F448619
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 460 | 251 | 460 | 200 |
Family's Representative Sequence
| Representative Sequence | 3300047471|Ga0495684_0529728|Ga0495684_0529728_80_760 |
| Length | 226 |
| Sequence | MRLRTLAYAGAAAALGASLWWRKNPSACPYGQRFWVQAPHPIVTRERLFFVMRPEAGERVLEIGPGTGYYTLDIAEWVGSEGTVEIFDLQQEFLDHTMARAAERGHENVVPTRGDATDLPYEAGTMDAVVLNAVLGEIPDPVAALREIRRVLKPTGRLLVGELFGDPHFTTQAALRRQGAEAGLAYADQSGYWFGYVGRLTPTAPATRRHPAASRGSPCRRCSGSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 128 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 129 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 130 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 133 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 134 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 135 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 136 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 137 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 138 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 139 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 140 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 141 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 143 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 144 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 145 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 146 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 147 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 148 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 149 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 150 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 204 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 205 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 206 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 207 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 208 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 211 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 212 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 213 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 214 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 215 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 216 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 217 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 218 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 219 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 220 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 248 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 249 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.57 |
| Metatranscriptomes | 0.43 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.43 |
| Nodule | 0 |
| Rhizoplane | 10.43 |
| Rhizosphere | 87.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000728 | 3300001977 | Bacteria | 5066 |
| 2 | JGI24740J21852_10005676 | 3300001979 | Bacteria | 5254 |
| 3 | JGI24748J21848_1003138 | 3300002074 | Bacteria | 1884 |
| 4 | JGI24034J26672_10000167 | 3300002239 | Bacteria | 9222 |
| 5 | JGI24742J22300_10000390 | 3300002244 | Bacteria | 6507 |
| 6 | JGI24751J29686_10026666 | 3300002459 | Bacteria | 1199 |
| 7 | JGI25406J46586_10021614 | 3300003203 | Bacteria | 2578 |
| 8 | JGI25407J50210_10030533 | 3300003373 | Unclassified | 1396 |
| 9 | Ga0070683_100002929 | 3300005329 | Bacteria | 13677 |
| 10 | Ga0070683_100003221 | 3300005329 | Bacteria | 13175 |
| 11 | Ga0070683_100004842 | 3300005329 | Bacteria | 11145 |
| 12 | Ga0070683_100015414 | 3300005329 | Bacteria | 6713 |
| 13 | Ga0070683_100271872 | 3300005329 | Bacteria | 1612 |
| 14 | Ga0070666_10023706 | 3300005335 | Bacteria | 3996 |
| 15 | Ga0070682_100000029 | 3300005337 | Bacteria | 183516 |
| 16 | Ga0070682_100000815 | 3300005337 | Bacteria | 18228 |
| 17 | Ga0068868_100043307 | 3300005338 | Bacteria | 3516 |
| 18 | Ga0068868_100888619 | 3300005338 | Bacteria | 809 |
| 19 | Ga0070689_100122698 | 3300005340 | Bacteria | 2076 |
| 20 | Ga0070689_100243560 | 3300005340 | Bacteria | 1482 |
| 21 | Ga0070691_10003720 | 3300005341 | Bacteria | 6890 |
| 22 | Ga0070661_100000161 | 3300005344 | Bacteria | 55183 |
| 23 | Ga0070661_100699584 | 3300005344 | Bacteria | 826 |
| 24 | Ga0070692_10252050 | 3300005345 | Bacteria | 1057 |
| 25 | Ga0070668_100295683 | 3300005347 | Bacteria | 1357 |
| 26 | Ga0070675_100000153 | 3300005354 | Bacteria | 41558 |
| 27 | Ga0070674_100000011 | 3300005356 | Bacteria | 134886 |
| 28 | Ga0070674_100000014 | 3300005356 | Bacteria | 100122 |
| 29 | Ga0070674_100008150 | 3300005356 | Bacteria | 6217 |
| 30 | Ga0070674_100106832 | 3300005356 | Bacteria | 2049 |
| 31 | Ga0070673_100019029 | 3300005364 | Bacteria | 4925 |
| 32 | Ga0070688_100000453 | 3300005365 | Bacteria | 20787 |
| 33 | Ga0070688_100001064 | 3300005365 | Bacteria | 13776 |
| 34 | Ga0070688_100438513 | 3300005365 | Bacteria | 974 |
| 35 | Ga0070659_100009701 | 3300005366 | Bacteria | 7074 |
| 36 | Ga0070667_100225233 | 3300005367 | Bacteria | 1670 |
| 37 | Ga0070667_100242123 | 3300005367 | Unclassified | 1611 |
| 38 | Ga0070714_100008340 | 3300005435 | Bacteria | 8083 |
| 39 | Ga0070700_100038140 | 3300005441 | Bacteria | 2927 |
| 40 | Ga0070663_100138260 | 3300005455 | Bacteria | 1857 |
| 41 | Ga0070663_100312538 | 3300005455 | Bacteria | 1261 |
| 42 | Ga0070678_100097451 | 3300005456 | Bacteria | 2271 |
| 43 | Ga0070678_100408611 | 3300005456 | Unclassified | 1181 |
| 44 | Ga0070662_100000008 | 3300005457 | Bacteria | 168754 |
| 45 | Ga0070681_10043861 | 3300005458 | Bacteria | 4477 |
| 46 | Ga0068867_100000247 | 3300005459 | Bacteria | 35692 |
| 47 | Ga0070685_10000203 | 3300005466 | Bacteria | 39835 |
| 48 | Ga0070685_10000754 | 3300005466 | Bacteria | 17603 |
| 49 | Ga0070679_100000651 | 3300005530 | Bacteria | 29562 |
| 50 | Ga0070684_100022662 | 3300005535 | Bacteria | 5241 |
| 51 | Ga0070684_100022755 | 3300005535 | Bacteria | 5232 |
| 52 | Ga0070684_100033478 | 3300005535 | Bacteria | 4388 |
| 53 | Ga0070684_100117307 | 3300005535 | Bacteria | 2392 |
| 54 | Ga0070684_100824467 | 3300005535 | Bacteria | 868 |
| 55 | Ga0068853_100031684 | 3300005539 | Bacteria | 4473 |
| 56 | Ga0070672_100000057 | 3300005543 | Bacteria | 50189 |
| 57 | Ga0070686_100022154 | 3300005544 | Bacteria | 3781 |
| 58 | Ga0070693_100000398 | 3300005547 | Bacteria | 19763 |
| 59 | Ga0070665_100000870 | 3300005548 | Bacteria | 39061 |
| 60 | Ga0070665_100002483 | 3300005548 | Bacteria | 20309 |
| 61 | Ga0070665_100047809 | 3300005548 | Bacteria | 4294 |
| 62 | Ga0070704_100191041 | 3300005549 | Bacteria | 1646 |
| 63 | Ga0068855_100149600 | 3300005563 | Bacteria | 2655 |
| 64 | Ga0068855_100356527 | 3300005563 | Bacteria | 1610 |
| 65 | Ga0068854_100000115 | 3300005578 | Bacteria | 55089 |
| 66 | Ga0068854_100338387 | 3300005578 | Bacteria | 1228 |
| 67 | Ga0068856_100000057 | 3300005614 | Bacteria | 102045 |
| 68 | Ga0068856_100010700 | 3300005614 | Bacteria | 8912 |
| 69 | Ga0068856_100020527 | 3300005614 | Bacteria | 6417 |
| 70 | Ga0068856_100420788 | 3300005614 | Bacteria | 1356 |
| 71 | Ga0070702_100002851 | 3300005615 | Bacteria | 7585 |
| 72 | Ga0068852_100000058 | 3300005616 | Bacteria | 75312 |
| 73 | Ga0068864_100000044 | 3300005618 | Bacteria | 157919 |
| 74 | Ga0068866_10000002 | 3300005718 | Bacteria | 394090 |
| 75 | Ga0068866_10000219 | 3300005718 | Bacteria | 27162 |
| 76 | Ga0068851_10001867 | 3300005834 | Bacteria | 9251 |
| 77 | Ga0068870_10271648 | 3300005840 | Bacteria | 1059 |
| 78 | Ga0068863_100000042 | 3300005841 | Bacteria | 154459 |
| 79 | Ga0068858_100000086 | 3300005842 | Bacteria | 96201 |
| 80 | Ga0068858_100000155 | 3300005842 | Bacteria | 72794 |
| 81 | Ga0068858_100064971 | 3300005842 | Bacteria | 3377 |
| 82 | Ga0068860_100010275 | 3300005843 | Bacteria | 9264 |
| 83 | Ga0081455_10207032 | 3300005937 | Bacteria | 1464 |
| 84 | Ga0081455_10394222 | 3300005937 | Bacteria | 963 |
| 85 | Ga0081538_10000032 | 3300005981 | Bacteria | 122398 |
| 86 | Ga0081540_1000546 | 3300005983 | Bacteria | 36470 |
| 87 | Ga0081540_1034794 | 3300005983 | Bacteria | 2710 |
| 88 | Ga0081539_10001100 | 3300005985 | Bacteria | 49090 |
| 89 | Ga0081539_10003159 | 3300005985 | Bacteria | 20901 |
| 90 | Ga0070715_10000015 | 3300006163 | Bacteria | 152816 |
