659 Ga0373950_0001343
660 Ga0373950_0012224
661 Ga0373958_0000492
662 Ga0373928_0016191
663 Ga0373929_0003009
664 Ga0373940_0003956
665 Ga0373949_0020155
666 Ga0373949_0035824
667 Ga0373951_0006568
668 Ga0373951_0071013
669 Ga0373952_0039281
670 Ga0373939_0037726
671 Ga0373939_0040898
672 Ga0373939_0156712
673 Ga0373941_0037895
674 Ga0373941_0048210
675 Ga0373960_0065102
676 Ga0373943_0000198
677 Ga0373946_0183766
678 Ga0373942_0008675
679 Ga0373961_0065866
680 Ga0373961_0093820
681 Ga0373962_0005846
682 Ga0373927_0085134
683 Ga0373947_0000463
684 Ga0373947_0160722
685 Ga0373925_0032727
686 Ga0395899_0004359
687 Ga0395899_0073697
688 Ga0395900_0017598
689 Ga0395900_0073556
690 Ga0395900_0077058
691 Ga0395900_0116164
692 Ga0395900_0139786
693 Ga0395900_0230394
694 Ga0395898_0010803
695 Ga0395898_0033673
696 Ga0395898_0055641
697 Ga0395898_0252268
698 Ga0395898_0311588
699 Ga0395898_0412415
700 Ga0395905_0015724
701 Ga0395905_0016260
702 Ga0395905_0039848
703 Ga0395905_0074025
704 Ga0395905_0113422
705 Ga0395905_0246072
706 Ga0395905_0452865
707 Ga0395901_0002954
708 Ga0395901_0011023
709 Ga0395901_0039196
710 Ga0395901_0167338
711 Ga0395901_0191189
712 Ga0395901_0242001
713 Ga0395901_0250663
714 Ga0395901_1097271
715 Ga0451802_1855425
716 Ga0451853_0919351
717 Ga0451853_3749003
718 Ga0439448_0002189
719 Ga0439448_0004023
720 Ga0439455_0026258
721 Ga0466965_0087193
722 Ga0466964_0087368
723 Ga0466968_0082465
724 Ga0466960_0011020
725 Ga0466960_0016233
726 Ga0466960_0188907
727 Ga0466967_0025521
728 Ga0495603_0000081
729 Ga0495591_104933
730 Ga0495641_0124610
731 Ga0495582_0039845
732 Ga0495585_0081498
733 Ga0495622_0104528
734 Ga0495588_0092186
735 Ga0495647_0025272
736 Ga0495658_0027270
737 Ga0495676_0002817
738 Ga0496100_0140463
739 Ga0496100_0181672
740 Ga0496100_0346799
741 Ga0496100_0402641
742 Ga0496101_0088133
743 Ga0496101_0179150
744 Ga0496101_0315987
745 Ga0496101_0332570
746 Ga0496102_0018999
747 Ga0496103_0066267
748 Ga0496103_0250646
749 Ga0496104_0134160
750 Ga0496104_0376364
751 Ga0496104_0497760
752 Ga0496105_0004904
753 Ga0496105_0071165
754 Ga0496105_0079531
755 Ga0496106_0185526
756 Ga0496106_0190711
757 Ga0496106_0278574
758 Ga0496106_0304837
759 Ga0496107_0058611
760 Ga0496107_0073761
761 Ga0496107_0239092
762 Ga0496108_0253047
763 Ga0496108_0362966
764 Ga0496108_0528738
765 Ga0496109_0013595
766 Ga0496109_0037330
767 Ga0496109_0068731
768 Ga0496109_0134636
769 Ga0496109_0273560
770 Ga0496110_0210110
771 Ga0496110_0416724
772 Ga0496110_0521900
773 Ga0496111_0003399
774 Ga0496111_0051053
775 Ga0496111_0094918
776 Ga0496111_0437086
777 Ga0496111_0562074
778 Ga0496112_0011968
779 Ga0496112_0020763
780 Ga0496112_0080915
781 Ga0496112_0224126
782 Ga0496112_0458933
783 Ga0496113_0001530
784 Ga0496113_0020831
785 Ga0496113_0141722
786 Ga0496113_0423367
787 Ga0496114_0113783
788 Ga0496114_0119291
789 Ga0496114_0267771
790 Ga0496115_0009459
791 Ga0501031_0003333
792 Ga0501032_0001554
793 Ga0501033_0000899
794 Ga0501036_0028150
795 Ga0501037_0068246
796 Ga0501038_0003802
797 Ga0501039_0009033
798 Ga0501040_0002266
799 Ga0501041_0000474
800 Ga0501042_0000930
801 Ga0501043_0000693
802 Ga0501046_0003310
803 Ga0501048_0000867
804 Ga0501068_0007288
805 Ga0501069_0000605
806 Ga0501069_0002145
807 Ga0501070_0001149
808 Ga0501071_0000677
809 Ga0501071_0465785
810 Ga0501072_0087924
811 Ga0501073_0003204
812 Ga0501074_0020219
813 Ga0501075_0003562
814 Ga0501075_0216235
815 Ga0501076_0042546
816 Ga0501077_0008185
817 Ga0501079_0025541
818 Ga0501080_0021752
819 Ga0501081_0002176
820 Ga0501083_0001492
821 Ga0501035_0001594
822 Ga0501044_0042132
823 Ga0501045_0005255
824 nmdc:mga05p37_239245_c1
825 nmdc:mga05p37_296507_c1
826 nmdc:mga05p37_34008_c1
827 nmdc:mga09592_147306_c1
828 nmdc:mga0qj67_66404_c1
829 nmdc:mga06r32_199096_c1
830 nmdc:mga06r32_301786_c1
831 nmdc:mga08y16_237999_c1
832 nmdc:mga08y16_30022_c1
833 nmdc:mga0n895_22631_c1
834 nmdc:mga0n895_416853_c1
835 nmdc:mga0n895_51885_c1
836 nmdc:mga0rr50_142337_c1
837 nmdc:mga0rr50_26218_c1
838 nmdc:mga0rr50_27403_c1
839 nmdc:mga08x19_36478_c1
840 nmdc:mga08x19_58179_c1
841 nmdc:mga0a205_163092_c1
842 nmdc:mga0a205_45720_c1
843 nmdc:mga0a205_54167_c1
844 nmdc:mga0a205_67654_c1
845 Ga0501084_0158783
846 Ga0501082_0033951
847 Ga0501082_0276692
848 Ga0530510_0011066

