F448619

General Info

Members Datasets Scaffolds Average Seq Length
460 251 460 200

Family's Representative Sequence

Representative Sequence 3300047471|Ga0495684_0529728|Ga0495684_0529728_80_760
Length 226
Sequence MRLRTLAYAGAAAALGASLWWRKNPSACPYGQRFWVQAPHPIVTRERLFFVMRPEAGERVLEIGPGTGYYTLDIAEWVGSEGTVEIFDLQQEFLDHTMARAAERGHENVVPTRGDATDLPYEAGTMDAVVLNAVLGEIPDPVAALREIRRVLKPTGRLLVGELFGDPHFTTQAALRRQGAEAGLAYADQSGYWFGYVGRLTPTAPATRRHPAASRGSPCRRCSGSR

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
128 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
129 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
244 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
245 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
248 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
249 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 10.43
Rhizosphere 87.61
Stem 0
Stem Tuber 0
Unclassified 1.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000728 3300001977 Bacteria 5066
2 JGI24740J21852_10005676 3300001979 Bacteria 5254
3 JGI24748J21848_1003138 3300002074 Bacteria 1884
4 JGI24034J26672_10000167 3300002239 Bacteria 9222
5 JGI24742J22300_10000390 3300002244 Bacteria 6507
6 JGI24751J29686_10026666 3300002459 Bacteria 1199
7 JGI25406J46586_10021614 3300003203 Bacteria 2578
8 JGI25407J50210_10030533 3300003373 Unclassified 1396
9 Ga0070683_100002929 3300005329 Bacteria 13677
10 Ga0070683_100003221 3300005329 Bacteria 13175
11 Ga0070683_100004842 3300005329 Bacteria 11145
12 Ga0070683_100015414 3300005329 Bacteria 6713
13 Ga0070683_100271872 3300005329 Bacteria 1612
14 Ga0070666_10023706 3300005335 Bacteria 3996
15 Ga0070682_100000029 3300005337 Bacteria 183516
16 Ga0070682_100000815 3300005337 Bacteria 18228
17 Ga0068868_100043307 3300005338 Bacteria 3516
18 Ga0068868_100888619 3300005338 Bacteria 809
19 Ga0070689_100122698 3300005340 Bacteria 2076
20 Ga0070689_100243560 3300005340 Bacteria 1482
21 Ga0070691_10003720 3300005341 Bacteria 6890
22 Ga0070661_100000161 3300005344 Bacteria 55183
23 Ga0070661_100699584 3300005344 Bacteria 826
24 Ga0070692_10252050 3300005345 Bacteria 1057
25 Ga0070668_100295683 3300005347 Bacteria 1357
26 Ga0070675_100000153 3300005354 Bacteria 41558
27 Ga0070674_100000011 3300005356 Bacteria 134886
28 Ga0070674_100000014 3300005356 Bacteria 100122
29 Ga0070674_100008150 3300005356 Bacteria 6217
30 Ga0070674_100106832 3300005356 Bacteria 2049
31 Ga0070673_100019029 3300005364 Bacteria 4925
32 Ga0070688_100000453 3300005365 Bacteria 20787
33 Ga0070688_100001064 3300005365 Bacteria 13776
34 Ga0070688_100438513 3300005365 Bacteria 974
35 Ga0070659_100009701 3300005366 Bacteria 7074
36 Ga0070667_100225233 3300005367 Bacteria 1670
37 Ga0070667_100242123 3300005367 Unclassified 1611
38 Ga0070714_100008340 3300005435 Bacteria 8083
39 Ga0070700_100038140 3300005441 Bacteria 2927
40 Ga0070663_100138260 3300005455 Bacteria 1857
41 Ga0070663_100312538 3300005455 Bacteria 1261
42 Ga0070678_100097451 3300005456 Bacteria 2271
43 Ga0070678_100408611 3300005456 Unclassified 1181
44 Ga0070662_100000008 3300005457 Bacteria 168754
45 Ga0070681_10043861 3300005458 Bacteria 4477
46 Ga0068867_100000247 3300005459 Bacteria 35692
47 Ga0070685_10000203 3300005466 Bacteria 39835
48 Ga0070685_10000754 3300005466 Bacteria 17603
49 Ga0070679_100000651 3300005530 Bacteria 29562
50 Ga0070684_100022662 3300005535 Bacteria 5241
51 Ga0070684_100022755 3300005535 Bacteria 5232
52 Ga0070684_100033478 3300005535 Bacteria 4388
53 Ga0070684_100117307 3300005535 Bacteria 2392
54 Ga0070684_100824467 3300005535 Bacteria 868
55 Ga0068853_100031684 3300005539 Bacteria 4473
56 Ga0070672_100000057 3300005543 Bacteria 50189
57 Ga0070686_100022154 3300005544 Bacteria 3781
58 Ga0070693_100000398 3300005547 Bacteria 19763
59 Ga0070665_100000870 3300005548 Bacteria 39061
60 Ga0070665_100002483 3300005548 Bacteria 20309
61 Ga0070665_100047809 3300005548 Bacteria 4294
62 Ga0070704_100191041 3300005549 Bacteria 1646
63 Ga0068855_100149600 3300005563 Bacteria 2655
64 Ga0068855_100356527 3300005563 Bacteria 1610
65 Ga0068854_100000115 3300005578 Bacteria 55089
66 Ga0068854_100338387 3300005578 Bacteria 1228
67 Ga0068856_100000057 3300005614 Bacteria 102045
68 Ga0068856_100010700 3300005614 Bacteria 8912
69 Ga0068856_100020527 3300005614 Bacteria 6417
70 Ga0068856_100420788 3300005614 Bacteria 1356
71 Ga0070702_100002851 3300005615 Bacteria 7585
72 Ga0068852_100000058 3300005616 Bacteria 75312
73 Ga0068864_100000044 3300005618 Bacteria 157919
74 Ga0068866_10000002 3300005718 Bacteria 394090
75 Ga0068866_10000219 3300005718 Bacteria 27162
76 Ga0068851_10001867 3300005834 Bacteria 9251
77 Ga0068870_10271648 3300005840 Bacteria 1059
78 Ga0068863_100000042 3300005841 Bacteria 154459
79 Ga0068858_100000086 3300005842 Bacteria 96201
80 Ga0068858_100000155 3300005842 Bacteria 72794
81 Ga0068858_100064971 3300005842 Bacteria 3377
82 Ga0068860_100010275 3300005843 Bacteria 9264
83 Ga0081455_10207032 3300005937 Bacteria 1464
84 Ga0081455_10394222 3300005937 Bacteria 963
85 Ga0081538_10000032 3300005981 Bacteria 122398
86 Ga0081540_1000546 3300005983 Bacteria 36470
87 Ga0081540_1034794 3300005983 Bacteria 2710
88 Ga0081539_10001100 3300005985 Bacteria 49090
89 Ga0081539_10003159 3300005985 Bacteria 20901
90 Ga0070715_10000015 3300006163 Bacteria 152816
91 Ga0070712_100001300 3300006175 Bacteria 15100
92 Ga0070712_100224422 3300006175 Bacteria 1489
93 Ga0075433_10000663 3300006852 Bacteria 23254
94 Ga0068865_100000020 3300006881 Bacteria 104487
95 Ga0111539_10956239 3300009094 Unclassified 996
96 Ga0105245_10000159 3300009098 Bacteria 63630
97 Ga0105245_10001015 3300009098 Bacteria 25483
98 Ga0105245_10002749 3300009098 Bacteria 15821
99 Ga0105247_10000993 3300009101 Bacteria 21414
100 Ga0105247_10249726 3300009101 Bacteria 1212
101 Ga0114129_10592930 3300009147 Bacteria 1437
102 Ga0114129_10743544 3300009147 Bacteria 1256
103 Ga0105243_10004998 3300009148 Bacteria 10392
104 Ga0105243_10221148 3300009148 Bacteria 1674
105 Ga0105242_10002766 3300009176 Bacteria 13729
106 Ga0105242_10008605 3300009176 Bacteria 7837
107 Ga0105242_10238304 3300009176 Bacteria 1634
108 Ga0105248_10000022 3300009177 Bacteria 275935
109 Ga0105248_10529203 3300009177 Bacteria 1329
110 Ga0105249_10189958 3300009553 Unclassified 2004
111 Ga0105033_104983 3300009986 Bacteria 1137
112 Ga0105239_10050654 3300010375 Bacteria 4554
113 Ga0105239_10645854 3300010375 Bacteria 1208
114 Ga0105239_10659490 3300010375 Bacteria 1195
115 Ga0157373_10496552 3300013100 Bacteria 881
116 Ga0157371_10004276 3300013102 Bacteria 12531
117 Ga0157370_10006328 3300013104 Bacteria 13080
118 Ga0157370_10187874 3300013104 Bacteria 1918
119 Ga0157370_10563265 3300013104 Bacteria 1044
120 Ga0157369_10000118 3300013105 Bacteria 111618
121 Ga0157374_10002177 3300013296 Bacteria 16513
122 Ga0157374_10297473 3300013296 Bacteria 1596
123 Ga0157378_10092044 3300013297 Bacteria 2758
124 Ga0157378_10386968 3300013297 Bacteria 1375
125 Ga0157372_10000616 3300013307 Bacteria 38850
126 Ga0157375_10000184 3300013308 Bacteria 58368
127 Ga0157375_10302567 3300013308 Unclassified 1763
128 Ga0163163_10207424 3300014325 Bacteria 2008
129 Ga0163163_10801426 3300014325 Unclassified 1005
130 Ga0163163_10975566 3300014325 Bacteria 911
131 Ga0157380_10000080 3300014326 Bacteria 53731
132 Ga0157379_10125057 3300014968 Bacteria 2314
133 Ga0157376_10035064 3300014969 Bacteria 4056
134 Ga0163161_10000173 3300017792 Bacteria 59103
135 Ga0206356_11661110 3300020070 Bacteria 3396
136 Ga0206353_11601057 3300020082 Bacteria 1801
137 Ga0207656_10000354 3300025321 Bacteria 15472
138 Ga0207656_10004306 3300025321 Bacteria 4960
139 Ga0207682_10000228 3300025893 Bacteria 25297