| 91 | Ga0070712_100001300 | 3300006175 | Bacteria | 15100 |
| 92 | Ga0070712_100224422 | 3300006175 | Bacteria | 1489 |
| 93 | Ga0075433_10000663 | 3300006852 | Bacteria | 23254 |
| 94 | Ga0068865_100000020 | 3300006881 | Bacteria | 104487 |
| 95 | Ga0111539_10956239 | 3300009094 | Unclassified | 996 |
| 96 | Ga0105245_10000159 | 3300009098 | Bacteria | 63630 |
| 97 | Ga0105245_10001015 | 3300009098 | Bacteria | 25483 |
| 98 | Ga0105245_10002749 | 3300009098 | Bacteria | 15821 |
| 99 | Ga0105247_10000993 | 3300009101 | Bacteria | 21414 |
| 100 | Ga0105247_10249726 | 3300009101 | Bacteria | 1212 |
| 101 | Ga0114129_10592930 | 3300009147 | Bacteria | 1437 |
| 102 | Ga0114129_10743544 | 3300009147 | Bacteria | 1256 |
| 103 | Ga0105243_10004998 | 3300009148 | Bacteria | 10392 |
| 104 | Ga0105243_10221148 | 3300009148 | Bacteria | 1674 |
| 105 | Ga0105242_10002766 | 3300009176 | Bacteria | 13729 |
| 106 | Ga0105242_10008605 | 3300009176 | Bacteria | 7837 |
| 107 | Ga0105242_10238304 | 3300009176 | Bacteria | 1634 |
| 108 | Ga0105248_10000022 | 3300009177 | Bacteria | 275935 |
| 109 | Ga0105248_10529203 | 3300009177 | Bacteria | 1329 |
| 110 | Ga0105249_10189958 | 3300009553 | Unclassified | 2004 |
| 111 | Ga0105033_104983 | 3300009986 | Bacteria | 1137 |
| 112 | Ga0105239_10050654 | 3300010375 | Bacteria | 4554 |
| 113 | Ga0105239_10645854 | 3300010375 | Bacteria | 1208 |
| 114 | Ga0105239_10659490 | 3300010375 | Bacteria | 1195 |
| 115 | Ga0157373_10496552 | 3300013100 | Bacteria | 881 |
| 116 | Ga0157371_10004276 | 3300013102 | Bacteria | 12531 |
| 117 | Ga0157370_10006328 | 3300013104 | Bacteria | 13080 |
| 118 | Ga0157370_10187874 | 3300013104 | Bacteria | 1918 |
| 119 | Ga0157370_10563265 | 3300013104 | Bacteria | 1044 |
| 120 | Ga0157369_10000118 | 3300013105 | Bacteria | 111618 |
| 121 | Ga0157374_10002177 | 3300013296 | Bacteria | 16513 |
| 122 | Ga0157374_10297473 | 3300013296 | Bacteria | 1596 |
| 123 | Ga0157378_10092044 | 3300013297 | Bacteria | 2758 |
| 124 | Ga0157378_10386968 | 3300013297 | Bacteria | 1375 |
| 125 | Ga0157372_10000616 | 3300013307 | Bacteria | 38850 |
| 126 | Ga0157375_10000184 | 3300013308 | Bacteria | 58368 |
| 127 | Ga0157375_10302567 | 3300013308 | Unclassified | 1763 |
| 128 | Ga0163163_10207424 | 3300014325 | Bacteria | 2008 |
| 129 | Ga0163163_10801426 | 3300014325 | Unclassified | 1005 |
| 130 | Ga0163163_10975566 | 3300014325 | Bacteria | 911 |
| 131 | Ga0157380_10000080 | 3300014326 | Bacteria | 53731 |
| 132 | Ga0157379_10125057 | 3300014968 | Bacteria | 2314 |
| 133 | Ga0157376_10035064 | 3300014969 | Bacteria | 4056 |
| 134 | Ga0163161_10000173 | 3300017792 | Bacteria | 59103 |
| 135 | Ga0206356_11661110 | 3300020070 | Bacteria | 3396 |
| 136 | Ga0206353_11601057 | 3300020082 | Bacteria | 1801 |
| 137 | Ga0207656_10000354 | 3300025321 | Bacteria | 15472 |
| 138 | Ga0207656_10004306 | 3300025321 | Bacteria | 4960 |
| 139 | Ga0207682_10000228 | 3300025893 | Bacteria | 25297 |
| 140 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 141 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 142 | Ga0207642_10000094 | 3300025899 | Bacteria | 23395 |
| 143 | Ga0207710_10000151 | 3300025900 | Bacteria | 77424 |
| 144 | Ga0207710_10112969 | 3300025900 | Bacteria | 1291 |
| 145 | Ga0207680_10048971 | 3300025903 | Bacteria | 2513 |
| 146 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 147 | Ga0207705_10091476 | 3300025909 | Bacteria | 2228 |
| 148 | Ga0207707_10018135 | 3300025912 | Bacteria | 6134 |
| 149 | Ga0207693_10000859 | 3300025915 | Bacteria | 27121 |
| 150 | Ga0207649_10000024 | 3300025920 | Bacteria | 183104 |
| 151 | Ga0207652_10000150 | 3300025921 | Bacteria | 75189 |
| 152 | Ga0207659_10000043 | 3300025926 | Bacteria | 90795 |
| 153 | Ga0207687_10000011 | 3300025927 | Bacteria | 388349 |
| 154 | Ga0207687_10000021 | 3300025927 | Bacteria | 226396 |
| 155 | Ga0207687_10000350 | 3300025927 | Bacteria | 30682 |
| 156 | Ga0207687_10000716 | 3300025927 | Bacteria | 22524 |
| 157 | Ga0207664_10056834 | 3300025929 | Bacteria | 3109 |
| 158 | Ga0207690_10006983 | 3300025932 | Bacteria | 6695 |
| 159 | Ga0207690_10121085 | 3300025932 | Unclassified | 1901 |
| 160 | Ga0207706_10000016 | 3300025933 | Bacteria | 170697 |
| 161 | Ga0207686_10000549 | 3300025934 | Bacteria | 24232 |
| 162 | Ga0207686_10015756 | 3300025934 | Bacteria | 4235 |
| 163 | Ga0207686_10070529 | 3300025934 | Bacteria | 2246 |
| 164 | Ga0207670_10128044 | 3300025936 | Bacteria | 1855 |
| 165 | Ga0207670_10129878 | 3300025936 | Bacteria | 1844 |
| 166 | Ga0207669_10000007 | 3300025937 | Bacteria | 169904 |
| 167 | Ga0207669_10000027 | 3300025937 | Bacteria | 91216 |
| 168 | Ga0207669_10015801 | 3300025937 | Bacteria | 3817 |
| 169 | Ga0207704_10000004 | 3300025938 | Bacteria | 239295 |
| 170 | Ga0207691_10000374 | 3300025940 | Bacteria | 45009 |
| 171 | Ga0207711_10000019 | 3300025941 | Bacteria | 412779 |
| 172 | Ga0207711_10362123 | 3300025941 | Bacteria | 1344 |
| 173 | Ga0207661_10000142 | 3300025944 | Bacteria | 45456 |
| 174 | Ga0207661_10001987 | 3300025944 | Bacteria | 14072 |
| 175 | Ga0207661_10003394 | 3300025944 | Bacteria | 11055 |
| 176 | Ga0207661_10007802 | 3300025944 | Bacteria | 7623 |
| 177 | Ga0207661_10035924 | 3300025944 | Bacteria | 3865 |
| 178 | Ga0207661_10553874 | 3300025944 | Bacteria | 1053 |
| 179 | Ga0207661_10930911 | 3300025944 | Bacteria | 800 |
| 180 | Ga0207667_10380532 | 3300025949 | Bacteria | 1438 |
| 181 | Ga0207651_10029595 | 3300025960 | Bacteria | 3472 |
| 182 | Ga0207712_10000033 | 3300025961 | Bacteria | 209336 |
| 183 | Ga0207668_10099829 | 3300025972 | Bacteria | 2154 |
| 184 | Ga0207668_10299638 | 3300025972 | Bacteria | 1326 |
| 185 | Ga0207668_10498915 | 3300025972 | Bacteria | 1047 |
| 186 | Ga0207640_10000059 | 3300025981 | Bacteria | 90901 |
| 187 | Ga0207640_10001105 | 3300025981 | Bacteria | 14885 |
| 188 | Ga0207640_10549871 | 3300025981 | Unclassified | 970 |
| 189 | Ga0207658_10044890 | 3300025986 | Bacteria | 3219 |
| 190 | Ga0207658_10331673 | 3300025986 | Bacteria | 1320 |
| 191 | Ga0207677_10004273 | 3300026023 | Bacteria | 7643 |
| 192 | Ga0207677_10039439 | 3300026023 | Bacteria | 3105 |
| 193 | Ga0207703_10000072 | 3300026035 | Bacteria | 120727 |
| 194 | Ga0207703_10000266 | 3300026035 | Bacteria | 58337 |
| 195 | Ga0207639_10003854 | 3300026041 | Bacteria | 10101 |
| 196 | Ga0207678_10153719 | 3300026067 | Bacteria | 1965 |
| 197 | Ga0207678_10379396 | 3300026067 | Bacteria | 1222 |
| 198 | Ga0207708_10100994 | 3300026075 | Bacteria | 2233 |
| 199 | Ga0207702_10000027 | 3300026078 | Bacteria | 183792 |
| 200 | Ga0207702_10007605 | 3300026078 | Bacteria | 9224 |
| 201 | Ga0207702_10014910 | 3300026078 | Bacteria | 6446 |
| 202 | Ga0207702_10369951 | 3300026078 | Bacteria | 1376 |
| 203 | Ga0207641_10000231 | 3300026088 | Bacteria | 72245 |
| 204 | Ga0207648_10000230 | 3300026089 | Bacteria | 59713 |
| 205 | Ga0207676_10000043 | 3300026095 | Bacteria | 161948 |
| 206 | Ga0207683_10010360 | 3300026121 | Bacteria | 7953 |
| 207 | Ga0207683_10421762 | 3300026121 | Unclassified | 1229 |
| 208 | Ga0207698_10000002 | 3300026142 | Bacteria | 404991 |
| 209 | Ga0268266_10000076 | 3300028379 | Bacteria | 217644 |
| 210 | Ga0268266_10004334 | 3300028379 | Bacteria | 13637 |
| 211 | Ga0268266_10036593 | 3300028379 | Bacteria | 4179 |
| 212 | Ga0268266_10194892 | 3300028379 | Bacteria | 1851 |
| 213 | Ga0268264_10008628 | 3300028381 | Bacteria | 8468 |
| 214 | Ga0265319_1000029 | 3300028563 | Bacteria | 131291 |
| 215 | Ga0265334_10032003 | 3300028573 | Bacteria | 2100 |
| 216 | Ga0265336_10055192 | 3300028666 | Bacteria | 1195 |
| 217 | Ga0265338_10000179 | 3300028800 | Bacteria | 117995 |
| 218 | Ga0265324_10041275 | 3300029957 | Bacteria | 1597 |
| 219 | Ga0265325_10011215 | 3300031241 | Bacteria | 5154 |
| 220 | Ga0265331_10023328 | 3300031250 | Bacteria | 3144 |
| 221 | Ga0307405_10233717 | 3300031731 | Bacteria | 1357 |
| 222 | Ga0307413_10444244 | 3300031824 | Bacteria | 1028 |
| 223 | Ga0307409_100034181 | 3300031995 | Bacteria | 3709 |
| 224 | Ga0373934_0132598 | 3300035086 | Bacteria | 1017 |
| 225 | Ga0373923_0277658 | 3300035111 | Unclassified | 789 |
| 226 | Ga0316574_0252193 | 3300035398 | Bacteria | 1127 |
| 227 | Ga0373947_0433599 | 3300035725 | Bacteria | 889 |