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

1

191

0.77

PF00149

Metallophos

Calcineurin-like phosphoesterase

3

160

0.61

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nnw-assembly1.cif.gz_A hypothetical protein from pyrococcus furiosus pfu-1218608 0.8353 2 222
1nnw-assembly1.cif.gz_A hypothetical protein from pyrococcus furiosus pfu-1218608 0.8285 2 222
3qfn-assembly1.cif.gz_B crystal structure of streptococcal asymmetric ap4a hydrolase and phosphodiesterase spr1479/saph in complex with inorganic phosphate 0.8166 2 220
3rqz-assembly1.cif.gz_A crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.8092 2 220
3qfn-assembly1.cif.gz_B crystal structure of streptococcal asymmetric ap4a hydrolase and phosphodiesterase spr1479/saph in complex with inorganic phosphate 0.8034 2 220
ID Description Score Start End Superfamily
2gjuC00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8364 2 222 3.60.21.10
2gjuC00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8296 2 222 3.60.21.10
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8245 1 220 3.60.21.10
3qfnB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8166 2 220 3.60.21.10
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8143 1 220 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A538KYL9-F1-model_v4 Metallophosphoesterase family protein 0.9887 1 222 GO:0005737
GO:0016791
AF-A0A538KYL9-F1-model_v4 Metallophosphoesterase family protein 0.9842 1 222 GO:0005737
GO:0016791
AF-H0E429-F1-model_v4 Metallophosphoesterase 0.9542 1 221 GO:0005737
GO:0016791
AF-A0A538HBV4-F1-model_v4 Metallophosphoesterase family protein 0.953 2 222 GO:0005737
GO:0016791
AF-A0A7W1GMF6-F1-model_v4 Metallophosphoesterase family protein 0.9527 87 222

Map