140 Ga0207642_10000001 3300025899 Bacteria 714030
141 Ga0207642_10000003 3300025899 Bacteria 650651
142 Ga0207642_10000094 3300025899 Bacteria 23395
143 Ga0207710_10000151 3300025900 Bacteria 77424
144 Ga0207710_10112969 3300025900 Bacteria 1291
145 Ga0207680_10048971 3300025903 Bacteria 2513
146 Ga0207685_10000001 3300025905 Bacteria 604473
147 Ga0207705_10091476 3300025909 Bacteria 2228
148 Ga0207707_10018135 3300025912 Bacteria 6134
149 Ga0207693_10000859 3300025915 Bacteria 27121
150 Ga0207649_10000024 3300025920 Bacteria 183104
151 Ga0207652_10000150 3300025921 Bacteria 75189
152 Ga0207659_10000043 3300025926 Bacteria 90795
153 Ga0207687_10000011 3300025927 Bacteria 388349
154 Ga0207687_10000021 3300025927 Bacteria 226396
155 Ga0207687_10000350 3300025927 Bacteria 30682
156 Ga0207687_10000716 3300025927 Bacteria 22524
157 Ga0207664_10056834 3300025929 Bacteria 3109
158 Ga0207690_10006983 3300025932 Bacteria 6695
159 Ga0207690_10121085 3300025932 Unclassified 1901
160 Ga0207706_10000016 3300025933 Bacteria 170697
161 Ga0207686_10000549 3300025934 Bacteria 24232
162 Ga0207686_10015756 3300025934 Bacteria 4235
163 Ga0207686_10070529 3300025934 Bacteria 2246
164 Ga0207670_10128044 3300025936 Bacteria 1855
165 Ga0207670_10129878 3300025936 Bacteria 1844
166 Ga0207669_10000007 3300025937 Bacteria 169904
167 Ga0207669_10000027 3300025937 Bacteria 91216
168 Ga0207669_10015801 3300025937 Bacteria 3817
169 Ga0207704_10000004 3300025938 Bacteria 239295
170 Ga0207691_10000374 3300025940 Bacteria 45009
171 Ga0207711_10000019 3300025941 Bacteria 412779
172 Ga0207711_10362123 3300025941 Bacteria 1344
173 Ga0207661_10000142 3300025944 Bacteria 45456
174 Ga0207661_10001987 3300025944 Bacteria 14072
175 Ga0207661_10003394 3300025944 Bacteria 11055
176 Ga0207661_10007802 3300025944 Bacteria 7623
177 Ga0207661_10035924 3300025944 Bacteria 3865
178 Ga0207661_10553874 3300025944 Bacteria 1053
179 Ga0207661_10930911 3300025944 Bacteria 800
180 Ga0207667_10380532 3300025949 Bacteria 1438
181 Ga0207651_10029595 3300025960 Bacteria 3472
182 Ga0207712_10000033 3300025961 Bacteria 209336
183 Ga0207668_10099829 3300025972 Bacteria 2154
184 Ga0207668_10299638 3300025972 Bacteria 1326
185 Ga0207668_10498915 3300025972 Bacteria 1047
186 Ga0207640_10000059 3300025981 Bacteria 90901
187 Ga0207640_10001105 3300025981 Bacteria 14885
188 Ga0207640_10549871 3300025981 Unclassified 970
189 Ga0207658_10044890 3300025986 Bacteria 3219
190 Ga0207658_10331673 3300025986 Bacteria 1320
191 Ga0207677_10004273 3300026023 Bacteria 7643
192 Ga0207677_10039439 3300026023 Bacteria 3105
193 Ga0207703_10000072 3300026035 Bacteria 120727
194 Ga0207703_10000266 3300026035 Bacteria 58337
195 Ga0207639_10003854 3300026041 Bacteria 10101
196 Ga0207678_10153719 3300026067 Bacteria 1965
197 Ga0207678_10379396 3300026067 Bacteria 1222
198 Ga0207708_10100994 3300026075 Bacteria 2233
199 Ga0207702_10000027 3300026078 Bacteria 183792
200 Ga0207702_10007605 3300026078 Bacteria 9224
201 Ga0207702_10014910 3300026078 Bacteria 6446
202 Ga0207702_10369951 3300026078 Bacteria 1376
203 Ga0207641_10000231 3300026088 Bacteria 72245
204 Ga0207648_10000230 3300026089 Bacteria 59713
205 Ga0207676_10000043 3300026095 Bacteria 161948
206 Ga0207683_10010360 3300026121 Bacteria 7953
207 Ga0207683_10421762 3300026121 Unclassified 1229
208 Ga0207698_10000002 3300026142 Bacteria 404991
209 Ga0268266_10000076 3300028379 Bacteria 217644
210 Ga0268266_10004334 3300028379 Bacteria 13637
211 Ga0268266_10036593 3300028379 Bacteria 4179
212 Ga0268266_10194892 3300028379 Bacteria 1851
213 Ga0268264_10008628 3300028381 Bacteria 8468
214 Ga0265319_1000029 3300028563 Bacteria 131291
215 Ga0265334_10032003 3300028573 Bacteria 2100
216 Ga0265336_10055192 3300028666 Bacteria 1195
217 Ga0265338_10000179 3300028800 Bacteria 117995
218 Ga0265324_10041275 3300029957 Bacteria 1597
219 Ga0265325_10011215 3300031241 Bacteria 5154
220 Ga0265331_10023328 3300031250 Bacteria 3144
221 Ga0307405_10233717 3300031731 Bacteria 1357
222 Ga0307413_10444244 3300031824 Bacteria 1028
223 Ga0307409_100034181 3300031995 Bacteria 3709
224 Ga0373934_0132598 3300035086 Bacteria 1017
225 Ga0373923_0277658 3300035111 Unclassified 789
226 Ga0316574_0252193 3300035398 Bacteria 1127
227 Ga0373947_0433599 3300035725 Bacteria 889
228 Ga0373937_0041924 3300036401 Bacteria 4177
229 Ga0373937_0215040 3300036401 Bacteria 1809
230 Ga0373937_0312578 3300036401 Bacteria 1486
231 Ga0395900_0570731 3300037418 Bacteria 1074
232 Ga0395905_0170928 3300037471 Bacteria 2042
233 Ga0451833_1024539 3300041491 Bacteria 1278
234 Ga0451853_0674116 3300041512 Bacteria 5453
235 Ga0466963_0000124 3300044694 Bacteria 28905
236 Ga0466957_0151930 3300044842 Bacteria 1498
237 Ga0466958_0028489 3300045836 Bacteria 3312
238 Ga0466958_0061588 3300045836 Bacteria 2286
239 Ga0466967_0038536 3300045976 Bacteria 4100
240 Ga0495592_0000521 3300046454 Bacteria 27805
241 Ga0495592_0064755 3300046454 Bacteria 2678
242 Ga0495603_0000622 3300046455 Bacteria 19869
243 Ga0495603_0004750 3300046455 Bacteria 8110
244 Ga0495629_0001361 3300046459 Bacteria 19270
245 Ga0495629_0150945 3300046459 Bacteria 1615
246 Ga0495641_0000001 3300046461 Bacteria 485224
247 Ga0495641_0022741 3300046461 Bacteria 3131
248 Ga0495651_0296853 3300046462 Bacteria 1085
249 Ga0495651_0551403 3300046462 Unclassified 732
250 Ga0495653_0098333 3300046463 Unclassified 2125
251 Ga0495653_0162105 3300046463 Bacteria 1551
252 Ga0495653_0206221 3300046463 Bacteria 1331
253 Ga0495582_0000022 3300046473 Bacteria 83315
254 Ga0495639_0030389 3300046475 Bacteria 2401
255 Ga0495662_0000137 3300046476 Bacteria 28083
256 Ga0495662_0009206 3300046476 Bacteria 4845
257 Ga0495594_0000276 3300046499 Bacteria 25314
258 Ga0495596_0085691 3300046500 Unclassified 1223
259 Ga0495606_0000045 3300046507 Bacteria 212105
260 Ga0495608_0000001 3300046511 Bacteria 411278
261 Ga0495608_0000163 3300046511 Bacteria 47170
262 Ga0495608_0287385 3300046511 Bacteria 1020
263 Ga0495618_0001468 3300046514 Bacteria 15801
264 Ga0495620_0001840 3300046515 Bacteria 12507
265 Ga0495628_0000858 3300046516 Bacteria 28086
266 Ga0495628_0026019 3300046516 Bacteria 4777
267 Ga0495628_0046466 3300046516 Bacteria 3448
268 Ga0495628_0061540 3300046516 Bacteria 2944
269 Ga0495628_0150797 3300046516 Bacteria 1771
270 Ga0495628_0201839 3300046516 Bacteria 1498
271 Ga0495630_0000037 3300046517 Bacteria 114404
272 Ga0495630_0020101 3300046517 Bacteria 4918
273 Ga0495630_0070337 3300046517 Bacteria 2633
274 Ga0495644_0000454 3300046523 Bacteria 17881
275 Ga0495652_0000086 3300046529 Bacteria 99373
276 Ga0495652_0060323 3300046529 Bacteria 3206
277 Ga0495640_0021952 3300046533 Bacteria 4675
278 Ga0495640_0112327 3300046533 Bacteria 1779
279 Ga0495586_0007201 3300046535 Bacteria 5933
280 Ga0495587_0001022 3300046536 Bacteria 18410
281 Ga0495587_0029073 3300046536 Bacteria 3357
282 Ga0495587_0054135 3300046536 Bacteria 2365
283 Ga0495587_0434493 3300046536 Bacteria 728
284 Ga0495621_0011410 3300046539 Bacteria 2747
285 Ga0495645_0024357 3300046543 Bacteria 4391
286 Ga0495622_0000690 3300046557 Bacteria 19165
287 Ga0495633_0006532 3300046558 Bacteria 6890
288 Ga0495656_0003561 3300046615 Bacteria 5272
289 Ga0495634_0000013 3300046642 Bacteria 130546
290 Ga0495634_0001471 3300046642 Bacteria 20875
291 Ga0495634_0090023 3300046642 Bacteria 1994
292 Ga0495634_0141968 3300046642 Bacteria 1524
293 Ga0495634_0182919 3300046642 Bacteria 1311
294 Ga0495625_0001659 3300046660 Bacteria 26100
295 Ga0495635_0000063 3300046663 Bacteria 65304
296 Ga0495635_0067371 3300046663 Bacteria 2456
297 Ga0495635_0242685 3300046663 Unclassified 1215
298 Ga0495635_0343917 3300046663 Bacteria 996
299 Ga0495588_0000179 3300046674 Bacteria 77030