| 228 | Ga0373937_0041924 | 3300036401 | Bacteria | 4177 |
| 229 | Ga0373937_0215040 | 3300036401 | Bacteria | 1809 |
| 230 | Ga0373937_0312578 | 3300036401 | Bacteria | 1486 |
| 231 | Ga0395900_0570731 | 3300037418 | Bacteria | 1074 |
| 232 | Ga0395905_0170928 | 3300037471 | Bacteria | 2042 |
| 233 | Ga0451833_1024539 | 3300041491 | Bacteria | 1278 |
| 234 | Ga0451853_0674116 | 3300041512 | Bacteria | 5453 |
| 235 | Ga0466963_0000124 | 3300044694 | Bacteria | 28905 |
| 236 | Ga0466957_0151930 | 3300044842 | Bacteria | 1498 |
| 237 | Ga0466958_0028489 | 3300045836 | Bacteria | 3312 |
| 238 | Ga0466958_0061588 | 3300045836 | Bacteria | 2286 |
| 239 | Ga0466967_0038536 | 3300045976 | Bacteria | 4100 |
| 240 | Ga0495592_0000521 | 3300046454 | Bacteria | 27805 |
| 241 | Ga0495592_0064755 | 3300046454 | Bacteria | 2678 |
| 242 | Ga0495603_0000622 | 3300046455 | Bacteria | 19869 |
| 243 | Ga0495603_0004750 | 3300046455 | Bacteria | 8110 |
| 244 | Ga0495629_0001361 | 3300046459 | Bacteria | 19270 |
| 245 | Ga0495629_0150945 | 3300046459 | Bacteria | 1615 |
| 246 | Ga0495641_0000001 | 3300046461 | Bacteria | 485224 |
| 247 | Ga0495641_0022741 | 3300046461 | Bacteria | 3131 |
| 248 | Ga0495651_0296853 | 3300046462 | Bacteria | 1085 |
| 249 | Ga0495651_0551403 | 3300046462 | Unclassified | 732 |
| 250 | Ga0495653_0098333 | 3300046463 | Unclassified | 2125 |
| 251 | Ga0495653_0162105 | 3300046463 | Bacteria | 1551 |
| 252 | Ga0495653_0206221 | 3300046463 | Bacteria | 1331 |
| 253 | Ga0495582_0000022 | 3300046473 | Bacteria | 83315 |
| 254 | Ga0495639_0030389 | 3300046475 | Bacteria | 2401 |
| 255 | Ga0495662_0000137 | 3300046476 | Bacteria | 28083 |
| 256 | Ga0495662_0009206 | 3300046476 | Bacteria | 4845 |
| 257 | Ga0495594_0000276 | 3300046499 | Bacteria | 25314 |
| 258 | Ga0495596_0085691 | 3300046500 | Unclassified | 1223 |
| 259 | Ga0495606_0000045 | 3300046507 | Bacteria | 212105 |
| 260 | Ga0495608_0000001 | 3300046511 | Bacteria | 411278 |
| 261 | Ga0495608_0000163 | 3300046511 | Bacteria | 47170 |
| 262 | Ga0495608_0287385 | 3300046511 | Bacteria | 1020 |
| 263 | Ga0495618_0001468 | 3300046514 | Bacteria | 15801 |
| 264 | Ga0495620_0001840 | 3300046515 | Bacteria | 12507 |
| 265 | Ga0495628_0000858 | 3300046516 | Bacteria | 28086 |
| 266 | Ga0495628_0026019 | 3300046516 | Bacteria | 4777 |
| 267 | Ga0495628_0046466 | 3300046516 | Bacteria | 3448 |
| 268 | Ga0495628_0061540 | 3300046516 | Bacteria | 2944 |
| 269 | Ga0495628_0150797 | 3300046516 | Bacteria | 1771 |
| 270 | Ga0495628_0201839 | 3300046516 | Bacteria | 1498 |
| 271 | Ga0495630_0000037 | 3300046517 | Bacteria | 114404 |
| 272 | Ga0495630_0020101 | 3300046517 | Bacteria | 4918 |
| 273 | Ga0495630_0070337 | 3300046517 | Bacteria | 2633 |
| 274 | Ga0495644_0000454 | 3300046523 | Bacteria | 17881 |
| 275 | Ga0495652_0000086 | 3300046529 | Bacteria | 99373 |
| 276 | Ga0495652_0060323 | 3300046529 | Bacteria | 3206 |
| 277 | Ga0495640_0021952 | 3300046533 | Bacteria | 4675 |
| 278 | Ga0495640_0112327 | 3300046533 | Bacteria | 1779 |
| 279 | Ga0495586_0007201 | 3300046535 | Bacteria | 5933 |
| 280 | Ga0495587_0001022 | 3300046536 | Bacteria | 18410 |
| 281 | Ga0495587_0029073 | 3300046536 | Bacteria | 3357 |
| 282 | Ga0495587_0054135 | 3300046536 | Bacteria | 2365 |
| 283 | Ga0495587_0434493 | 3300046536 | Bacteria | 728 |
| 284 | Ga0495621_0011410 | 3300046539 | Bacteria | 2747 |
| 285 | Ga0495645_0024357 | 3300046543 | Bacteria | 4391 |
| 286 | Ga0495622_0000690 | 3300046557 | Bacteria | 19165 |
| 287 | Ga0495633_0006532 | 3300046558 | Bacteria | 6890 |
| 288 | Ga0495656_0003561 | 3300046615 | Bacteria | 5272 |
| 289 | Ga0495634_0000013 | 3300046642 | Bacteria | 130546 |
| 290 | Ga0495634_0001471 | 3300046642 | Bacteria | 20875 |
| 291 | Ga0495634_0090023 | 3300046642 | Bacteria | 1994 |
| 292 | Ga0495634_0141968 | 3300046642 | Bacteria | 1524 |
| 293 | Ga0495634_0182919 | 3300046642 | Bacteria | 1311 |
| 294 | Ga0495625_0001659 | 3300046660 | Bacteria | 26100 |
| 295 | Ga0495635_0000063 | 3300046663 | Bacteria | 65304 |
| 296 | Ga0495635_0067371 | 3300046663 | Bacteria | 2456 |
| 297 | Ga0495635_0242685 | 3300046663 | Unclassified | 1215 |
| 298 | Ga0495635_0343917 | 3300046663 | Bacteria | 996 |
| 299 | Ga0495588_0000179 | 3300046674 | Bacteria | 77030 |
| 300 | Ga0495657_0000002 | 3300046675 | Bacteria | 411958 |
| 301 | Ga0495657_0134059 | 3300046675 | Bacteria | 1549 |
| 302 | Ga0495599_0006457 | 3300046678 | Bacteria | 7074 |
| 303 | Ga0495599_0119765 | 3300046678 | Bacteria | 1637 |
| 304 | Ga0495599_0127676 | 3300046678 | Bacteria | 1580 |
| 305 | Ga0495599_0133382 | 3300046678 | Bacteria | 1542 |
| 306 | Ga0495647_0000003 | 3300046681 | Bacteria | 145235 |
| 307 | Ga0495647_0003248 | 3300046681 | Bacteria | 5203 |
| 308 | Ga0495647_0008323 | 3300046681 | Bacteria | 3485 |
| 309 | Ga0495658_0000008 | 3300046683 | Bacteria | 115426 |
| 310 | Ga0495658_0098296 | 3300046683 | Bacteria | 1743 |
| 311 | Ga0495669_0000651 | 3300046684 | Bacteria | 15129 |
| 312 | Ga0495669_0015561 | 3300046684 | Bacteria | 3258 |
| 313 | Ga0495669_0121731 | 3300046684 | Bacteria | 1223 |
| 314 | Ga0495613_0000122 | 3300046689 | Bacteria | 77044 |
| 315 | Ga0495613_0000369 | 3300046689 | Bacteria | 39198 |
| 316 | Ga0495613_0204189 | 3300046689 | Bacteria | 1392 |
| 317 | Ga0495624_0000164 | 3300046690 | Bacteria | 48886 |
| 318 | Ga0495624_0002296 | 3300046690 | Bacteria | 14562 |
| 319 | Ga0495624_0003753 | 3300046690 | Bacteria | 11225 |
| 320 | Ga0495670_0007059 | 3300046691 | Bacteria | 5530 |
| 321 | Ga0495670_0150665 | 3300046691 | Bacteria | 1220 |
| 322 | Ga0495649_0030299 | 3300046694 | Bacteria | 2989 |
| 323 | Ga0495600_0035731 | 3300046809 | Bacteria | 3229 |
| 324 | Ga0495600_0097188 | 3300046809 | Unclassified | 1920 |
| 325 | Ga0495604_0000033 | 3300047317 | Bacteria | 134810 |
| 326 | Ga0495604_0000850 | 3300047317 | Bacteria | 25489 |
| 327 | Ga0495604_0050587 | 3300047317 | Bacteria | 3226 |
| 328 | Ga0495604_0235900 | 3300047317 | Unclassified | 1253 |
| 329 | Ga0495674_0000007 | 3300047319 | Bacteria | 336257 |
| 330 | Ga0495674_0355247 | 3300047319 | Bacteria | 1189 |
| 331 | Ga0495676_0000652 | 3300047321 | Bacteria | 28858 |
| 332 | Ga0495676_0001759 | 3300047321 | Bacteria | 18921 |
| 333 | Ga0495676_0403765 | 3300047321 | Bacteria | 906 |
| 334 | Ga0495680_0000215 | 3300047322 | Bacteria | 63049 |
| 335 | Ga0495680_0000587 | 3300047322 | Bacteria | 40868 |
| 336 | Ga0495680_0036038 | 3300047322 | Bacteria | 3977 |
| 337 | Ga0495675_0000046 | 3300047444 | Bacteria | 82596 |
| 338 | Ga0495675_0015728 | 3300047444 | Bacteria | 4784 |
| 339 | Ga0495685_017740 | 3300047447 | Bacteria | 2439 |
| 340 | Ga0495684_0110662 | 3300047471 | Bacteria | 2073 |
| 341 | Ga0495684_0529728 | 3300047471 | Unclassified | 805 |
| 342 | Ga0495686_0129780 | 3300047472 | Unclassified | 1495 |
| 343 | Ga0495593_0010922 | 3300047673 | Bacteria | 5230 |
| 344 | Ga0495602_0000010 | 3300048088 | Bacteria | 212121 |
| 345 | Ga0495602_0000188 | 3300048088 | Bacteria | 58305 |
| 346 | Ga0495602_0163145 | 3300048088 | Bacteria | 1738 |
| 347 | Ga0495602_0166521 | 3300048088 | Bacteria | 1715 |
| 348 | Ga0496100_0000003 | 3300048903 | Bacteria | 360802 |
| 349 | Ga0496100_0000063 | 3300048903 | Bacteria | 60957 |
| 350 | Ga0496101_0000003 | 3300048904 | Bacteria | 406565 |
| 351 | Ga0496101_0000012 | 3300048904 | Bacteria | 268127 |
| 352 | Ga0496102_0105895 | 3300048905 | Bacteria | 2617 |
| 353 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 354 | Ga0496104_0000066 | 3300048907 | Bacteria | 108721 |
| 355 | Ga0496104_0000666 | 3300048907 | Bacteria | 29447 |
| 356 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 357 | Ga0496105_0000020 | 3300048908 | Bacteria | 181484 |
| 358 | Ga0496105_0004549 | 3300048908 | Bacteria | 10446 |
| 359 | Ga0496105_0022756 | 3300048908 | Bacteria | 5078 |
| 360 | Ga0496106_0000015 | 3300048909 | Bacteria | 187570 |
| 361 | Ga0496106_0000020 | 3300048909 | Bacteria | 169168 |
| 362 | Ga0496107_0000008 | 3300048910 | Bacteria | 251874 |
| 363 | Ga0496107_0000014 | 3300048910 | Bacteria | 176738 |
| 364 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 365 | Ga0496108_0001295 | 3300048911 | Bacteria | 19647 |
| 366 | Ga0496108_0001400 | 3300048911 | Bacteria | 18998 |
| 367 | Ga0496108_0009647 | 3300048911 | Bacteria | 7824 |
| 368 | Ga0496108_0010707 | 3300048911 | Bacteria | 7442 |
| 369 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 370 | Ga0496109_0000035 | 3300048912 | Bacteria | 159744 |
| 371 | Ga0496109_0000246 | 3300048912 | Bacteria | 52127 |
| 372 | Ga0496109_0000888 | 3300048912 | Bacteria | 25009 |
| 373 | Ga0496109_0533390 | 3300048912 | Bacteria | 1107 |
| 374 | Ga0496110_0002971 | 3300048913 | Bacteria | 12859 |
| 375 | Ga0496110_0018894 | 3300048913 | Bacteria | 5791 |
| 376 | Ga0496110_0025732 | 3300048913 | Bacteria | 5031 |
| 377 | Ga0496110_0143574 | 3300048913 | Bacteria | 2158 |
| 378 | Ga0496111_0000022 | 3300048914 | Bacteria | 66777 |
| 379 | Ga0496111_0009354 | 3300048914 | Bacteria | 6535 |
| 380 | Ga0496111_0031644 | 3300048914 | Bacteria | 3770 |
| 381 | Ga0496111_0139036 | 3300048914 | Bacteria | 1799 |
| 382 | Ga0496111_0532169 | 3300048914 | Bacteria | 864 |
| 383 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 384 | Ga0496112_0006530 | 3300048915 | Bacteria | 10256 |
| 385 | Ga0496112_0103593 | 3300048915 | Bacteria | 2816 |
| 386 | Ga0496113_0000093 | 3300048916 | Bacteria | 38914 |
| 387 | Ga0496113_0017949 | 3300048916 | Bacteria | 4920 |
| 388 | Ga0496113_0058250 | 3300048916 | Bacteria | 2906 |
| 389 | Ga0496113_0067331 | 3300048916 | Unclassified | 2715 |
| 390 | Ga0496113_0083986 | 3300048916 | Bacteria | 2444 |
| 391 | Ga0496113_0146468 | 3300048916 | Bacteria | 1861 |
| 392 | Ga0496113_0157168 | 3300048916 | Bacteria | 1796 |
| 393 | Ga0496113_0822161 | 3300048916 | Bacteria | 737 |
| 394 | Ga0496114_0030582 | 3300048917 | Bacteria | 4431 |
| 395 | Ga0496115_0000004 | 3300048918 | Bacteria | 319734 |
| 396 | Ga0496119_0019537 | 3300048922 | Bacteria | 4985 |
| 397 | Ga0496119_0320679 | 3300048922 | Bacteria | 759 |
| 398 | Ga0496120_0049030 | 3300048923 | Bacteria | 2426 |
| 399 | Ga0496124_0315264 | 3300048927 | Bacteria | 1123 |
| 400 | Ga0496125_0047605 | 3300048928 | Bacteria | 3583 |
| 401 | Ga0501032_0376465 | 3300049569 | Bacteria | 913 |
| 402 | Ga0501036_0054873 | 3300049572 | Bacteria | 3376 |
| 403 | Ga0501039_0306210 | 3300049575 | Bacteria | 1249 |
| 404 | Ga0501040_0086471 | 3300049576 | Bacteria | 2177 |
| 405 | Ga0501040_0353517 | 3300049576 | Bacteria | 1053 |
| 406 | Ga0501041_0100089 | 3300049577 | Bacteria | 1794 |
| 407 | Ga0501042_0012267 | 3300049578 | Bacteria | 5800 |
| 408 | Ga0501042_0019107 | 3300049578 | Bacteria | 4755 |
| 409 | Ga0501046_0147556 | 3300049580 | Bacteria | 1776 |
| 410 | Ga0501048_0046586 | 3300049582 | Bacteria | 3095 |
| 411 | Ga0501048_0547258 | 3300049582 | Bacteria | 830 |
| 412 | Ga0501067_0099414 | 3300049583 | Bacteria | 1616 |
| 413 | Ga0501069_0452417 | 3300049585 | Bacteria | 763 |
| 414 | Ga0501070_0420345 | 3300049586 | Bacteria | 1080 |
| 415 | Ga0501071_0223791 | 3300049587 | Bacteria | 1417 |
| 416 | Ga0501072_0017787 | 3300049588 | Bacteria | 5466 |
| 417 | Ga0501072_0147757 | 3300049588 | Bacteria | 1874 |
| 418 | Ga0501075_0007890 | 3300049591 | Bacteria | 7391 |
| 419 | Ga0501075_0776284 | 3300049591 | Bacteria | 729 |
| 420 | Ga0501076_0002784 | 3300049592 | Bacteria | 12111 |
| 421 | Ga0501076_0690294 | 3300049592 | Bacteria | 843 |
| 422 | Ga0501079_0013453 | 3300049741 | Bacteria | 6240 |
| 423 | Ga0501079_0390869 | 3300049741 | Bacteria | 1091 |
| 424 | Ga0501081_0004692 | 3300049743 | Bacteria | 8788 |
| 425 | Ga0501081_0353171 | 3300049743 | Bacteria | 1084 |
| 426 | Ga0501083_0329397 | 3300049744 | Bacteria | 993 |
| 427 | Ga0501045_0496404 | 3300049824 | Bacteria | 906 |
| 428 | nmdc:mga0qj67_67177_c1 | 3300050509 | Bacteria | 2856 |
| 429 | nmdc:mga0rr50_462661_c1 | 3300050513 | Bacteria | 1076 |
| 430 | nmdc:mga0a205_155_c1 | 3300050515 | Bacteria | 44726 |
| 431 | Ga0495601_0000012 | 3300053077 | Bacteria | 227853 |
| 432 | Ga0495601_0000169 | 3300053077 | Bacteria | 35095 |
| 433 | Ga0495601_0012989 | 3300053077 | Bacteria | 5002 |
| 434 | Ga0495601_0023415 | 3300053077 | Bacteria | 3794 |
| 435 | Ga0495601_0103639 | 3300053077 | Bacteria | 1839 |
| 436 | Ga0495601_0245779 | 3300053077 | Unclassified | 1168 |
| 437 | Ga0495601_0266134 | 3300053077 | Bacteria | 1118 |
| 438 | Ga0495601_0569593 | 3300053077 | Bacteria | 728 |
| 439 | Ga0495612_0001003 | 3300053078 | Bacteria | 11610 |
| 440 | Ga0495612_0017880 | 3300053078 | Bacteria | 2837 |
| 441 | Ga0495612_0060720 | 3300053078 | Bacteria | 1565 |
| 442 | Ga0495612_0076366 | 3300053078 | Bacteria | 1403 |
| 443 | Ga0495655_0000471 | 3300053083 | Bacteria | 6767 |
| 444 | Ga0495655_0004966 | 3300053083 | Bacteria | 2317 |
| 445 | Ga0495595_0000001 | 3300053084 | Bacteria | 495226 |
| 446 | Ga0495595_0000372 | 3300053084 | Bacteria | 17048 |
| 447 | Ga0495595_0001241 | 3300053084 | Bacteria | 9932 |
| 448 | Ga0495619_0000015 | 3300053085 | Bacteria | 252787 |
| 449 | Ga0495619_0000018 | 3300053085 | Bacteria | 209943 |
| 450 | Ga0495619_0000120 | 3300053085 | Bacteria | 58265 |
| 451 | Ga0495619_0000758 | 3300053085 | Bacteria | 21054 |
| 452 | Ga0495619_0007151 | 3300053085 | Bacteria | 7068 |
| 453 | Ga0495619_0040276 | 3300053085 | Bacteria | 3054 |
| 454 | Ga0495619_0070764 | 3300053085 | Bacteria | 2333 |
| 455 | Ga0495619_0368707 | 3300053085 | Unclassified | 993 |
| 456 | Ga0500641_0017264 | 3300053096 | Bacteria | 2697 |
| 457 | Ga0500614_000374 | 3300053123 | Bacteria | 11670 |
| 458 | Ga0501084_0215158 | 3300054114 | Bacteria | 1621 |
| 459 | Ga0501082_0195069 | 3300060353 | Bacteria | 1761 |
| 460 | Ga0530510_0000462 | 3300061734 | Bacteria | 26213 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031731 | Ga0307405_10233717 | Ga0307405_102337173 | 181 |
| 2 | 3300031824 | Ga0307413_10444244 | Ga0307413_104442441 | 181 |
| 3 | 3300031995 | Ga0307409_100034181 | Ga0307409_1000341814 | 181 |
| 4 | 3300005365 | Ga0070688_100000453 | Ga0070688_10000045319 | 183 |
| 5 | 3300005466 | Ga0070685_10000754 | Ga0070685_1000075417 | 183 |
| 6 | 3300049583 | Ga0501067_0099414 | Ga0501067_0099414_31_648 | 184 |
| 7 | 3300005329 | Ga0070683_100002929 | Ga0070683_10000292914 | 185 |
| 8 | 3300005329 | Ga0070683_100003221 | Ga0070683_10000322110 | 185 |
| 9 | 3300005345 | Ga0070692_10252050 | Ga0070692_102520502 | 185 |
| 10 | 3300005354 | Ga0070675_100000153 | Ga0070675_10000015322 | 185 |
| 11 | 3300005535 | Ga0070684_100033478 | Ga0070684_1000334785 | 185 |
| 12 | 3300005543 | Ga0070672_100000057 | Ga0070672_1000000579 | 185 |
| 13 | 3300006175 | Ga0070712_100001300 | Ga0070712_1000013005 | 185 |
| 14 | 3300009147 | Ga0114129_10743544 | Ga0114129_107435442 | 185 |
| 15 | 3300013102 | Ga0157371_10004276 | Ga0157371_1000427610 | 185 |
| 16 | 3300025915 | Ga0207693_10000859 | Ga0207693_100008596 | 185 |
| 17 | 3300025926 | Ga0207659_10000043 | Ga0207659_1000004325 | 185 |
| 18 | 3300025940 | Ga0207691_10000374 | Ga0207691_1000037441 | 185 |
| 19 | 3300025944 | Ga0207661_10000142 | Ga0207661_1000014239 | 185 |
| 20 | 3300025944 | Ga0207661_10001987 | Ga0207661_100019876 | 185 |
| 21 | 3300048911 | Ga0496108_0001295 | Ga0496108_0001295_11763_12374 | 185 |
| 22 | 3300048911 | Ga0496108_0009647 | Ga0496108_0009647_914_1525 | 185 |
| 23 | 3300048912 | Ga0496109_0000035 | Ga0496109_0000035_124813_125424 | 185 |
| 24 | 3300048912 | Ga0496109_0000888 | Ga0496109_0000888_11775_12386 | 185 |
| 25 | 3300049744 | Ga0501083_0329397 | Ga0501083_0329397_135_746 | 185 |
| 26 | 3300003373 | JGI25407J50210_10030533 | JGI25407J50210_100305331 | 186 |
| 27 | 3300005981 | Ga0081538_10000032 | Ga0081538_1000003263 | 186 |
| 28 | 3300013296 | Ga0157374_10297473 | Ga0157374_102974732 | 186 |
| 29 | 3300049576 | Ga0501040_0353517 | Ga0501040_0353517_269_871 | 186 |
| 30 | 3300005340 | Ga0070689_100122698 | Ga0070689_1001226982 | 187 |
| 31 | 3300005365 | Ga0070688_100438513 | Ga0070688_1004385132 | 187 |
| 32 | 3300005614 | Ga0068856_100020527 | Ga0068856_1000205276 | 187 |
| 33 | 3300009177 | Ga0105248_10000022 | Ga0105248_10000022251 | 187 |
| 34 | 3300010375 | Ga0105239_10645854 | Ga0105239_106458542 | 187 |
| 35 | 3300013100 | Ga0157373_10496552 | Ga0157373_104965521 | 187 |
| 36 | 3300013105 | Ga0157369_10000118 | Ga0157369_1000011842 | 187 |
| 37 | 3300014969 | Ga0157376_10035064 | Ga0157376_100350644 | 187 |