300 Ga0495657_0000002 3300046675 Bacteria 411958
301 Ga0495657_0134059 3300046675 Bacteria 1549
302 Ga0495599_0006457 3300046678 Bacteria 7074
303 Ga0495599_0119765 3300046678 Bacteria 1637
304 Ga0495599_0127676 3300046678 Bacteria 1580
305 Ga0495599_0133382 3300046678 Bacteria 1542
306 Ga0495647_0000003 3300046681 Bacteria 145235
307 Ga0495647_0003248 3300046681 Bacteria 5203
308 Ga0495647_0008323 3300046681 Bacteria 3485
309 Ga0495658_0000008 3300046683 Bacteria 115426
310 Ga0495658_0098296 3300046683 Bacteria 1743
311 Ga0495669_0000651 3300046684 Bacteria 15129
312 Ga0495669_0015561 3300046684 Bacteria 3258
313 Ga0495669_0121731 3300046684 Bacteria 1223
314 Ga0495613_0000122 3300046689 Bacteria 77044
315 Ga0495613_0000369 3300046689 Bacteria 39198
316 Ga0495613_0204189 3300046689 Bacteria 1392
317 Ga0495624_0000164 3300046690 Bacteria 48886
318 Ga0495624_0002296 3300046690 Bacteria 14562
319 Ga0495624_0003753 3300046690 Bacteria 11225
320 Ga0495670_0007059 3300046691 Bacteria 5530
321 Ga0495670_0150665 3300046691 Bacteria 1220
322 Ga0495649_0030299 3300046694 Bacteria 2989
323 Ga0495600_0035731 3300046809 Bacteria 3229
324 Ga0495600_0097188 3300046809 Unclassified 1920
325 Ga0495604_0000033 3300047317 Bacteria 134810
326 Ga0495604_0000850 3300047317 Bacteria 25489
327 Ga0495604_0050587 3300047317 Bacteria 3226
328 Ga0495604_0235900 3300047317 Unclassified 1253
329 Ga0495674_0000007 3300047319 Bacteria 336257
330 Ga0495674_0355247 3300047319 Bacteria 1189
331 Ga0495676_0000652 3300047321 Bacteria 28858
332 Ga0495676_0001759 3300047321 Bacteria 18921
333 Ga0495676_0403765 3300047321 Bacteria 906
334 Ga0495680_0000215 3300047322 Bacteria 63049
335 Ga0495680_0000587 3300047322 Bacteria 40868
336 Ga0495680_0036038 3300047322 Bacteria 3977
337 Ga0495675_0000046 3300047444 Bacteria 82596
338 Ga0495675_0015728 3300047444 Bacteria 4784
339 Ga0495685_017740 3300047447 Bacteria 2439
340 Ga0495684_0110662 3300047471 Bacteria 2073
341 Ga0495684_0529728 3300047471 Unclassified 805
342 Ga0495686_0129780 3300047472 Unclassified 1495
343 Ga0495593_0010922 3300047673 Bacteria 5230
344 Ga0495602_0000010 3300048088 Bacteria 212121
345 Ga0495602_0000188 3300048088 Bacteria 58305
346 Ga0495602_0163145 3300048088 Bacteria 1738
347 Ga0495602_0166521 3300048088 Bacteria 1715
348 Ga0496100_0000003 3300048903 Bacteria 360802
349 Ga0496100_0000063 3300048903 Bacteria 60957
350 Ga0496101_0000003 3300048904 Bacteria 406565
351 Ga0496101_0000012 3300048904 Bacteria 268127
352 Ga0496102_0105895 3300048905 Bacteria 2617
353 Ga0496104_0000002 3300048907 Bacteria 686017
354 Ga0496104_0000066 3300048907 Bacteria 108721
355 Ga0496104_0000666 3300048907 Bacteria 29447
356 Ga0496105_0000001 3300048908 Bacteria 1328178
357 Ga0496105_0000020 3300048908 Bacteria 181484
358 Ga0496105_0004549 3300048908 Bacteria 10446
359 Ga0496105_0022756 3300048908 Bacteria 5078
360 Ga0496106_0000015 3300048909 Bacteria 187570
361 Ga0496106_0000020 3300048909 Bacteria 169168
362 Ga0496107_0000008 3300048910 Bacteria 251874
363 Ga0496107_0000014 3300048910 Bacteria 176738
364 Ga0496108_0000002 3300048911 Bacteria 700890
365 Ga0496108_0001295 3300048911 Bacteria 19647
366 Ga0496108_0001400 3300048911 Bacteria 18998
367 Ga0496108_0009647 3300048911 Bacteria 7824
368 Ga0496108_0010707 3300048911 Bacteria 7442
369 Ga0496109_0000001 3300048912 Bacteria 700852
370 Ga0496109_0000035 3300048912 Bacteria 159744
371 Ga0496109_0000246 3300048912 Bacteria 52127
372 Ga0496109_0000888 3300048912 Bacteria 25009
373 Ga0496109_0533390 3300048912 Bacteria 1107
374 Ga0496110_0002971 3300048913 Bacteria 12859
375 Ga0496110_0018894 3300048913 Bacteria 5791
376 Ga0496110_0025732 3300048913 Bacteria 5031
377 Ga0496110_0143574 3300048913 Bacteria 2158
378 Ga0496111_0000022 3300048914 Bacteria 66777
379 Ga0496111_0009354 3300048914 Bacteria 6535
380 Ga0496111_0031644 3300048914 Bacteria 3770
381 Ga0496111_0139036 3300048914 Bacteria 1799
382 Ga0496111_0532169 3300048914 Bacteria 864
383 Ga0496112_0000003 3300048915 Bacteria 660147
384 Ga0496112_0006530 3300048915 Bacteria 10256
385 Ga0496112_0103593 3300048915 Bacteria 2816
386 Ga0496113_0000093 3300048916 Bacteria 38914
387 Ga0496113_0017949 3300048916 Bacteria 4920
388 Ga0496113_0058250 3300048916 Bacteria 2906
389 Ga0496113_0067331 3300048916 Unclassified 2715
390 Ga0496113_0083986 3300048916 Bacteria 2444
391 Ga0496113_0146468 3300048916 Bacteria 1861
392 Ga0496113_0157168 3300048916 Bacteria 1796
393 Ga0496113_0822161 3300048916 Bacteria 737
394 Ga0496114_0030582 3300048917 Bacteria 4431
395 Ga0496115_0000004 3300048918 Bacteria 319734
396 Ga0496119_0019537 3300048922 Bacteria 4985
397 Ga0496119_0320679 3300048922 Bacteria 759
398 Ga0496120_0049030 3300048923 Bacteria 2426
399 Ga0496124_0315264 3300048927 Bacteria 1123
400 Ga0496125_0047605 3300048928 Bacteria 3583
401 Ga0501032_0376465 3300049569 Bacteria 913
402 Ga0501036_0054873 3300049572 Bacteria 3376
403 Ga0501039_0306210 3300049575 Bacteria 1249
404 Ga0501040_0086471 3300049576 Bacteria 2177
405 Ga0501040_0353517 3300049576 Bacteria 1053
406 Ga0501041_0100089 3300049577 Bacteria 1794
407 Ga0501042_0012267 3300049578 Bacteria 5800
408 Ga0501042_0019107 3300049578 Bacteria 4755
409 Ga0501046_0147556 3300049580 Bacteria 1776
410 Ga0501048_0046586 3300049582 Bacteria 3095
411 Ga0501048_0547258 3300049582 Bacteria 830
412 Ga0501067_0099414 3300049583 Bacteria 1616
413 Ga0501069_0452417 3300049585 Bacteria 763
414 Ga0501070_0420345 3300049586 Bacteria 1080
415 Ga0501071_0223791 3300049587 Bacteria 1417
416 Ga0501072_0017787 3300049588 Bacteria 5466
417 Ga0501072_0147757 3300049588 Bacteria 1874
418 Ga0501075_0007890 3300049591 Bacteria 7391
419 Ga0501075_0776284 3300049591 Bacteria 729
420 Ga0501076_0002784 3300049592 Bacteria 12111
421 Ga0501076_0690294 3300049592 Bacteria 843
422 Ga0501079_0013453 3300049741 Bacteria 6240
423 Ga0501079_0390869 3300049741 Bacteria 1091
424 Ga0501081_0004692 3300049743 Bacteria 8788
425 Ga0501081_0353171 3300049743 Bacteria 1084
426 Ga0501083_0329397 3300049744 Bacteria 993
427 Ga0501045_0496404 3300049824 Bacteria 906
428 nmdc:mga0qj67_67177_c1 3300050509 Bacteria 2856
429 nmdc:mga0rr50_462661_c1 3300050513 Bacteria 1076
430 nmdc:mga0a205_155_c1 3300050515 Bacteria 44726
431 Ga0495601_0000012 3300053077 Bacteria 227853
432 Ga0495601_0000169 3300053077 Bacteria 35095
433 Ga0495601_0012989 3300053077 Bacteria 5002
434 Ga0495601_0023415 3300053077 Bacteria 3794
435 Ga0495601_0103639 3300053077 Bacteria 1839
436 Ga0495601_0245779 3300053077 Unclassified 1168
437 Ga0495601_0266134 3300053077 Bacteria 1118
438 Ga0495601_0569593 3300053077 Bacteria 728
439 Ga0495612_0001003 3300053078 Bacteria 11610
440 Ga0495612_0017880 3300053078 Bacteria 2837
441 Ga0495612_0060720 3300053078 Bacteria 1565
442 Ga0495612_0076366 3300053078 Bacteria 1403
443 Ga0495655_0000471 3300053083 Bacteria 6767
444 Ga0495655_0004966 3300053083 Bacteria 2317
445 Ga0495595_0000001 3300053084 Bacteria 495226
446 Ga0495595_0000372 3300053084 Bacteria 17048
447 Ga0495595_0001241 3300053084 Bacteria 9932
448 Ga0495619_0000015 3300053085 Bacteria 252787
449 Ga0495619_0000018 3300053085 Bacteria 209943
450 Ga0495619_0000120 3300053085 Bacteria 58265
451 Ga0495619_0000758 3300053085 Bacteria 21054
452 Ga0495619_0007151 3300053085 Bacteria 7068
453 Ga0495619_0040276 3300053085 Bacteria 3054
454 Ga0495619_0070764 3300053085 Bacteria 2333
455 Ga0495619_0368707 3300053085 Unclassified 993
456 Ga0500641_0017264 3300053096 Bacteria 2697
457 Ga0500614_000374 3300053123 Bacteria 11670
458 Ga0501084_0215158 3300054114 Bacteria 1621
459 Ga0501082_0195069 3300060353 Bacteria 1761
460 Ga0530510_0000462 3300061734 Bacteria 26213