| 38 | 3300025936 | Ga0207670_10128044 | Ga0207670_101280442 | 187 |
| 39 | 3300025941 | Ga0207711_10000019 | Ga0207711_1000001988 | 187 |
| 40 | 3300026078 | Ga0207702_10014910 | Ga0207702_100149103 | 187 |
| 41 | 3300046461 | Ga0495641_0022741 | Ga0495641_0022741_673_1287 | 187 |
| 42 | 3300046499 | Ga0495594_0000276 | Ga0495594_0000276_5645_6256 | 187 |
| 43 | 3300046557 | Ga0495622_0000690 | Ga0495622_0000690_18432_19043 | 187 |
| 44 | 3300047321 | Ga0495676_0000652 | Ga0495676_0000652_3057_3671 | 187 |
| 45 | 3300005329 | Ga0070683_100271872 | Ga0070683_1002718722 | 188 |
| 46 | 3300005337 | Ga0070682_100000815 | Ga0070682_1000008159 | 188 |
| 47 | 3300005366 | Ga0070659_100009701 | Ga0070659_1000097015 | 188 |
| 48 | 3300005455 | Ga0070663_100138260 | Ga0070663_1001382602 | 188 |
| 49 | 3300005535 | Ga0070684_100824467 | Ga0070684_1008244672 | 188 |
| 50 | 3300005563 | Ga0068855_100149600 | Ga0068855_1001496004 | 188 |
| 51 | 3300005983 | Ga0081540_1000546 | Ga0081540_100054620 | 188 |
| 52 | 3300006881 | Ga0068865_100000020 | Ga0068865_10000002019 | 188 |
| 53 | 3300009098 | Ga0105245_10002749 | Ga0105245_1000274918 | 188 |
| 54 | 3300009986 | Ga0105033_104983 | Ga0105033_1049832 | 188 |
| 55 | 3300013297 | Ga0157378_10092044 | Ga0157378_100920443 | 188 |
| 56 | 3300013308 | Ga0157375_10302567 | Ga0157375_103025673 | 188 |
| 57 | 3300025927 | Ga0207687_10000350 | Ga0207687_1000035018 | 188 |
| 58 | 3300025932 | Ga0207690_10006983 | Ga0207690_100069832 | 188 |
| 59 | 3300025938 | Ga0207704_10000004 | Ga0207704_10000004173 | 188 |
| 60 | 3300025944 | Ga0207661_10035924 | Ga0207661_100359243 | 188 |
| 61 | 3300025972 | Ga0207668_10299638 | Ga0207668_102996382 | 188 |
| 62 | 3300026067 | Ga0207678_10379396 | Ga0207678_103793962 | 188 |
| 63 | 3300044842 | Ga0466957_0151930 | Ga0466957_0151930_214_825 | 188 |
| 64 | 3300045976 | Ga0466967_0038536 | Ga0466967_0038536_2514_3161 | 188 |
| 65 | 3300046462 | Ga0495651_0296853 | Ga0495651_0296853_59_631 | 188 |
| 66 | 3300046507 | Ga0495606_0000045 | Ga0495606_0000045_22940_23551 | 188 |
| 67 | 3300046511 | Ga0495608_0000001 | Ga0495608_0000001_237496_238107 | 188 |
| 68 | 3300046516 | Ga0495628_0046466 | Ga0495628_0046466_1095_1673 | 188 |
| 69 | 3300046516 | Ga0495628_0150797 | Ga0495628_0150797_285_896 | 188 |
| 70 | 3300046536 | Ga0495587_0434493 | Ga0495587_0434493_91_702 | 188 |
| 71 | 3300046674 | Ga0495588_0000179 | Ga0495588_0000179_2763_3395 | 188 |
| 72 | 3300046675 | Ga0495657_0000002 | Ga0495657_0000002_238176_238787 | 188 |
| 73 | 3300046684 | Ga0495669_0121731 | Ga0495669_0121731_18_587 | 188 |
| 74 | 3300046689 | Ga0495613_0000122 | Ga0495613_0000122_12984_13595 | 188 |
| 75 | 3300047317 | Ga0495604_0000850 | Ga0495604_0000850_19504_20115 | 188 |
| 76 | 3300047444 | Ga0495675_0000046 | Ga0495675_0000046_4541_5152 | 188 |
| 77 | 3300048088 | Ga0495602_0000010 | Ga0495602_0000010_187838_188452 | 188 |
| 78 | 3300048088 | Ga0495602_0163145 | Ga0495602_0163145_712_1323 | 188 |
| 79 | 3300048088 | Ga0495602_0166521 | Ga0495602_0166521_1045_1614 | 188 |
| 80 | 3300048911 | Ga0496108_0001400 | Ga0496108_0001400_6478_7107 | 188 |
| 81 | 3300048912 | Ga0496109_0000246 | Ga0496109_0000246_39648_40277 | 188 |
| 82 | 3300048913 | Ga0496110_0002971 | Ga0496110_0002971_4520_5131 | 188 |
| 83 | 3300048913 | Ga0496110_0143574 | Ga0496110_0143574_169_780 | 188 |
| 84 | 3300048914 | Ga0496111_0000022 | Ga0496111_0000022_9935_10546 | 188 |
| 85 | 3300048915 | Ga0496112_0006530 | Ga0496112_0006530_4565_5176 | 188 |
| 86 | 3300048916 | Ga0496113_0000093 | Ga0496113_0000093_20938_21549 | 188 |
| 87 | 3300048927 | Ga0496124_0315264 | Ga0496124_0315264_444_1055 | 188 |
| 88 | 3300053077 | Ga0495601_0000012 | Ga0495601_0000012_186118_186729 | 188 |
| 89 | 3300053083 | Ga0495655_0000471 | Ga0495655_0000471_4707_5321 | 188 |
| 90 | 3300053084 | Ga0495595_0000001 | Ga0495595_0000001_173172_173783 | 188 |
| 91 | 3300053084 | Ga0495595_0001241 | Ga0495595_0001241_4989_5603 | 188 |
| 92 | 3300053085 | Ga0495619_0000120 | Ga0495619_0000120_53126_53737 | 188 |
| 93 | 3300053085 | Ga0495619_0000758 | Ga0495619_0000758_20316_20930 | 188 |
| 94 | 3300005578 | Ga0068854_100338387 | Ga0068854_1003383872 | 189 |
| 95 | 3300005615 | Ga0070702_100002851 | Ga0070702_1000028514 | 189 |
| 96 | 3300005983 | Ga0081540_1034794 | Ga0081540_10347942 | 189 |
| 97 | 3300020082 | Ga0206353_11601057 | Ga0206353_116010574 | 189 |
| 98 | 3300025981 | Ga0207640_10549871 | Ga0207640_105498711 | 189 |
| 99 | 3300046516 | Ga0495628_0000858 | Ga0495628_0000858_3286_3903 | 189 |
| 100 | 3300046681 | Ga0495647_0000003 | Ga0495647_0000003_110566_111138 | 189 |
| 101 | 3300046690 | Ga0495624_0000164 | Ga0495624_0000164_14542_15114 | 189 |
| 102 | 3300047321 | Ga0495676_0403765 | Ga0495676_0403765_174_797 | 189 |
| 103 | 3300048088 | Ga0495602_0000188 | Ga0495602_0000188_56184_56801 | 189 |
| 104 | 3300048903 | Ga0496100_0000063 | Ga0496100_0000063_12125_12739 | 189 |
| 105 | 3300048904 | Ga0496101_0000012 | Ga0496101_0000012_264440_265054 | 189 |
| 106 | 3300048909 | Ga0496106_0000020 | Ga0496106_0000020_163941_164555 | 189 |
| 107 | 3300048910 | Ga0496107_0000014 | Ga0496107_0000014_163930_164544 | 189 |
| 108 | 3300048916 | Ga0496113_0067331 | Ga0496113_0067331_539_1129 | 189 |
| 109 | 3300050513 | nmdc:mga0rr50_462661_c1 | nmdc:mga0rr50_462661_c1_190_801 | 189 |
| 110 | 3300053085 | Ga0495619_0000018 | Ga0495619_0000018_149884_150495 | 189 |
| 111 | 3300045836 | Ga0466958_0061588 | Ga0466958_0061588_952_1563 | 190 |
| 112 | 3300046678 | Ga0495599_0133382 | Ga0495599_0133382_595_1206 | 190 |
| 113 | 3300010375 | Ga0105239_10050654 | Ga0105239_100506547 | 191 |
| 114 | 3300046615 | Ga0495656_0003561 | Ga0495656_0003561_3943_4524 | 191 |
| 115 | 3300009101 | Ga0105247_10249726 | Ga0105247_102497262 | 192 |
| 116 | 3300025900 | Ga0207710_10112969 | Ga0207710_101129692 | 192 |
| 117 | 3300028563 | Ga0265319_1000029 | Ga0265319_100002934 | 192 |
| 118 | 3300028666 | Ga0265336_10055192 | Ga0265336_100551922 | 192 |
| 119 | 3300028800 | Ga0265338_10000179 | Ga0265338_1000017942 | 192 |
| 120 | 3300029957 | Ga0265324_10041275 | Ga0265324_100412753 | 192 |
| 121 | 3300031241 | Ga0265325_10011215 | Ga0265325_100112155 | 192 |
| 122 | 3300031250 | Ga0265331_10023328 | Ga0265331_100233285 | 192 |
| 123 | 3300046536 | Ga0495587_0054135 | Ga0495587_0054135_1136_1753 | 192 |
| 124 | 3300046675 | Ga0495657_0134059 | Ga0495657_0134059_740_1372 | 193 |
| 125 | 3300049585 | Ga0501069_0452417 | Ga0501069_0452417_40_624 | 193 |
| 126 | 3300053077 | Ga0495601_0012989 | Ga0495601_0012989_3381_4013 | 193 |
| 127 | 3300048907 | Ga0496104_0000666 | Ga0496104_0000666_371_979 | 195 |
| 128 | 3300048908 | Ga0496105_0004549 | Ga0496105_0004549_3538_4146 | 195 |
| 129 | 3300048922 | Ga0496119_0320679 | Ga0496119_0320679_49_657 | 195 |
| 130 | 3300053077 | Ga0495601_0245779 | Ga0495601_0245779_287_895 | 195 |
| 131 | 3300006175 | Ga0070712_100224422 | Ga0070712_1002244222 | 198 |
| 132 | 3300005356 | Ga0070674_100000014 | Ga0070674_10000001416 | 199 |
| 133 | 3300005718 | Ga0068866_10000219 | Ga0068866_1000021918 | 199 |
| 134 | 3300009147 | Ga0114129_10592930 | Ga0114129_105929303 | 199 |
| 135 | 3300009148 | Ga0105243_10221148 | Ga0105243_102211481 | 199 |
| 136 | 3300009176 | Ga0105242_10008605 | Ga0105242_100086055 | 199 |
| 137 | 3300025899 | Ga0207642_10000094 | Ga0207642_1000009421 | 199 |
| 138 | 3300025934 | Ga0207686_10015756 | Ga0207686_100157564 | 199 |
| 139 | 3300025937 | Ga0207669_10000007 | Ga0207669_1000000726 | 199 |
| 140 | 3300035398 | Ga0316574_0252193 | Ga0316574_0252193_155_781 | 199 |
| 141 | 3300046663 | Ga0495635_0242685 | Ga0495635_0242685_194_799 | 199 |
| 142 | 3300048911 | Ga0496108_0010707 | Ga0496108_0010707_5610_6218 | 199 |
| 143 | 3300048916 | Ga0496113_0058250 | Ga0496113_0058250_772_1380 | 199 |
| 144 | 3300049569 | Ga0501032_0376465 | Ga0501032_0376465_257_859 | 199 |
| 145 | 3300049572 | Ga0501036_0054873 | Ga0501036_0054873_2144_2746 | 199 |
| 146 | 3300049575 | Ga0501039_0306210 | Ga0501039_0306210_552_1154 | 199 |
| 147 | 3300049576 | Ga0501040_0086471 | Ga0501040_0086471_306_908 | 199 |
| 148 | 3300049577 | Ga0501041_0100089 | Ga0501041_0100089_57_659 | 199 |
| 149 | 3300049582 | Ga0501048_0046586 | Ga0501048_0046586_371_973 | 199 |
| 150 | 3300049588 | Ga0501072_0017787 | Ga0501072_0017787_357_959 | 199 |
| 151 | 3300049592 | Ga0501076_0002784 | Ga0501076_0002784_6706_7308 | 199 |
| 152 | 3300049741 | Ga0501079_0013453 | Ga0501079_0013453_1053_1655 | 199 |
| 153 | 3300049743 | Ga0501081_0004692 | Ga0501081_0004692_1693_2295 | 199 |
| 154 | 3300049824 | Ga0501045_0496404 | Ga0501045_0496404_52_654 | 199 |
| 155 | 3300054114 | Ga0501084_0215158 | Ga0501084_0215158_980_1582 | 199 |
| 156 | 3300060353 | Ga0501082_0195069 | Ga0501082_0195069_1006_1608 | 199 |
| 157 | 3300061734 | Ga0530510_0000462 | Ga0530510_0000462_6353_6955 | 199 |
| 158 | 3300005344 | Ga0070661_100699584 | Ga0070661_1006995841 | 200 |
| 159 | 3300005356 | Ga0070674_100008150 | Ga0070674_1000081503 | 200 |
| 160 | 3300005367 | Ga0070667_100242123 | Ga0070667_1002421232 | 200 |
| 161 | 3300005535 | Ga0070684_100022662 | Ga0070684_1000226622 | 200 |
| 162 | 3300025937 | Ga0207669_10015801 | Ga0207669_100158012 | 200 |
| 163 | 3300025944 | Ga0207661_10930911 | Ga0207661_109309112 | 200 |
| 164 | 3300035086 | Ga0373934_0132598 | Ga0373934_0132598_308_913 | 200 |
| 165 | 3300036401 | Ga0373937_0215040 | Ga0373937_0215040_1169_1774 | 200 |
| 166 | 3300037418 | Ga0395900_0570731 | Ga0395900_0570731_378_983 | 200 |
| 167 | 3300037471 | Ga0395905_0170928 | Ga0395905_0170928_1061_1666 | 200 |
| 168 | 3300046642 | Ga0495634_0182919 | Ga0495634_0182919_154_759 | 200 |
| 169 | 3300046678 | Ga0495599_0119765 | Ga0495599_0119765_263_868 | 200 |
| 170 | 3300047317 | Ga0495604_0235900 | Ga0495604_0235900_91_696 | 200 |
| 171 | 3300047319 | Ga0495674_0355247 | Ga0495674_0355247_549_1154 | 200 |
| 172 | 3300048913 | Ga0496110_0018894 | Ga0496110_0018894_4269_4874 | 200 |
| 173 | 3300048914 | Ga0496111_0009354 | Ga0496111_0009354_4350_4955 | 200 |
| 174 | 3300048915 | Ga0496112_0103593 | Ga0496112_0103593_1753_2358 | 200 |
| 175 | 3300048916 | Ga0496113_0083986 | Ga0496113_0083986_1606_2211 | 200 |
| 176 | 3300048918 | Ga0496115_0000004 | Ga0496115_0000004_270639_271241 | 200 |
| 177 | 3300053077 | Ga0495601_0023415 | Ga0495601_0023415_1736_2341 | 200 |
| 178 | 3300053078 | Ga0495612_0017880 | Ga0495612_0017880_761_1366 | 200 |
| 179 | 3300053085 | Ga0495619_0070764 | Ga0495619_0070764_725_1330 | 200 |
| 180 | 3300001979 | JGI24740J21852_10005676 | JGI24740J21852_100056766 | 201 |
| 181 | 3300005338 | Ga0068868_100888619 | Ga0068868_1008886191 | 201 |
| 182 | 3300005549 | Ga0070704_100191041 | Ga0070704_1001910413 | 201 |
| 183 | 3300005616 | Ga0068852_100000058 | Ga0068852_10000005828 | 201 |
| 184 | 3300005840 | Ga0068870_10271648 | Ga0068870_102716482 | 201 |
| 185 | 3300005937 | Ga0081455_10207032 | Ga0081455_102070322 | 201 |
| 186 | 3300009101 | Ga0105247_10000993 | Ga0105247_1000099315 | 201 |
| 187 | 3300009176 | Ga0105242_10238304 | Ga0105242_102383043 | 201 |
| 188 | 3300013297 | Ga0157378_10386968 | Ga0157378_103869683 | 201 |
| 189 | 3300025900 | Ga0207710_10000151 | Ga0207710_1000015135 | 201 |
| 190 | 3300025972 | Ga0207668_10498915 | Ga0207668_104989151 | 201 |
| 191 | 3300026142 | Ga0207698_10000002 | Ga0207698_10000002169 | 201 |
| 192 | 3300028379 | Ga0268266_10036593 | Ga0268266_100365932 | 201 |
| 193 | 3300044694 | Ga0466963_0000124 | Ga0466963_0000124_3461_4066 | 201 |
| 194 | 3300045836 | Ga0466958_0028489 | Ga0466958_0028489_2498_3124 | 201 |
| 195 | 3300046500 | Ga0495596_0085691 | Ga0495596_0085691_445_1053 | 201 |
| 196 | 3300046529 | Ga0495652_0060323 | Ga0495652_0060323_1245_1853 | 201 |
| 197 | 3300046684 | Ga0495669_0015561 | Ga0495669_0015561_1389_1997 | 201 |
| 198 | 3300046690 | Ga0495624_0002296 | Ga0495624_0002296_4781_5386 | 201 |
| 199 | 3300046690 | Ga0495624_0003753 | Ga0495624_0003753_7537_8142 | 201 |
| 200 | 3300047447 | Ga0495685_017740 | Ga0495685_017740_431_1036 | 201 |
| 201 | 3300048907 | Ga0496104_0000002 | Ga0496104_0000002_123568_124173 | 201 |
| 202 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_1204006_1204611 | 201 |
| 203 | 3300048913 | Ga0496110_0025732 | Ga0496110_0025732_653_1261 | 201 |
| 204 | 3300048914 | Ga0496111_0139036 | Ga0496111_0139036_701_1309 | 201 |
| 205 | 3300048922 | Ga0496119_0019537 | Ga0496119_0019537_1527_2132 | 201 |
| 206 | 3300048923 | Ga0496120_0049030 | Ga0496120_0049030_407_1012 | 201 |
| 207 | 3300049580 | Ga0501046_0147556 | Ga0501046_0147556_20_628 | 201 |
| 208 | 3300049587 | Ga0501071_0223791 | Ga0501071_0223791_317_925 | 201 |
| 209 | 3300053077 | Ga0495601_0266134 | Ga0495601_0266134_175_783 | 201 |
| 210 | 3300053077 | Ga0495601_0569593 | Ga0495601_0569593_88_693 | 201 |
| 211 | 3300053083 | Ga0495655_0004966 | Ga0495655_0004966_1621_2229 | 201 |
| 212 | 3300001977 | JGI24746J21847_1000728 | JGI24746J21847_10007283 | 202 |
| 213 | 3300002074 | JGI24748J21848_1003138 | JGI24748J21848_10031384 | 202 |
| 214 | 3300002239 | JGI24034J26672_10000167 | JGI24034J26672_100001677 | 202 |
| 215 | 3300002244 | JGI24742J22300_10000390 | JGI24742J22300_100003905 | 202 |
| 216 | 3300002459 | JGI24751J29686_10026666 | JGI24751J29686_100266663 | 202 |
| 217 | 3300003203 | JGI25406J46586_10021614 | JGI25406J46586_100216142 | 202 |
| 218 | 3300005329 | Ga0070683_100004842 | Ga0070683_1000048425 | 202 |
| 219 | 3300005329 | Ga0070683_100015414 | Ga0070683_1000154145 | 202 |
| 220 | 3300005335 | Ga0070666_10023706 | Ga0070666_100237063 | 202 |
| 221 | 3300005337 | Ga0070682_100000029 | Ga0070682_10000002918 | 202 |
| 222 | 3300005338 | Ga0068868_100043307 | Ga0068868_1000433073 | 202 |
| 223 | 3300005340 | Ga0070689_100243560 | Ga0070689_1002435602 | 202 |
| 224 | 3300005341 | Ga0070691_10003720 | Ga0070691_100037205 | 202 |
| 225 | 3300005344 | Ga0070661_100000161 | Ga0070661_1000001618 | 202 |
| 226 | 3300005347 | Ga0070668_100295683 | Ga0070668_1002956832 | 202 |
| 227 | 3300005356 | Ga0070674_100000011 | Ga0070674_1000000115 | 202 |
| 228 | 3300005356 | Ga0070674_100106832 | Ga0070674_1001068323 | 202 |
| 229 | 3300005364 | Ga0070673_100019029 | Ga0070673_1000190296 | 202 |
| 230 | 3300005365 | Ga0070688_100001064 | Ga0070688_10000106414 | 202 |
| 231 | 3300005367 | Ga0070667_100225233 | Ga0070667_1002252331 | 202 |
| 232 | 3300005435 | Ga0070714_100008340 | Ga0070714_1000083401 | 202 |
| 233 | 3300005441 | Ga0070700_100038140 | Ga0070700_1000381402 | 202 |
| 234 | 3300005455 | Ga0070663_100312538 | Ga0070663_1003125383 | 202 |
| 235 | 3300005456 | Ga0070678_100097451 | Ga0070678_1000974512 | 202 |
| 236 | 3300005456 | Ga0070678_100408611 | Ga0070678_1004086113 | 202 |
| 237 | 3300005457 | Ga0070662_100000008 | Ga0070662_10000000868 | 202 |
| 238 | 3300005458 | Ga0070681_10043861 | Ga0070681_100438614 | 202 |
| 239 | 3300005459 | Ga0068867_100000247 | Ga0068867_10000024710 | 202 |
| 240 | 3300005466 | Ga0070685_10000203 | Ga0070685_1000020323 | 202 |
| 241 | 3300005530 | Ga0070679_100000651 | Ga0070679_10000065125 | 202 |
| 242 | 3300005535 | Ga0070684_100022755 | Ga0070684_1000227555 | 202 |
| 243 | 3300005535 | Ga0070684_100117307 | Ga0070684_1001173073 | 202 |
| 244 | 3300005539 | Ga0068853_100031684 | Ga0068853_1000316844 | 202 |
| 245 | 3300005544 | Ga0070686_100022154 | Ga0070686_1000221543 | 202 |
| 246 | 3300005547 | Ga0070693_100000398 | Ga0070693_1000003988 | 202 |
| 247 | 3300005548 | Ga0070665_100000870 | Ga0070665_10000087031 | 202 |
| 248 | 3300005548 | Ga0070665_100002483 | Ga0070665_10000248310 | 202 |
| 249 | 3300005548 | Ga0070665_100047809 | Ga0070665_1000478095 | 202 |
| 250 | 3300005563 | Ga0068855_100356527 | Ga0068855_1003565273 | 202 |
| 251 | 3300005578 | Ga0068854_100000115 | Ga0068854_10000011548 | 202 |
| 252 | 3300005614 | Ga0068856_100000057 | Ga0068856_10000005753 | 202 |
| 253 | 3300005614 | Ga0068856_100010700 | Ga0068856_1000107004 | 202 |
| 254 | 3300005614 | Ga0068856_100420788 | Ga0068856_1004207881 | 202 |
| 255 | 3300005618 | Ga0068864_100000044 | Ga0068864_100000044133 | 202 |
| 256 | 3300005718 | Ga0068866_10000002 | Ga0068866_1000000251 | 202 |
| 257 | 3300005834 | Ga0068851_10001867 | Ga0068851_100018678 | 202 |
| 258 | 3300005841 | Ga0068863_100000042 | Ga0068863_10000004244 | 202 |
| 259 | 3300005842 | Ga0068858_100000086 | Ga0068858_10000008614 | 202 |
| 260 | 3300005842 | Ga0068858_100000155 | Ga0068858_10000015540 | 202 |
| 261 | 3300005842 | Ga0068858_100064971 | Ga0068858_1000649711 | 202 |