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031731 Ga0307405_10233717 Ga0307405_102337173 181
2 3300031824 Ga0307413_10444244 Ga0307413_104442441 181
3 3300031995 Ga0307409_100034181 Ga0307409_1000341814 181
4 3300005365 Ga0070688_100000453 Ga0070688_10000045319 183
5 3300005466 Ga0070685_10000754 Ga0070685_1000075417 183
6 3300049583 Ga0501067_0099414 Ga0501067_0099414_31_648 184
7 3300005329 Ga0070683_100002929 Ga0070683_10000292914 185
8 3300005329 Ga0070683_100003221 Ga0070683_10000322110 185
9 3300005345 Ga0070692_10252050 Ga0070692_102520502 185
10 3300005354 Ga0070675_100000153 Ga0070675_10000015322 185
11 3300005535 Ga0070684_100033478 Ga0070684_1000334785 185
12 3300005543 Ga0070672_100000057 Ga0070672_1000000579 185
13 3300006175 Ga0070712_100001300 Ga0070712_1000013005 185
14 3300009147 Ga0114129_10743544 Ga0114129_107435442 185
15 3300013102 Ga0157371_10004276 Ga0157371_1000427610 185
16 3300025915 Ga0207693_10000859 Ga0207693_100008596 185
17 3300025926 Ga0207659_10000043 Ga0207659_1000004325 185
18 3300025940 Ga0207691_10000374 Ga0207691_1000037441 185
19 3300025944 Ga0207661_10000142 Ga0207661_1000014239 185
20 3300025944 Ga0207661_10001987 Ga0207661_100019876 185
21 3300048911 Ga0496108_0001295 Ga0496108_0001295_11763_12374 185
22 3300048911 Ga0496108_0009647 Ga0496108_0009647_914_1525 185
23 3300048912 Ga0496109_0000035 Ga0496109_0000035_124813_125424 185
24 3300048912 Ga0496109_0000888 Ga0496109_0000888_11775_12386 185
25 3300049744 Ga0501083_0329397 Ga0501083_0329397_135_746 185
26 3300003373 JGI25407J50210_10030533 JGI25407J50210_100305331 186
27 3300005981 Ga0081538_10000032 Ga0081538_1000003263 186
28 3300013296 Ga0157374_10297473 Ga0157374_102974732 186
29 3300049576 Ga0501040_0353517 Ga0501040_0353517_269_871 186
30 3300005340 Ga0070689_100122698 Ga0070689_1001226982 187
31 3300005365 Ga0070688_100438513 Ga0070688_1004385132 187
32 3300005614 Ga0068856_100020527 Ga0068856_1000205276 187
33 3300009177 Ga0105248_10000022 Ga0105248_10000022251 187
34 3300010375 Ga0105239_10645854 Ga0105239_106458542 187
35 3300013100 Ga0157373_10496552 Ga0157373_104965521 187
36 3300013105 Ga0157369_10000118 Ga0157369_1000011842 187
37 3300014969 Ga0157376_10035064 Ga0157376_100350644 187
38 3300025936 Ga0207670_10128044 Ga0207670_101280442 187
39 3300025941 Ga0207711_10000019 Ga0207711_1000001988 187
40 3300026078 Ga0207702_10014910 Ga0207702_100149103 187
41 3300046461 Ga0495641_0022741 Ga0495641_0022741_673_1287 187
42 3300046499 Ga0495594_0000276 Ga0495594_0000276_5645_6256 187
43 3300046557 Ga0495622_0000690 Ga0495622_0000690_18432_19043 187
44 3300047321 Ga0495676_0000652 Ga0495676_0000652_3057_3671 187
45 3300005329 Ga0070683_100271872 Ga0070683_1002718722 188
46 3300005337 Ga0070682_100000815 Ga0070682_1000008159 188
47 3300005366 Ga0070659_100009701 Ga0070659_1000097015 188
48 3300005455 Ga0070663_100138260 Ga0070663_1001382602 188
49 3300005535 Ga0070684_100824467 Ga0070684_1008244672 188
50 3300005563 Ga0068855_100149600 Ga0068855_1001496004 188
51 3300005983 Ga0081540_1000546 Ga0081540_100054620 188
52 3300006881 Ga0068865_100000020 Ga0068865_10000002019 188
53 3300009098 Ga0105245_10002749 Ga0105245_1000274918 188
54 3300009986 Ga0105033_104983 Ga0105033_1049832 188
55 3300013297 Ga0157378_10092044 Ga0157378_100920443 188
56 3300013308 Ga0157375_10302567 Ga0157375_103025673 188
57 3300025927 Ga0207687_10000350 Ga0207687_1000035018 188
58 3300025932 Ga0207690_10006983 Ga0207690_100069832 188
59 3300025938 Ga0207704_10000004 Ga0207704_10000004173 188
60 3300025944 Ga0207661_10035924 Ga0207661_100359243 188
61 3300025972 Ga0207668_10299638 Ga0207668_102996382 188
62 3300026067 Ga0207678_10379396 Ga0207678_103793962 188
63 3300044842 Ga0466957_0151930 Ga0466957_0151930_214_825 188
64 3300045976 Ga0466967_0038536 Ga0466967_0038536_2514_3161 188
65 3300046462 Ga0495651_0296853 Ga0495651_0296853_59_631 188
66 3300046507 Ga0495606_0000045 Ga0495606_0000045_22940_23551 188
67 3300046511 Ga0495608_0000001 Ga0495608_0000001_237496_238107 188
68 3300046516 Ga0495628_0046466 Ga0495628_0046466_1095_1673 188
69 3300046516 Ga0495628_0150797 Ga0495628_0150797_285_896 188
70 3300046536 Ga0495587_0434493 Ga0495587_0434493_91_702 188
71 3300046674 Ga0495588_0000179 Ga0495588_0000179_2763_3395 188
72 3300046675 Ga0495657_0000002 Ga0495657_0000002_238176_238787 188
73 3300046684 Ga0495669_0121731 Ga0495669_0121731_18_587 188
74 3300046689 Ga0495613_0000122 Ga0495613_0000122_12984_13595 188
75 3300047317 Ga0495604_0000850 Ga0495604_0000850_19504_20115 188
76 3300047444 Ga0495675_0000046 Ga0495675_0000046_4541_5152 188
77 3300048088 Ga0495602_0000010 Ga0495602_0000010_187838_188452 188
78 3300048088 Ga0495602_0163145 Ga0495602_0163145_712_1323 188
79 3300048088 Ga0495602_0166521 Ga0495602_0166521_1045_1614 188
80 3300048911 Ga0496108_0001400 Ga0496108_0001400_6478_7107 188
81 3300048912 Ga0496109_0000246 Ga0496109_0000246_39648_40277 188
82 3300048913 Ga0496110_0002971 Ga0496110_0002971_4520_5131 188
83 3300048913 Ga0496110_0143574 Ga0496110_0143574_169_780 188
84 3300048914 Ga0496111_0000022 Ga0496111_0000022_9935_10546 188
85 3300048915 Ga0496112_0006530 Ga0496112_0006530_4565_5176 188
86 3300048916 Ga0496113_0000093 Ga0496113_0000093_20938_21549 188
87 3300048927 Ga0496124_0315264 Ga0496124_0315264_444_1055 188
88 3300053077 Ga0495601_0000012 Ga0495601_0000012_186118_186729 188
89 3300053083 Ga0495655_0000471 Ga0495655_0000471_4707_5321 188
90 3300053084 Ga0495595_0000001 Ga0495595_0000001_173172_173783 188
91 3300053084 Ga0495595_0001241 Ga0495595_0001241_4989_5603 188
92 3300053085 Ga0495619_0000120 Ga0495619_0000120_53126_53737 188
93 3300053085 Ga0495619_0000758 Ga0495619_0000758_20316_20930 188
94 3300005578 Ga0068854_100338387 Ga0068854_1003383872 189
95 3300005615 Ga0070702_100002851 Ga0070702_1000028514 189
96 3300005983 Ga0081540_1034794 Ga0081540_10347942 189
97 3300020082 Ga0206353_11601057 Ga0206353_116010574 189
98 3300025981 Ga0207640_10549871 Ga0207640_105498711 189
99 3300046516 Ga0495628_0000858 Ga0495628_0000858_3286_3903 189
100 3300046681 Ga0495647_0000003 Ga0495647_0000003_110566_111138 189
101 3300046690 Ga0495624_0000164 Ga0495624_0000164_14542_15114 189
102 3300047321 Ga0495676_0403765 Ga0495676_0403765_174_797 189
103 3300048088 Ga0495602_0000188 Ga0495602_0000188_56184_56801 189
104 3300048903 Ga0496100_0000063 Ga0496100_0000063_12125_12739 189
105 3300048904 Ga0496101_0000012 Ga0496101_0000012_264440_265054 189
106 3300048909 Ga0496106_0000020 Ga0496106_0000020_163941_164555 189
107 3300048910 Ga0496107_0000014 Ga0496107_0000014_163930_164544 189
108 3300048916 Ga0496113_0067331 Ga0496113_0067331_539_1129 189
109 3300050513 nmdc:mga0rr50_462661_c1 nmdc:mga0rr50_462661_c1_190_801 189
110 3300053085 Ga0495619_0000018 Ga0495619_0000018_149884_150495 189
111 3300045836 Ga0466958_0061588 Ga0466958_0061588_952_1563 190
112 3300046678 Ga0495599_0133382 Ga0495599_0133382_595_1206 190
113 3300010375 Ga0105239_10050654 Ga0105239_100506547 191
114 3300046615 Ga0495656_0003561 Ga0495656_0003561_3943_4524 191
115 3300009101 Ga0105247_10249726 Ga0105247_102497262 192
116 3300025900 Ga0207710_10112969 Ga0207710_101129692 192
117 3300028563 Ga0265319_1000029 Ga0265319_100002934 192
118 3300028666 Ga0265336_10055192 Ga0265336_100551922 192
119 3300028800 Ga0265338_10000179 Ga0265338_1000017942 192
120 3300029957 Ga0265324_10041275 Ga0265324_100412753 192
121 3300031241 Ga0265325_10011215 Ga0265325_100112155 192
122 3300031250 Ga0265331_10023328 Ga0265331_100233285 192
123 3300046536 Ga0495587_0054135 Ga0495587_0054135_1136_1753 192
124 3300046675 Ga0495657_0134059 Ga0495657_0134059_740_1372 193
125 3300049585 Ga0501069_0452417 Ga0501069_0452417_40_624 193
126 3300053077 Ga0495601_0012989 Ga0495601_0012989_3381_4013 193
127 3300048907 Ga0496104_0000666 Ga0496104_0000666_371_979 195
128 3300048908 Ga0496105_0004549 Ga0496105_0004549_3538_4146 195
129 3300048922 Ga0496119_0320679 Ga0496119_0320679_49_657 195
130 3300053077 Ga0495601_0245779 Ga0495601_0245779_287_895 195
131 3300006175 Ga0070712_100224422 Ga0070712_1002244222 198
132 3300005356 Ga0070674_100000014 Ga0070674_10000001416 199
133 3300005718 Ga0068866_10000219 Ga0068866_1000021918 199
134 3300009147 Ga0114129_10592930 Ga0114129_105929303 199
135 3300009148 Ga0105243_10221148 Ga0105243_102211481 199
136 3300009176 Ga0105242_10008605 Ga0105242_100086055 199
137 3300025899 Ga0207642_10000094 Ga0207642_1000009421 199
138 3300025934 Ga0207686_10015756 Ga0207686_100157564 199
139 3300025937 Ga0207669_10000007 Ga0207669_1000000726 199
140 3300035398 Ga0316574_0252193 Ga0316574_0252193_155_781 199
141 3300046663 Ga0495635_0242685 Ga0495635_0242685_194_799 199
142 3300048911 Ga0496108_0010707 Ga0496108_0010707_5610_6218 199
143 3300048916 Ga0496113_0058250 Ga0496113_0058250_772_1380 199
144 3300049569 Ga0501032_0376465 Ga0501032_0376465_257_859 199
145 3300049572 Ga0501036_0054873 Ga0501036_0054873_2144_2746 199
146 3300049575 Ga0501039_0306210 Ga0501039_0306210_552_1154 199
147 3300049576 Ga0501040_0086471 Ga0501040_0086471_306_908 199
148 3300049577 Ga0501041_0100089 Ga0501041_0100089_57_659 199
149 3300049582 Ga0501048_0046586 Ga0501048_0046586_371_973 199
150 3300049588 Ga0501072_0017787 Ga0501072_0017787_357_959 199
151 3300049592 Ga0501076_0002784 Ga0501076_0002784_6706_7308 199
152 3300049741 Ga0501079_0013453 Ga0501079_0013453_1053_1655 199
153 3300049743 Ga0501081_0004692 Ga0501081_0004692_1693_2295 199
154 3300049824 Ga0501045_0496404 Ga0501045_0496404_52_654 199
155 3300054114 Ga0501084_0215158 Ga0501084_0215158_980_1582 199
156 3300060353 Ga0501082_0195069 Ga0501082_0195069_1006_1608 199
157 3300061734 Ga0530510_0000462 Ga0530510_0000462_6353_6955 199
158 3300005344 Ga0070661_100699584 Ga0070661_1006995841 200
159 3300005356 Ga0070674_100008150 Ga0070674_1000081503 200
160 3300005367 Ga0070667_100242123 Ga0070667_1002421232 200
161 3300005535 Ga0070684_100022662 Ga0070684_1000226622 200
162 3300025937 Ga0207669_10015801 Ga0207669_100158012 200
163 3300025944 Ga0207661_10930911 Ga0207661_109309112 200
164 3300035086 Ga0373934_0132598 Ga0373934_0132598_308_913 200
165 3300036401 Ga0373937_0215040 Ga0373937_0215040_1169_1774 200
166 3300037418 Ga0395900_0570731 Ga0395900_0570731_378_983 200
167 3300037471 Ga0395905_0170928 Ga0395905_0170928_1061_1666 200
168 3300046642 Ga0495634_0182919 Ga0495634_0182919_154_759 200
169 3300046678 Ga0495599_0119765 Ga0495599_0119765_263_868 200
170 3300047317 Ga0495604_0235900 Ga0495604_0235900_91_696 200
171 3300047319 Ga0495674_0355247 Ga0495674_0355247_549_1154 200
172 3300048913 Ga0496110_0018894 Ga0496110_0018894_4269_4874 200
173 3300048914 Ga0496111_0009354 Ga0496111_0009354_4350_4955 200
174 3300048915 Ga0496112_0103593 Ga0496112_0103593_1753_2358 200
175 3300048916 Ga0496113_0083986 Ga0496113_0083986_1606_2211 200
176 3300048918 Ga0496115_0000004 Ga0496115_0000004_270639_271241 200
177 3300053077 Ga0495601_0023415 Ga0495601_0023415_1736_2341 200
178 3300053078 Ga0495612_0017880 Ga0495612_0017880_761_1366 200
179 3300053085 Ga0495619_0070764 Ga0495619_0070764_725_1330 200
180 3300001979 JGI24740J21852_10005676 JGI24740J21852_100056766 201
181 3300005338 Ga0068868_100888619 Ga0068868_1008886191 201
182 3300005549 Ga0070704_100191041 Ga0070704_1001910413 201
183 3300005616 Ga0068852_100000058 Ga0068852_10000005828 201
184 3300005840 Ga0068870_10271648 Ga0068870_102716482 201
185 3300005937 Ga0081455_10207032 Ga0081455_102070322 201
186 3300009101 Ga0105247_10000993 Ga0105247_1000099315 201
187 3300009176 Ga0105242_10238304 Ga0105242_102383043 201
188 3300013297 Ga0157378_10386968 Ga0157378_103869683 201
189 3300025900 Ga0207710_10000151 Ga0207710_1000015135 201
190 3300025972 Ga0207668_10498915 Ga0207668_104989151 201
191 3300026142 Ga0207698_10000002 Ga0207698_10000002169 201
192 3300028379 Ga0268266_10036593 Ga0268266_100365932 201
193 3300044694 Ga0466963_0000124 Ga0466963_0000124_3461_4066 201
194 3300045836 Ga0466958_0028489 Ga0466958_0028489_2498_3124 201
195 3300046500 Ga0495596_0085691 Ga0495596_0085691_445_1053 201
196 3300046529 Ga0495652_0060323 Ga0495652_0060323_1245_1853 201
197 3300046684 Ga0495669_0015561 Ga0495669_0015561_1389_1997 201
198 3300046690 Ga0495624_0002296 Ga0495624_0002296_4781_5386 201
199 3300046690 Ga0495624_0003753 Ga0495624_0003753_7537_8142 201
200 3300047447 Ga0495685_017740 Ga0495685_017740_431_1036 201
201 3300048907 Ga0496104_0000002 Ga0496104_0000002_123568_124173 201
202 3300048908 Ga0496105_0000001 Ga0496105_0000001_1204006_1204611 201
203 3300048913 Ga0496110_0025732 Ga0496110_0025732_653_1261 201
204 3300048914 Ga0496111_0139036 Ga0496111_0139036_701_1309 201
205 3300048922 Ga0496119_0019537 Ga0496119_0019537_1527_2132 201
206 3300048923 Ga0496120_0049030 Ga0496120_0049030_407_1012 201
207 3300049580 Ga0501046_0147556 Ga0501046_0147556_20_628 201
208 3300049587 Ga0501071_0223791 Ga0501071_0223791_317_925 201
209 3300053077 Ga0495601_0266134 Ga0495601_0266134_175_783 201
210 3300053077 Ga0495601_0569593 Ga0495601_0569593_88_693 201
211 3300053083 Ga0495655_0004966 Ga0495655_0004966_1621_2229 201
212 3300001977 JGI24746J21847_1000728 JGI24746J21847_10007283 202
213 3300002074 JGI24748J21848_1003138 JGI24748J21848_10031384 202
214 3300002239 JGI24034J26672_10000167 JGI24034J26672_100001677 202
215 3300002244 JGI24742J22300_10000390 JGI24742J22300_100003905 202
216 3300002459 JGI24751J29686_10026666 JGI24751J29686_100266663 202
217 3300003203 JGI25406J46586_10021614 JGI25406J46586_100216142 202
218 3300005329 Ga0070683_100004842 Ga0070683_1000048425 202
219 3300005329 Ga0070683_100015414 Ga0070683_1000154145 202
220 3300005335 Ga0070666_10023706 Ga0070666_100237063 202
221 3300005337 Ga0070682_100000029 Ga0070682_10000002918 202
222 3300005338 Ga0068868_100043307 Ga0068868_1000433073 202
223 3300005340 Ga0070689_100243560 Ga0070689_1002435602 202
224 3300005341 Ga0070691_10003720 Ga0070691_100037205 202
225 3300005344 Ga0070661_100000161 Ga0070661_1000001618 202
226 3300005347 Ga0070668_100295683 Ga0070668_1002956832 202
227 3300005356 Ga0070674_100000011 Ga0070674_1000000115 202
228 3300005356 Ga0070674_100106832 Ga0070674_1001068323 202
229 3300005364 Ga0070673_100019029 Ga0070673_1000190296 202
230 3300005365 Ga0070688_100001064 Ga0070688_10000106414 202
231 3300005367 Ga0070667_100225233 Ga0070667_1002252331 202
232 3300005435 Ga0070714_100008340 Ga0070714_1000083401 202
233 3300005441 Ga0070700_100038140 Ga0070700_1000381402 202
234 3300005455 Ga0070663_100312538 Ga0070663_1003125383 202
235 3300005456 Ga0070678_100097451 Ga0070678_1000974512 202
236 3300005456 Ga0070678_100408611 Ga0070678_1004086113 202
237 3300005457 Ga0070662_100000008 Ga0070662_10000000868 202
238 3300005458 Ga0070681_10043861 Ga0070681_100438614 202
239 3300005459 Ga0068867_100000247 Ga0068867_10000024710 202
240 3300005466 Ga0070685_10000203 Ga0070685_1000020323 202
241 3300005530 Ga0070679_100000651 Ga0070679_10000065125 202
242 3300005535 Ga0070684_100022755 Ga0070684_1000227555 202
243 3300005535 Ga0070684_100117307 Ga0070684_1001173073 202
244 3300005539 Ga0068853_100031684 Ga0068853_1000316844 202
245 3300005544 Ga0070686_100022154 Ga0070686_1000221543 202
246 3300005547 Ga0070693_100000398 Ga0070693_1000003988 202
247 3300005548 Ga0070665_100000870 Ga0070665_10000087031 202
248 3300005548 Ga0070665_100002483 Ga0070665_10000248310 202
249 3300005548 Ga0070665_100047809 Ga0070665_1000478095 202
250 3300005563 Ga0068855_100356527 Ga0068855_1003565273 202
251 3300005578 Ga0068854_100000115 Ga0068854_10000011548 202
252 3300005614 Ga0068856_100000057 Ga0068856_10000005753 202
253 3300005614 Ga0068856_100010700 Ga0068856_1000107004 202
254 3300005614 Ga0068856_100420788 Ga0068856_1004207881 202
255 3300005618 Ga0068864_100000044 Ga0068864_100000044133 202
256 3300005718 Ga0068866_10000002 Ga0068866_1000000251 202
257 3300005834 Ga0068851_10001867 Ga0068851_100018678 202
258 3300005841 Ga0068863_100000042 Ga0068863_10000004244 202
259 3300005842 Ga0068858_100000086 Ga0068858_10000008614 202
260 3300005842 Ga0068858_100000155 Ga0068858_10000015540 202
261 3300005842 Ga0068858_100064971 Ga0068858_1000649711 202
262 3300005843 Ga0068860_100010275 Ga0068860_1000102754 202
263 3300005937 Ga0081455_10394222 Ga0081455_103942222 202
264 3300005985 Ga0081539_10001100 Ga0081539_1000110039 202
265 3300005985 Ga0081539_10003159 Ga0081539_1000315921 202
266 3300006163 Ga0070715_10000015 Ga0070715_10000015116 202
267 3300006852 Ga0075433_10000663 Ga0075433_100006639 202
268 3300009094 Ga0111539_10956239 Ga0111539_109562391 202
269 3300009098 Ga0105245_10000159 Ga0105245_1000015943 202
270 3300009098 Ga0105245_10001015 Ga0105245_1000101518 202
271 3300009148 Ga0105243_10004998 Ga0105243_100049988 202
272 3300009176 Ga0105242_10002766 Ga0105242_1000276612 202
273 3300009177 Ga0105248_10529203 Ga0105248_105292032 202
274 3300009553 Ga0105249_10189958 Ga0105249_101899584 202
275 3300010375 Ga0105239_10659490 Ga0105239_106594902 202
276 3300013104 Ga0157370_10006328 Ga0157370_100063288 202
277 3300013104 Ga0157370_10187874 Ga0157370_101878743 202
278 3300013104 Ga0157370_10563265 Ga0157370_105632652 202
279 3300013296 Ga0157374_10002177 Ga0157374_100021775 202
280 3300013307 Ga0157372_10000616 Ga0157372_1000061618 202
281 3300013308 Ga0157375_10000184 Ga0157375_1000018436 202
282 3300014325 Ga0163163_10207424 Ga0163163_102074244 202
283 3300014325 Ga0163163_10801426 Ga0163163_108014261 202
284 3300014325 Ga0163163_10975566 Ga0163163_109755661 202
285 3300014326 Ga0157380_10000080 Ga0157380_1000008015 202
286 3300014968 Ga0157379_10125057 Ga0157379_101250572 202
287 3300017792 Ga0163161_10000173 Ga0163161_1000017351 202
288 3300020070 Ga0206356_11661110 Ga0206356_116611104 202
289 3300025321 Ga0207656_10000354 Ga0207656_1000035412 202
290 3300025321 Ga0207656_10004306 Ga0207656_100043065 202
291 3300025893 Ga0207682_10000228 Ga0207682_100002285 202
292 3300025899 Ga0207642_10000001 Ga0207642_10000001557 202
293 3300025899 Ga0207642_10000003 Ga0207642_10000003557 202
294 3300025903 Ga0207680_10048971 Ga0207680_100489713 202
295 3300025905 Ga0207685_10000001 Ga0207685_10000001310 202
296 3300025909 Ga0207705_10091476 Ga0207705_100914763 202
297 3300025912 Ga0207707_10018135 Ga0207707_100181358 202
298 3300025920 Ga0207649_10000024 Ga0207649_1000002456 202
299 3300025921 Ga0207652_10000150 Ga0207652_1000015051 202
300 3300025927 Ga0207687_10000011 Ga0207687_10000011350 202
301 3300025927 Ga0207687_10000021 Ga0207687_10000021155 202
302 3300025927 Ga0207687_10000716 Ga0207687_100007165 202
303 3300025929 Ga0207664_10056834 Ga0207664_100568342 202
304 3300025932 Ga0207690_10121085 Ga0207690_101210854 202
305 3300025933 Ga0207706_10000016 Ga0207706_10000016106 202
306 3300025934 Ga0207686_10000549 Ga0207686_100005499 202
307 3300025934 Ga0207686_10070529 Ga0207686_100705292 202
308 3300025936 Ga0207670_10129878 Ga0207670_101298782 202
309 3300025937 Ga0207669_10000027 Ga0207669_100000275 202
310 3300025941 Ga0207711_10362123 Ga0207711_103621232 202
311 3300025944 Ga0207661_10003394 Ga0207661_1000339410 202
312 3300025944 Ga0207661_10007802 Ga0207661_100078025 202
313 3300025944 Ga0207661_10553874 Ga0207661_105538742 202
314 3300025949 Ga0207667_10380532 Ga0207667_103805322 202
315 3300025960 Ga0207651_10029595 Ga0207651_100295955 202
316 3300025961 Ga0207712_10000033 Ga0207712_1000003330 202
317 3300025972 Ga0207668_10099829 Ga0207668_100998292 202
318 3300025981 Ga0207640_10000059 Ga0207640_1000005942 202
319 3300025981 Ga0207640_10001105 Ga0207640_100011058 202
320 3300025986 Ga0207658_10044890 Ga0207658_100448903 202
321 3300025986 Ga0207658_10331673 Ga0207658_103316731 202
322 3300026023 Ga0207677_10004273 Ga0207677_100042732 202
323 3300026023 Ga0207677_10039439 Ga0207677_100394393 202
324 3300026035 Ga0207703_10000072 Ga0207703_1000007282 202
325 3300026035 Ga0207703_10000266 Ga0207703_1000026648 202
326 3300026041 Ga0207639_10003854 Ga0207639_100038546 202
327 3300026067 Ga0207678_10153719 Ga0207678_101537192 202
328 3300026075 Ga0207708_10100994 Ga0207708_101009944 202
329 3300026078 Ga0207702_10000027 Ga0207702_1000002794 202
330 3300026078 Ga0207702_10007605 Ga0207702_100076055 202
331 3300026078 Ga0207702_10369951 Ga0207702_103699513 202
332 3300026088 Ga0207641_10000231 Ga0207641_1000023144 202
333 3300026089 Ga0207648_10000230 Ga0207648_1000023016 202
334 3300026095 Ga0207676_10000043 Ga0207676_10000043132 202
335 3300026121 Ga0207683_10010360 Ga0207683_100103608 202
336 3300026121 Ga0207683_10421762 Ga0207683_104217622 202
337 3300028379 Ga0268266_10000076 Ga0268266_10000076187 202
338 3300028379 Ga0268266_10004334 Ga0268266_1000433411 202
339 3300028379 Ga0268266_10194892 Ga0268266_101948922 202
340 3300028381 Ga0268264_10008628 Ga0268264_1000862810 202
341 3300028573 Ga0265334_10032003 Ga0265334_100320034 202
342 3300035111 Ga0373923_0277658 Ga0373923_0277658_18_632 202
343 3300035725 Ga0373947_0433599 Ga0373947_0433599_158_766 202
344 3300036401 Ga0373937_0041924 Ga0373937_0041924_2033_2647 202
345 3300036401 Ga0373937_0312578 Ga0373937_0312578_836_1450 202
346 3300041491 Ga0451833_1024539 Ga0451833_1024539_488_1129 202
347 3300041512 Ga0451853_0674116 Ga0451853_0674116_955_1572 202
348 3300046454 Ga0495592_0000521 Ga0495592_0000521_15062_15676 202
349 3300046454 Ga0495592_0064755 Ga0495592_0064755_771_1382 202
350 3300046455 Ga0495603_0000622 Ga0495603_0000622_1422_2033 202
351 3300046455 Ga0495603_0004750 Ga0495603_0004750_6653_7267 202
352 3300046459 Ga0495629_0001361 Ga0495629_0001361_6220_6831 202
353 3300046459 Ga0495629_0150945 Ga0495629_0150945_68_688 202
354 3300046461 Ga0495641_0000001 Ga0495641_0000001_189035_189652 202
355 3300046462 Ga0495651_0551403 Ga0495651_0551403_92_715 202
356 3300046463 Ga0495653_0098333 Ga0495653_0098333_1316_1927 202
357 3300046463 Ga0495653_0162105 Ga0495653_0162105_500_1114 202
358 3300046463 Ga0495653_0206221 Ga0495653_0206221_54_677 202
359 3300046473 Ga0495582_0000022 Ga0495582_0000022_68270_68887 202
360 3300046475 Ga0495639_0030389 Ga0495639_0030389_1479_2090 202
361 3300046476 Ga0495662_0000137 Ga0495662_0000137_13088_13699 202
362 3300046476 Ga0495662_0009206 Ga0495662_0009206_1300_1911 202
363 3300046511 Ga0495608_0000163 Ga0495608_0000163_12435_13055 202
364 3300046511 Ga0495608_0287385 Ga0495608_0287385_306_923 202
365 3300046514 Ga0495618_0001468 Ga0495618_0001468_1118_1732 202
366 3300046515 Ga0495620_0001840 Ga0495620_0001840_9013_9645 202
367 3300046516 Ga0495628_0026019 Ga0495628_0026019_2748_3356 202
368 3300046516 Ga0495628_0061540 Ga0495628_0061540_1045_1662 202
369 3300046516 Ga0495628_0201839 Ga0495628_0201839_223_834 202
370 3300046517 Ga0495630_0000037 Ga0495630_0000037_4807_5439 202
371 3300046517 Ga0495630_0020101 Ga0495630_0020101_3414_4025 202
372 3300046517 Ga0495630_0070337 Ga0495630_0070337_1344_1970 202
373 3300046523 Ga0495644_0000454 Ga0495644_0000454_1212_1826 202
374 3300046529 Ga0495652_0000086 Ga0495652_0000086_32185_32811 202
375 3300046533 Ga0495640_0021952 Ga0495640_0021952_2892_3506 202
376 3300046533 Ga0495640_0112327 Ga0495640_0112327_92_703 202
377 3300046535 Ga0495586_0007201 Ga0495586_0007201_4941_5558 202
378 3300046536 Ga0495587_0001022 Ga0495587_0001022_12246_12857 202
379 3300046536 Ga0495587_0029073 Ga0495587_0029073_1294_1908 202
380 3300046539 Ga0495621_0011410 Ga0495621_0011410_1362_1973 202
381 3300046543 Ga0495645_0024357 Ga0495645_0024357_759_1403 202
382 3300046558 Ga0495633_0006532 Ga0495633_0006532_1071_1700 202
383 3300046642 Ga0495634_0000013 Ga0495634_0000013_25371_25982 202
384 3300046642 Ga0495634_0001471 Ga0495634_0001471_19117_19737 202
385 3300046642 Ga0495634_0090023 Ga0495634_0090023_1217_1849 202
386 3300046642 Ga0495634_0141968 Ga0495634_0141968_536_1150 202
387 3300046660 Ga0495625_0001659 Ga0495625_0001659_4244_4855 202
388 3300046663 Ga0495635_0000063 Ga0495635_0000063_21477_22091 202
389 3300046663 Ga0495635_0067371 Ga0495635_0067371_855_1475 202
390 3300046663 Ga0495635_0343917 Ga0495635_0343917_232_864 202
391 3300046678 Ga0495599_0006457 Ga0495599_0006457_454_1071 202
392 3300046678 Ga0495599_0127676 Ga0495599_0127676_789_1430 202
393 3300046681 Ga0495647_0003248 Ga0495647_0003248_1544_2161 202
394 3300046681 Ga0495647_0008323 Ga0495647_0008323_1327_1959 202
395 3300046683 Ga0495658_0000008 Ga0495658_0000008_68710_69327 202
396 3300046683 Ga0495658_0098296 Ga0495658_0098296_1087_1698 202
397 3300046684 Ga0495669_0000651 Ga0495669_0000651_11363_11989 202
398 3300046689 Ga0495613_0000369 Ga0495613_0000369_35259_35873 202
399 3300046689 Ga0495613_0204189 Ga0495613_0204189_594_1205 202
400 3300046691 Ga0495670_0007059 Ga0495670_0007059_1201_1830 202
401 3300046691 Ga0495670_0150665 Ga0495670_0150665_337_948 202
402 3300046694 Ga0495649_0030299 Ga0495649_0030299_891_1508 202
403 3300046809 Ga0495600_0035731 Ga0495600_0035731_1555_2169 202
404 3300046809 Ga0495600_0097188 Ga0495600_0097188_1109_1738 202
405 3300047317 Ga0495604_0000033 Ga0495604_0000033_72014_72625 202
406 3300047317 Ga0495604_0050587 Ga0495604_0050587_1074_1685 202
407 3300047319 Ga0495674_0000007 Ga0495674_0000007_143670_144281 202
408 3300047321 Ga0495676_0001759 Ga0495676_0001759_15048_15665 202
409 3300047322 Ga0495680_0000215 Ga0495680_0000215_33978_34598 202
410 3300047322 Ga0495680_0000587 Ga0495680_0000587_5361_5975 202
411 3300047322 Ga0495680_0036038 Ga0495680_0036038_2124_2744 202
412 3300047444 Ga0495675_0015728 Ga0495675_0015728_2731_3342 202
413 3300047471 Ga0495684_0110662 Ga0495684_0110662_711_1322 202
414 3300047471 Ga0495684_0529728 Ga0495684_0529728_80_760 202
415 3300047472 Ga0495686_0129780 Ga0495686_0129780_443_1054 202
416 3300047673 Ga0495593_0010922 Ga0495593_0010922_2729_3340 202
417 3300048903 Ga0496100_0000003 Ga0496100_0000003_196254_196880 202
418 3300048904 Ga0496101_0000003 Ga0496101_0000003_196254_196880 202
419 3300048905 Ga0496102_0105895 Ga0496102_0105895_1072_1692 202
420 3300048907 Ga0496104_0000066 Ga0496104_0000066_28462_29094 202
421 3300048908 Ga0496105_0000020 Ga0496105_0000020_152391_153023 202
422 3300048908 Ga0496105_0022756 Ga0496105_0022756_922_1551 202
423 3300048909 Ga0496106_0000015 Ga0496106_0000015_65697_66323 202
424 3300048910 Ga0496107_0000008 Ga0496107_0000008_87314_87940 202
425 3300048911 Ga0496108_0000002 Ga0496108_0000002_67834_68442 202
426 3300048912 Ga0496109_0000001 Ga0496109_0000001_67796_68404 202
427 3300048912 Ga0496109_0533390 Ga0496109_0533390_367_978 202
428 3300048914 Ga0496111_0031644 Ga0496111_0031644_995_1606 202
429 3300048914 Ga0496111_0532169 Ga0496111_0532169_51_671 202
430 3300048915 Ga0496112_0000003 Ga0496112_0000003_637604_638215 202
431 3300048916 Ga0496113_0017949 Ga0496113_0017949_1937_2548 202
432 3300048916 Ga0496113_0146468 Ga0496113_0146468_18_629 202
433 3300048916 Ga0496113_0157168 Ga0496113_0157168_44_658 202
434 3300048916 Ga0496113_0822161 Ga0496113_0822161_96_707 202
435 3300048917 Ga0496114_0030582 Ga0496114_0030582_2432_3052 202
436 3300048928 Ga0496125_0047605 Ga0496125_0047605_1193_1801 202
437 3300049578 Ga0501042_0012267 Ga0501042_0012267_3915_4526 202
438 3300049578 Ga0501042_0019107 Ga0501042_0019107_1982_2593 202
439 3300049582 Ga0501048_0547258 Ga0501048_0547258_31_648 202
440 3300049586 Ga0501070_0420345 Ga0501070_0420345_60_671 202
441 3300049588 Ga0501072_0147757 Ga0501072_0147757_469_1086 202
442 3300049591 Ga0501075_0007890 Ga0501075_0007890_1569_2180 202
443 3300049591 Ga0501075_0776284 Ga0501075_0776284_79_696 202
444 3300049592 Ga0501076_0690294 Ga0501076_0690294_84_701 202
445 3300049741 Ga0501079_0390869 Ga0501079_0390869_134_751 202
446 3300049743 Ga0501081_0353171 Ga0501081_0353171_462_1073 202
447 3300050509 nmdc:mga0qj67_67177_c1 nmdc:mga0qj67_67177_c1_2077_2688 202
448 3300050515 nmdc:mga0a205_155_c1 nmdc:mga0a205_155_c1_19403_20011 202
449 3300053077 Ga0495601_0000169 Ga0495601_0000169_19119_19736 202
450 3300053077 Ga0495601_0103639 Ga0495601_0103639_968_1600 202
451 3300053078 Ga0495612_0001003 Ga0495612_0001003_6854_7468 202
452 3300053078 Ga0495612_0060720 Ga0495612_0060720_311_922 202
453 3300053078 Ga0495612_0076366 Ga0495612_0076366_693_1307 202
454 3300053084 Ga0495595_0000372 Ga0495595_0000372_1286_1897 202
455 3300053085 Ga0495619_0000015 Ga0495619_0000015_88644_89255 202
456 3300053085 Ga0495619_0007151 Ga0495619_0007151_3567_4199 202
457 3300053085 Ga0495619_0040276 Ga0495619_0040276_1047_1661 202
458 3300053085 Ga0495619_0368707 Ga0495619_0368707_261_881 202
459 3300053096 Ga0500641_0017264 Ga0500641_0017264_968_1579 202
460 3300053123 Ga0500614_000374 Ga0500614_000374_8411_9028 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08242

Methyltransf_12

Methyltransferase domain

61

158

0.97

PF13847

Methyltransf_31

Methyltransferase domain

54

182

0.96

PF13649

Methyltransf_25

Methyltransferase domain

60

156

0.95

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

40

175

0.94

PF08241

Methyltransf_11

Methyltransferase domain

61

160

0.94

PF13489

Methyltransf_23

Methyltransferase domain

34

183

0.82

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

21

163

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.9151 42 200
5kn4-assembly1.cif.gz_B pavine n-methyltransferase apoenzyme ph 6.0 0.9079 45 162
3mgg-assembly1.cif.gz_A crystal structure of methyl transferase from methanosarcina mazei 0.8982 56 163
4pne-assembly3.cif.gz_B crystal structure of the [4+2]-cyclase spnf 0.8977 45 190
4pne-assembly3.cif.gz_A crystal structure of the [4+2]-cyclase spnf 0.8946 45 190
ID Description Score Start End Superfamily
af_Q54LU3_44_217_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.919 45 160 3.40.50.150
3dh0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9151 42 200 3.40.50.150
af_C7J169_1_82_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9054 45 110 3.40.50.150
af_K7KE15_1_124_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9012 44 160 3.40.50.150
af_K7LTE4_237_888_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8998 45 117 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1G0LN26-F1-model_v4 Methyltransferase type 11 0.9867 57 202 GO:0008757
GO:0032259
AF-A0A1H6FJQ3-F1-model_v4 UbiE/COQ5 methyltransferase family protein 0.9818 45 201 GO:0008168
GO:0032259
AF-A0A419W307-F1-model_v4 Arsenite methyltransferase (EC 2.1.1.137) 0.9782 58 201 GO:0008168
GO:0032259
AF-A0A7J2IRE3-F1-model_v4 Methyltransferase domain-containing protein 0.9759 42 201 GO:0004222
GO:0008168
GO:0016020
GO:0032259
GO:0071586
AF-X1HEA1-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9745 55 181 GO:0008757
GO:0032259

Feature Viewer

pLDDT pTM Quality
86.4 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map