| 262 | 3300005843 | Ga0068860_100010275 | Ga0068860_1000102754 | 202 |
| 263 | 3300005937 | Ga0081455_10394222 | Ga0081455_103942222 | 202 |
| 264 | 3300005985 | Ga0081539_10001100 | Ga0081539_1000110039 | 202 |
| 265 | 3300005985 | Ga0081539_10003159 | Ga0081539_1000315921 | 202 |
| 266 | 3300006163 | Ga0070715_10000015 | Ga0070715_10000015116 | 202 |
| 267 | 3300006852 | Ga0075433_10000663 | Ga0075433_100006639 | 202 |
| 268 | 3300009094 | Ga0111539_10956239 | Ga0111539_109562391 | 202 |
| 269 | 3300009098 | Ga0105245_10000159 | Ga0105245_1000015943 | 202 |
| 270 | 3300009098 | Ga0105245_10001015 | Ga0105245_1000101518 | 202 |
| 271 | 3300009148 | Ga0105243_10004998 | Ga0105243_100049988 | 202 |
| 272 | 3300009176 | Ga0105242_10002766 | Ga0105242_1000276612 | 202 |
| 273 | 3300009177 | Ga0105248_10529203 | Ga0105248_105292032 | 202 |
| 274 | 3300009553 | Ga0105249_10189958 | Ga0105249_101899584 | 202 |
| 275 | 3300010375 | Ga0105239_10659490 | Ga0105239_106594902 | 202 |
| 276 | 3300013104 | Ga0157370_10006328 | Ga0157370_100063288 | 202 |
| 277 | 3300013104 | Ga0157370_10187874 | Ga0157370_101878743 | 202 |
| 278 | 3300013104 | Ga0157370_10563265 | Ga0157370_105632652 | 202 |
| 279 | 3300013296 | Ga0157374_10002177 | Ga0157374_100021775 | 202 |
| 280 | 3300013307 | Ga0157372_10000616 | Ga0157372_1000061618 | 202 |
| 281 | 3300013308 | Ga0157375_10000184 | Ga0157375_1000018436 | 202 |
| 282 | 3300014325 | Ga0163163_10207424 | Ga0163163_102074244 | 202 |
| 283 | 3300014325 | Ga0163163_10801426 | Ga0163163_108014261 | 202 |
| 284 | 3300014325 | Ga0163163_10975566 | Ga0163163_109755661 | 202 |
| 285 | 3300014326 | Ga0157380_10000080 | Ga0157380_1000008015 | 202 |
| 286 | 3300014968 | Ga0157379_10125057 | Ga0157379_101250572 | 202 |
| 287 | 3300017792 | Ga0163161_10000173 | Ga0163161_1000017351 | 202 |
| 288 | 3300020070 | Ga0206356_11661110 | Ga0206356_116611104 | 202 |
| 289 | 3300025321 | Ga0207656_10000354 | Ga0207656_1000035412 | 202 |
| 290 | 3300025321 | Ga0207656_10004306 | Ga0207656_100043065 | 202 |
| 291 | 3300025893 | Ga0207682_10000228 | Ga0207682_100002285 | 202 |
| 292 | 3300025899 | Ga0207642_10000001 | Ga0207642_10000001557 | 202 |
| 293 | 3300025899 | Ga0207642_10000003 | Ga0207642_10000003557 | 202 |
| 294 | 3300025903 | Ga0207680_10048971 | Ga0207680_100489713 | 202 |
| 295 | 3300025905 | Ga0207685_10000001 | Ga0207685_10000001310 | 202 |
| 296 | 3300025909 | Ga0207705_10091476 | Ga0207705_100914763 | 202 |
| 297 | 3300025912 | Ga0207707_10018135 | Ga0207707_100181358 | 202 |
| 298 | 3300025920 | Ga0207649_10000024 | Ga0207649_1000002456 | 202 |
| 299 | 3300025921 | Ga0207652_10000150 | Ga0207652_1000015051 | 202 |
| 300 | 3300025927 | Ga0207687_10000011 | Ga0207687_10000011350 | 202 |
| 301 | 3300025927 | Ga0207687_10000021 | Ga0207687_10000021155 | 202 |
| 302 | 3300025927 | Ga0207687_10000716 | Ga0207687_100007165 | 202 |
| 303 | 3300025929 | Ga0207664_10056834 | Ga0207664_100568342 | 202 |
| 304 | 3300025932 | Ga0207690_10121085 | Ga0207690_101210854 | 202 |
| 305 | 3300025933 | Ga0207706_10000016 | Ga0207706_10000016106 | 202 |
| 306 | 3300025934 | Ga0207686_10000549 | Ga0207686_100005499 | 202 |
| 307 | 3300025934 | Ga0207686_10070529 | Ga0207686_100705292 | 202 |
| 308 | 3300025936 | Ga0207670_10129878 | Ga0207670_101298782 | 202 |
| 309 | 3300025937 | Ga0207669_10000027 | Ga0207669_100000275 | 202 |
| 310 | 3300025941 | Ga0207711_10362123 | Ga0207711_103621232 | 202 |
| 311 | 3300025944 | Ga0207661_10003394 | Ga0207661_1000339410 | 202 |
| 312 | 3300025944 | Ga0207661_10007802 | Ga0207661_100078025 | 202 |
| 313 | 3300025944 | Ga0207661_10553874 | Ga0207661_105538742 | 202 |
| 314 | 3300025949 | Ga0207667_10380532 | Ga0207667_103805322 | 202 |
| 315 | 3300025960 | Ga0207651_10029595 | Ga0207651_100295955 | 202 |
| 316 | 3300025961 | Ga0207712_10000033 | Ga0207712_1000003330 | 202 |
| 317 | 3300025972 | Ga0207668_10099829 | Ga0207668_100998292 | 202 |
| 318 | 3300025981 | Ga0207640_10000059 | Ga0207640_1000005942 | 202 |
| 319 | 3300025981 | Ga0207640_10001105 | Ga0207640_100011058 | 202 |
| 320 | 3300025986 | Ga0207658_10044890 | Ga0207658_100448903 | 202 |
| 321 | 3300025986 | Ga0207658_10331673 | Ga0207658_103316731 | 202 |
| 322 | 3300026023 | Ga0207677_10004273 | Ga0207677_100042732 | 202 |
| 323 | 3300026023 | Ga0207677_10039439 | Ga0207677_100394393 | 202 |
| 324 | 3300026035 | Ga0207703_10000072 | Ga0207703_1000007282 | 202 |
| 325 | 3300026035 | Ga0207703_10000266 | Ga0207703_1000026648 | 202 |
| 326 | 3300026041 | Ga0207639_10003854 | Ga0207639_100038546 | 202 |
| 327 | 3300026067 | Ga0207678_10153719 | Ga0207678_101537192 | 202 |
| 328 | 3300026075 | Ga0207708_10100994 | Ga0207708_101009944 | 202 |
| 329 | 3300026078 | Ga0207702_10000027 | Ga0207702_1000002794 | 202 |
| 330 | 3300026078 | Ga0207702_10007605 | Ga0207702_100076055 | 202 |
| 331 | 3300026078 | Ga0207702_10369951 | Ga0207702_103699513 | 202 |
| 332 | 3300026088 | Ga0207641_10000231 | Ga0207641_1000023144 | 202 |
| 333 | 3300026089 | Ga0207648_10000230 | Ga0207648_1000023016 | 202 |
| 334 | 3300026095 | Ga0207676_10000043 | Ga0207676_10000043132 | 202 |
| 335 | 3300026121 | Ga0207683_10010360 | Ga0207683_100103608 | 202 |
| 336 | 3300026121 | Ga0207683_10421762 | Ga0207683_104217622 | 202 |
| 337 | 3300028379 | Ga0268266_10000076 | Ga0268266_10000076187 | 202 |
| 338 | 3300028379 | Ga0268266_10004334 | Ga0268266_1000433411 | 202 |
| 339 | 3300028379 | Ga0268266_10194892 | Ga0268266_101948922 | 202 |
| 340 | 3300028381 | Ga0268264_10008628 | Ga0268264_1000862810 | 202 |
| 341 | 3300028573 | Ga0265334_10032003 | Ga0265334_100320034 | 202 |
| 342 | 3300035111 | Ga0373923_0277658 | Ga0373923_0277658_18_632 | 202 |
| 343 | 3300035725 | Ga0373947_0433599 | Ga0373947_0433599_158_766 | 202 |
| 344 | 3300036401 | Ga0373937_0041924 | Ga0373937_0041924_2033_2647 | 202 |
| 345 | 3300036401 | Ga0373937_0312578 | Ga0373937_0312578_836_1450 | 202 |
| 346 | 3300041491 | Ga0451833_1024539 | Ga0451833_1024539_488_1129 | 202 |
| 347 | 3300041512 | Ga0451853_0674116 | Ga0451853_0674116_955_1572 | 202 |
| 348 | 3300046454 | Ga0495592_0000521 | Ga0495592_0000521_15062_15676 | 202 |
| 349 | 3300046454 | Ga0495592_0064755 | Ga0495592_0064755_771_1382 | 202 |
| 350 | 3300046455 | Ga0495603_0000622 | Ga0495603_0000622_1422_2033 | 202 |
| 351 | 3300046455 | Ga0495603_0004750 | Ga0495603_0004750_6653_7267 | 202 |
| 352 | 3300046459 | Ga0495629_0001361 | Ga0495629_0001361_6220_6831 | 202 |
| 353 | 3300046459 | Ga0495629_0150945 | Ga0495629_0150945_68_688 | 202 |
| 354 | 3300046461 | Ga0495641_0000001 | Ga0495641_0000001_189035_189652 | 202 |
| 355 | 3300046462 | Ga0495651_0551403 | Ga0495651_0551403_92_715 | 202 |
| 356 | 3300046463 | Ga0495653_0098333 | Ga0495653_0098333_1316_1927 | 202 |
| 357 | 3300046463 | Ga0495653_0162105 | Ga0495653_0162105_500_1114 | 202 |
| 358 | 3300046463 | Ga0495653_0206221 | Ga0495653_0206221_54_677 | 202 |
| 359 | 3300046473 | Ga0495582_0000022 | Ga0495582_0000022_68270_68887 | 202 |
| 360 | 3300046475 | Ga0495639_0030389 | Ga0495639_0030389_1479_2090 | 202 |
| 361 | 3300046476 | Ga0495662_0000137 | Ga0495662_0000137_13088_13699 | 202 |
| 362 | 3300046476 | Ga0495662_0009206 | Ga0495662_0009206_1300_1911 | 202 |
| 363 | 3300046511 | Ga0495608_0000163 | Ga0495608_0000163_12435_13055 | 202 |
| 364 | 3300046511 | Ga0495608_0287385 | Ga0495608_0287385_306_923 | 202 |
| 365 | 3300046514 | Ga0495618_0001468 | Ga0495618_0001468_1118_1732 | 202 |
| 366 | 3300046515 | Ga0495620_0001840 | Ga0495620_0001840_9013_9645 | 202 |
| 367 | 3300046516 | Ga0495628_0026019 | Ga0495628_0026019_2748_3356 | 202 |
| 368 | 3300046516 | Ga0495628_0061540 | Ga0495628_0061540_1045_1662 | 202 |
| 369 | 3300046516 | Ga0495628_0201839 | Ga0495628_0201839_223_834 | 202 |
| 370 | 3300046517 | Ga0495630_0000037 | Ga0495630_0000037_4807_5439 | 202 |
| 371 | 3300046517 | Ga0495630_0020101 | Ga0495630_0020101_3414_4025 | 202 |
| 372 | 3300046517 | Ga0495630_0070337 | Ga0495630_0070337_1344_1970 | 202 |
| 373 | 3300046523 | Ga0495644_0000454 | Ga0495644_0000454_1212_1826 | 202 |
| 374 | 3300046529 | Ga0495652_0000086 | Ga0495652_0000086_32185_32811 | 202 |
| 375 | 3300046533 | Ga0495640_0021952 | Ga0495640_0021952_2892_3506 | 202 |
| 376 | 3300046533 | Ga0495640_0112327 | Ga0495640_0112327_92_703 | 202 |
| 377 | 3300046535 | Ga0495586_0007201 | Ga0495586_0007201_4941_5558 | 202 |
| 378 | 3300046536 | Ga0495587_0001022 | Ga0495587_0001022_12246_12857 | 202 |
| 379 | 3300046536 | Ga0495587_0029073 | Ga0495587_0029073_1294_1908 | 202 |
| 380 | 3300046539 | Ga0495621_0011410 | Ga0495621_0011410_1362_1973 | 202 |
| 381 | 3300046543 | Ga0495645_0024357 | Ga0495645_0024357_759_1403 | 202 |
| 382 | 3300046558 | Ga0495633_0006532 | Ga0495633_0006532_1071_1700 | 202 |
| 383 | 3300046642 | Ga0495634_0000013 | Ga0495634_0000013_25371_25982 | 202 |
| 384 | 3300046642 | Ga0495634_0001471 | Ga0495634_0001471_19117_19737 | 202 |
| 385 | 3300046642 | Ga0495634_0090023 | Ga0495634_0090023_1217_1849 | 202 |
| 386 | 3300046642 | Ga0495634_0141968 | Ga0495634_0141968_536_1150 | 202 |
| 387 | 3300046660 | Ga0495625_0001659 | Ga0495625_0001659_4244_4855 | 202 |
| 388 | 3300046663 | Ga0495635_0000063 | Ga0495635_0000063_21477_22091 | 202 |
| 389 | 3300046663 | Ga0495635_0067371 | Ga0495635_0067371_855_1475 | 202 |
| 390 | 3300046663 | Ga0495635_0343917 | Ga0495635_0343917_232_864 | 202 |
| 391 | 3300046678 | Ga0495599_0006457 | Ga0495599_0006457_454_1071 | 202 |
| 392 | 3300046678 | Ga0495599_0127676 | Ga0495599_0127676_789_1430 | 202 |
| 393 | 3300046681 | Ga0495647_0003248 | Ga0495647_0003248_1544_2161 | 202 |
| 394 | 3300046681 | Ga0495647_0008323 | Ga0495647_0008323_1327_1959 | 202 |
| 395 | 3300046683 | Ga0495658_0000008 | Ga0495658_0000008_68710_69327 | 202 |
| 396 | 3300046683 | Ga0495658_0098296 | Ga0495658_0098296_1087_1698 | 202 |
| 397 | 3300046684 | Ga0495669_0000651 | Ga0495669_0000651_11363_11989 | 202 |
| 398 | 3300046689 | Ga0495613_0000369 | Ga0495613_0000369_35259_35873 | 202 |
| 399 | 3300046689 | Ga0495613_0204189 | Ga0495613_0204189_594_1205 | 202 |
| 400 | 3300046691 | Ga0495670_0007059 | Ga0495670_0007059_1201_1830 | 202 |
| 401 | 3300046691 | Ga0495670_0150665 | Ga0495670_0150665_337_948 | 202 |
| 402 | 3300046694 | Ga0495649_0030299 | Ga0495649_0030299_891_1508 | 202 |
| 403 | 3300046809 | Ga0495600_0035731 | Ga0495600_0035731_1555_2169 | 202 |
| 404 | 3300046809 | Ga0495600_0097188 | Ga0495600_0097188_1109_1738 | 202 |
| 405 | 3300047317 | Ga0495604_0000033 | Ga0495604_0000033_72014_72625 | 202 |
| 406 | 3300047317 | Ga0495604_0050587 | Ga0495604_0050587_1074_1685 | 202 |
| 407 | 3300047319 | Ga0495674_0000007 | Ga0495674_0000007_143670_144281 | 202 |
| 408 | 3300047321 | Ga0495676_0001759 | Ga0495676_0001759_15048_15665 | 202 |
| 409 | 3300047322 | Ga0495680_0000215 | Ga0495680_0000215_33978_34598 | 202 |
| 410 | 3300047322 | Ga0495680_0000587 | Ga0495680_0000587_5361_5975 | 202 |
| 411 | 3300047322 | Ga0495680_0036038 | Ga0495680_0036038_2124_2744 | 202 |
| 412 | 3300047444 | Ga0495675_0015728 | Ga0495675_0015728_2731_3342 | 202 |
| 413 | 3300047471 | Ga0495684_0110662 | Ga0495684_0110662_711_1322 | 202 |
| 414 | 3300047471 | Ga0495684_0529728 | Ga0495684_0529728_80_760 | 202 |
| 415 | 3300047472 | Ga0495686_0129780 | Ga0495686_0129780_443_1054 | 202 |
| 416 | 3300047673 | Ga0495593_0010922 | Ga0495593_0010922_2729_3340 | 202 |
| 417 | 3300048903 | Ga0496100_0000003 | Ga0496100_0000003_196254_196880 | 202 |
| 418 | 3300048904 | Ga0496101_0000003 | Ga0496101_0000003_196254_196880 | 202 |
| 419 | 3300048905 | Ga0496102_0105895 | Ga0496102_0105895_1072_1692 | 202 |
| 420 | 3300048907 | Ga0496104_0000066 | Ga0496104_0000066_28462_29094 | 202 |
| 421 | 3300048908 | Ga0496105_0000020 | Ga0496105_0000020_152391_153023 | 202 |
| 422 | 3300048908 | Ga0496105_0022756 | Ga0496105_0022756_922_1551 | 202 |
| 423 | 3300048909 | Ga0496106_0000015 | Ga0496106_0000015_65697_66323 | 202 |
| 424 | 3300048910 | Ga0496107_0000008 | Ga0496107_0000008_87314_87940 | 202 |
| 425 | 3300048911 | Ga0496108_0000002 | Ga0496108_0000002_67834_68442 | 202 |
| 426 | 3300048912 | Ga0496109_0000001 | Ga0496109_0000001_67796_68404 | 202 |
| 427 | 3300048912 | Ga0496109_0533390 | Ga0496109_0533390_367_978 | 202 |
| 428 | 3300048914 | Ga0496111_0031644 | Ga0496111_0031644_995_1606 | 202 |
| 429 | 3300048914 | Ga0496111_0532169 | Ga0496111_0532169_51_671 | 202 |
| 430 | 3300048915 | Ga0496112_0000003 | Ga0496112_0000003_637604_638215 | 202 |
| 431 | 3300048916 | Ga0496113_0017949 | Ga0496113_0017949_1937_2548 | 202 |
| 432 | 3300048916 | Ga0496113_0146468 | Ga0496113_0146468_18_629 | 202 |
| 433 | 3300048916 | Ga0496113_0157168 | Ga0496113_0157168_44_658 | 202 |
| 434 | 3300048916 | Ga0496113_0822161 | Ga0496113_0822161_96_707 | 202 |
| 435 | 3300048917 | Ga0496114_0030582 | Ga0496114_0030582_2432_3052 | 202 |
| 436 | 3300048928 | Ga0496125_0047605 | Ga0496125_0047605_1193_1801 | 202 |
| 437 | 3300049578 | Ga0501042_0012267 | Ga0501042_0012267_3915_4526 | 202 |
| 438 | 3300049578 | Ga0501042_0019107 | Ga0501042_0019107_1982_2593 | 202 |
| 439 | 3300049582 | Ga0501048_0547258 | Ga0501048_0547258_31_648 | 202 |
| 440 | 3300049586 | Ga0501070_0420345 | Ga0501070_0420345_60_671 | 202 |
| 441 | 3300049588 | Ga0501072_0147757 | Ga0501072_0147757_469_1086 | 202 |
| 442 | 3300049591 | Ga0501075_0007890 | Ga0501075_0007890_1569_2180 | 202 |
| 443 | 3300049591 | Ga0501075_0776284 | Ga0501075_0776284_79_696 | 202 |
| 444 | 3300049592 | Ga0501076_0690294 | Ga0501076_0690294_84_701 | 202 |
| 445 | 3300049741 | Ga0501079_0390869 | Ga0501079_0390869_134_751 | 202 |
| 446 | 3300049743 | Ga0501081_0353171 | Ga0501081_0353171_462_1073 | 202 |
| 447 | 3300050509 | nmdc:mga0qj67_67177_c1 | nmdc:mga0qj67_67177_c1_2077_2688 | 202 |
| 448 | 3300050515 | nmdc:mga0a205_155_c1 | nmdc:mga0a205_155_c1_19403_20011 | 202 |
| 449 | 3300053077 | Ga0495601_0000169 | Ga0495601_0000169_19119_19736 | 202 |
| 450 | 3300053077 | Ga0495601_0103639 | Ga0495601_0103639_968_1600 | 202 |
| 451 | 3300053078 | Ga0495612_0001003 | Ga0495612_0001003_6854_7468 | 202 |
| 452 | 3300053078 | Ga0495612_0060720 | Ga0495612_0060720_311_922 | 202 |
| 453 | 3300053078 | Ga0495612_0076366 | Ga0495612_0076366_693_1307 | 202 |
| 454 | 3300053084 | Ga0495595_0000372 | Ga0495595_0000372_1286_1897 | 202 |
| 455 | 3300053085 | Ga0495619_0000015 | Ga0495619_0000015_88644_89255 | 202 |
| 456 | 3300053085 | Ga0495619_0007151 | Ga0495619_0007151_3567_4199 | 202 |
| 457 | 3300053085 | Ga0495619_0040276 | Ga0495619_0040276_1047_1661 | 202 |
| 458 | 3300053085 | Ga0495619_0368707 | Ga0495619_0368707_261_881 | 202 |
| 459 | 3300053096 | Ga0500641_0017264 | Ga0500641_0017264_968_1579 | 202 |
| 460 | 3300053123 | Ga0500614_000374 | Ga0500614_000374_8411_9028 | 202 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dh0-assembly1.cif.gz_A | crystal structure of a sam dependent methyltransferase from aquifex aeolicus | 0.9151 | 42 | 200 |
| 5kn4-assembly1.cif.gz_B | pavine n-methyltransferase apoenzyme ph 6.0 | 0.9079 | 45 | 162 |
| 3mgg-assembly1.cif.gz_A | crystal structure of methyl transferase from methanosarcina mazei | 0.8982 | 56 | 163 |
| 4pne-assembly3.cif.gz_B | crystal structure of the [4+2]-cyclase spnf | 0.8977 | 45 | 190 |
| 4pne-assembly3.cif.gz_A | crystal structure of the [4+2]-cyclase spnf | 0.8946 | 45 | 190 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54LU3_44_217_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.919 | 45 | 160 | 3.40.50.150 |
| 3dh0A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9151 | 42 | 200 | 3.40.50.150 |
| af_C7J169_1_82_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9054 | 45 | 110 | 3.40.50.150 |
| af_K7KE15_1_124_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9012 | 44 | 160 | 3.40.50.150 |
| af_K7LTE4_237_888_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8998 | 45 | 117 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G0LN26-F1-model_v4 | Methyltransferase type 11 | 0.9867 | 57 | 202 |
GO:0008757
GO:0032259 |
| AF-A0A1H6FJQ3-F1-model_v4 | UbiE/COQ5 methyltransferase family protein | 0.9818 | 45 | 201 |
GO:0008168
GO:0032259 |
| AF-A0A419W307-F1-model_v4 | Arsenite methyltransferase (EC 2.1.1.137) | 0.9782 | 58 | 201 |
GO:0008168
GO:0032259 |
| AF-A0A7J2IRE3-F1-model_v4 | Methyltransferase domain-containing protein | 0.9759 | 42 | 201 |
GO:0004222
GO:0008168 GO:0016020 GO:0032259 GO:0071586 |
| AF-X1HEA1-F1-model_v4 | Methyltransferase type 11 domain-containing protein | 0.9745 | 55 | 181 |
GO:0008757
GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar