F448536

General Info

Members Datasets Scaffolds Average Seq Length
460 158 920 160

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10060061|Ga0105245_100600616
Length 197
Sequence MAETLAAVASPPADGAVLPVMRGCTARYGKEISMASREDFTDEEWARLKRAPFVAGMAISLADPGGPIEAFKETAATLKAVRGAEGGASGELPGAIAREVVAEAQQRKNPLGGFKPTSGATAGVEILDELGGVNRIVSEKGSPEDTAAMREFLLAVAQEAANAAKEGGFMGWHAERVSEGEQRMLDRLKEALSAPSA

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
83 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
84 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
85 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
86 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
87 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
88 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
89 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
90 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
91 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
92 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
93 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
94 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
95 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
96 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
97 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
98 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
99 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
100 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
101 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
102 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
103 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
104 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
105 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
106 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
107 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
108 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
109 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
129 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
155 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
156 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.87
Rhizosphere 99.13
Stem 0
Stem Tuber 0
Unclassified 9.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10060061 3300009098 Bacteria 3424
2 JGI25406J46586_10004822 3300003203 Bacteria 6272
3 JGI25406J46586_10052300 3300003203 Bacteria 1362
4 JGI25407J50210_10011438 3300003373 Bacteria 2268
5 JGI25407J50210_10012332 3300003373 Bacteria 2191
6 JGI25407J50210_10016022 3300003373 Bacteria 1939
7 JGI25407J50210_10023816 3300003373 Bacteria 1589
8 JGI25407J50210_10026554 3300003373 Bacteria 1502
9 JGI25407J50210_10097646 3300003373 Bacteria 726
10 JGI25407J50210_10099748 3300003373 Bacteria 718
11 JGI25407J50210_10102723 3300003373 Unclassified 706
12 JGI25407J50210_10119178 3300003373 Unclassified 650
13 Ga0070676_10368913 3300005328 Bacteria 991
14 Ga0070676_10921245 3300005328 Bacteria 652
15 Ga0070682_100469732 3300005337 Bacteria 968
16 Ga0070661_100896338 3300005344 Bacteria 732
17 Ga0070668_100185624 3300005347 Bacteria 1701
18 Ga0070674_100140001 3300005356 Bacteria 1815
19 Ga0070659_100175995 3300005366 Bacteria 1754
20 Ga0070700_100093364 3300005441 Bacteria 1968
21 Ga0070663_100599733 3300005455 Bacteria 926
22 Ga0070678_100675222 3300005456 Unclassified 929
23 Ga0070662_100177174 3300005457 Bacteria 1679
24 Ga0070662_100387322 3300005457 Bacteria 1151
25 Ga0068867_100277688 3300005459 Bacteria 1373
26 Ga0070684_100357494 3300005535 Bacteria 1344
27 Ga0070665_100561281 3300005548 Bacteria 1154
28 Ga0070664_100202959 3300005564 Bacteria 1770
29 Ga0070664_100206893 3300005564 Bacteria 1753
30 Ga0070664_100542694 3300005564 Bacteria 1075
31 Ga0068857_101009738 3300005577 Bacteria 801
32 Ga0068854_100320543 3300005578 Bacteria 1259
33 Ga0068854_100492591 3300005578 Bacteria 1031
34 Ga0070702_100737403 3300005615 Bacteria 755
35 Ga0068864_101373079 3300005618 Bacteria 708
36 Ga0068861_100204539 3300005719 Bacteria 1659
37 Ga0068861_100387269 3300005719 Bacteria 1237
38 Ga0068862_101343734 3300005844 Bacteria 717
39 Ga0081455_10035255 3300005937 Bacteria 4474
40 Ga0081455_10065193 3300005937 Bacteria 3047
41 Ga0081455_10541153 3300005937 Bacteria 772
42 Ga0081538_10000517 3300005981 Bacteria 43195
43 Ga0081538_10001979 3300005981 Bacteria 20471
44 Ga0081538_10003192 3300005981 Bacteria 15567
45 Ga0081538_10003617 3300005981 Bacteria 14529
46 Ga0081538_10007842 3300005981 Bacteria 9158
47 Ga0081538_10008425 3300005981 Bacteria 8753
48 Ga0081538_10014362 3300005981 Bacteria 6205
49 Ga0081538_10014541 3300005981 Bacteria 6153
50 Ga0081538_10016087 3300005981 Bacteria 5753
51 Ga0081538_10021228 3300005981 Bacteria 4750
52 Ga0081538_10021461 3300005981 Bacteria 4714
53 Ga0081538_10022405 3300005981 Bacteria 4578
54 Ga0081538_10027756 3300005981 Bacteria 3914
55 Ga0081538_10029181 3300005981 Bacteria 3776
56 Ga0081538_10032794 3300005981 Bacteria 3471
57 Ga0081538_10033687 3300005981 Bacteria 3403
58 Ga0081538_10038377 3300005981 Bacteria 3091
59 Ga0081538_10051783 3300005981 Bacteria 2461
60 Ga0081538_10059367 3300005981 Bacteria 2210
61 Ga0081538_10063161 3300005981 Bacteria 2105
62 Ga0081538_10064731 3300005981 Bacteria 2065
63 Ga0081538_10154216 3300005981 Bacteria 1034
64 Ga0081538_10167565 3300005981 Bacteria 964
65 Ga0081538_10218562 3300005981 Bacteria 759
66 Ga0081540_1022650 3300005983 Bacteria 3705
67 Ga0081539_10002553 3300005985 Bacteria 25265
68 Ga0081539_10003404 3300005985 Bacteria 19619
69 Ga0081539_10003764 3300005985 Bacteria 17977
70 Ga0081539_10009333 3300005985 Bacteria 8231
71 Ga0081539_10063444 3300005985 Bacteria 2016
72 Ga0081539_10089012 3300005985 Bacteria 1600
73 Ga0081539_10142458 3300005985 Unclassified 1163
74 Ga0081539_10231696 3300005985 Bacteria 833
75 Ga0075432_10024118 3300006058 Unclassified 2083
76 Ga0075428_100735798 3300006844 Bacteria 1050
77 Ga0075428_100915858 3300006844 Bacteria 930
78 Ga0075428_101003755 3300006844 Unclassified 883
79 Ga0075428_101368633 3300006844 Unclassified 743
80 Ga0075430_100024681 3300006846 Bacteria 5113
81 Ga0075431_100287633 3300006847 Bacteria 1663
82 Ga0075433_10013824 3300006852 Bacteria 6580
83 Ga0075433_10032833 3300006852 Bacteria 4448
84 Ga0075434_100007620 3300006871 Bacteria 10015
85 Ga0075434_100057631 3300006871 Bacteria 3861
86 Ga0075429_100351497 3300006880 Unclassified 1290
87 Ga0075435_100305882 3300007076 Unclassified 1360
88 Ga0111539_10044738 3300009094 Bacteria 5302
89 Ga0111539_10076964 3300009094 Bacteria 3928
90 Ga0111539_10125649 3300009094 Bacteria 3006
91 Ga0111539_10360368 3300009094 Bacteria 1692
92 Ga0111539_11119040 3300009094 Bacteria 915
93 Ga0111539_12487682 3300009094 Bacteria 600
94 Ga0105245_10700548 3300009098 Bacteria 1046
95 Ga0114129_10012071 3300009147 Bacteria 12295
96 Ga0114129_10492970 3300009147 Bacteria 1601
97 Ga0114129_10808542 3300009147 Bacteria 1195
98 Ga0105248_12163527 3300009177 Bacteria 633
99 Ga0105249_10252511 3300009553 Bacteria 1749
100 Ga0105239_10295331 3300010375 Bacteria 1825
101 Ga0163162_10293295 3300013306 Bacteria 1758
102 Ga0182008_10149710 3300014497 Bacteria 1170
103 Ga0157379_10545256 3300014968 Bacteria 1079
104 Ga0207688_10137922 3300025901 Bacteria 1434
105 Ga0207705_10465361 3300025909 Bacteria 981
106 Ga0207657_10319265 3300025919 Bacteria 1228
107 Ga0207659_10376988 3300025926 Bacteria 1182
108 Ga0207687_10528910 3300025927 Bacteria 987
109 Ga0207690_10940123 3300025932 Bacteria 718
110 Ga0207706_10013703 3300025933 Bacteria 7359
111 Ga0207706_10020732 3300025933 Bacteria 5906
112 Ga0207709_10380539 3300025935 Unclassified 1074
113 Ga0207661_10443379 3300025944 Bacteria 1182
114 Ga0207661_11270802 3300025944 Bacteria 677
115 Ga0207679_10227543 3300025945 Bacteria 1572
116 Ga0207679_10242920 3300025945 Bacteria 1527
117 Ga0207712_10344942 3300025961 Bacteria 1236
118 Ga0207668_10718290 3300025972 Bacteria 879
119 Ga0207640_10090961 3300025981 Bacteria 2113
120 Ga0207640_10822447 3300025981 Bacteria 806
121 Ga0207678_10223272 3300026067 Bacteria 1613
122 Ga0207708_10592863 3300026075 Bacteria 938
123 Ga0207648_10209376 3300026089 Bacteria 1730
124 Ga0207648_10393533 3300026089 Bacteria 1254
125 Ga0207676_10832885 3300026095 Bacteria 902
126 Ga0207674_10626353 3300026116 Bacteria 1039
127 Ga0207675_100032765 3300026118 Bacteria 4841
128 Ga0207675_100342695 3300026118 Bacteria 1463
129 Ga0207675_100979741 3300026118 Bacteria 863
130 Ga0207698_11192517 3300026142 Bacteria 775
131 Ga0207428_10008257 3300027907 Bacteria 9417
132 Ga0207428_10113535 3300027907 Bacteria 2082
133 Ga0207428_10454875 3300027907 Bacteria 933
134 Ga0268266_11356554 3300028379 Bacteria 686
135 Ga0307408_100039693 3300031548 Bacteria 3330
136 Ga0307408_100175913 3300031548 Bacteria 1712
137 Ga0307408_100248464 3300031548 Bacteria 1466
138 Ga0307408_100260001 3300031548 Bacteria 1436
139 Ga0307408_100291447 3300031548 Bacteria 1363
140 Ga0307408_100382819 3300031548 Bacteria 1203
141 Ga0307408_100620591 3300031548 Unclassified 963
142 Ga0307405_10012918 3300031731 Bacteria 4440
143 Ga0307405_10017930 3300031731 Bacteria 3896
144 Ga0307405_10037756 3300031731 Bacteria 2906
145 Ga0307405_10111777 3300031731 Unclassified 1852
146 Ga0307405_10117778 3300031731 Bacteria 1811
147 Ga0307405_10300609 3300031731 Bacteria 1217
148 Ga0307405_10444846 3300031731 Bacteria 1026
149 Ga0307405_10450726 3300031731 Unclassified 1020
150 Ga0307413_10011755 3300031824 Bacteria 4323
151 Ga0307413_10012860 3300031824 Bacteria 4181
152 Ga0307413_10018590 3300031824 Bacteria 3652
153 Ga0307413_10050358 3300031824 Bacteria 2502
154 Ga0307413_10089226 3300031824 Bacteria 2002
155 Ga0307413_10212641 3300031824 Bacteria 1406
156 Ga0307413_11907458 3300031824 Bacteria 534
157 Ga0307410_10020371 3300031852 Bacteria 4055
158 Ga0307410_10041653 3300031852 Bacteria 3030
159 Ga0307410_10043157 3300031852 Bacteria 2986
160 Ga0307410_10050551 3300031852 Bacteria 2796
161 Ga0307410_10223062 3300031852 Bacteria 1451
162 Ga0307410_10226632 3300031852 Unclassified 1441
163 Ga0307410_10347294 3300031852 Bacteria 1184
164 Ga0307410_10475728 3300031852 Unclassified 1024
165 Ga0307410_11123120 3300031852 Bacteria 682
166 Ga0307406_10002539 3300031901 Bacteria 9953
167 Ga0307406_10040348 3300031901 Bacteria 2902
168 Ga0307406_10065140 3300031901 Unclassified 2367
169 Ga0307406_10111825 3300031901 Bacteria 1882
170 Ga0307406_10150265 3300031901 Bacteria 1660
171 Ga0307406_10197856 3300031901 Unclassified 1477
172 Ga0307406_10259904 3300031901 Unclassified 1313
173 Ga0307406_10354387 3300031901 Bacteria 1148
174 Ga0307406_10471911 3300031901 Bacteria 1011
175 Ga0307406_10723156 3300031901 Bacteria 833
176 Ga0307406_11218446 3300031901 Bacteria 654
177 Ga0307406_11903034 3300031901 Bacteria 530
178 Ga0307407_10001466 3300031903 Bacteria 8567
179 Ga0307407_10003346 3300031903 Bacteria 6555
180 Ga0307407_10005504 3300031903 Bacteria 5504
181 Ga0307407_10021625 3300031903 Bacteria 3322
182 Ga0307407_10180641 3300031903 Unclassified 1398
183 Ga0307412_10014802 3300031911 Bacteria 4610
184 Ga0307412_10046217 3300031911 Bacteria 2851
185 Ga0307412_10176805 3300031911 Bacteria 1601
186 Ga0307412_10304015 3300031911 Bacteria 1262
187 Ga0307412_10323991 3300031911 Unclassified 1227
188 Ga0307412_11108424 3300031911 Unclassified 705
189 Ga0307409_100000251 3300031995 Bacteria 21695
190 Ga0307409_100000332 3300031995 Bacteria 19503
191 Ga0307409_100008958 3300031995 Bacteria 6114
192 Ga0307409_100034543 3300031995 Bacteria 3694
193 Ga0307409_100076522 3300031995 Bacteria 2684
194 Ga0307409_100079058 3300031995 Bacteria 2649
195 Ga0307409_100095002 3300031995 Bacteria 2455
196 Ga0307409_100128508 3300031995 Bacteria 2160
197 Ga0307409_100177640 3300031995 Bacteria 1881
198 Ga0307409_100185628 3300031995 Unclassified 1845
199 Ga0307409_100793851 3300031995 Bacteria 954
200 Ga0307409_100796203 3300031995 Unclassified 952
201 Ga0307409_100821157 3300031995 Bacteria 938
202 Ga0307409_101028329 3300031995 Bacteria 843
203 Ga0307409_101308157 3300031995 Bacteria 750
204 Ga0307409_102340876 3300031995 Bacteria 563
205 Ga0307416_100001100 3300032002 Bacteria 14470
206 Ga0307416_100009077 3300032002 Bacteria 6475
207 Ga0307416_100011100 3300032002 Bacteria 5990
208 Ga0307416_100044339 3300032002 Bacteria 3491
209 Ga0307416_100049427 3300032002 Bacteria 3343
210 Ga0307416_100051565 3300032002 Bacteria 3287
211 Ga0307416_100061081 3300032002 Bacteria 3073
212 Ga0307416_100119020 3300032002 Bacteria 2348
213 Ga0307416_100205463 3300032002 Bacteria 1873
214 Ga0307416_100250804 3300032002 Unclassified 1722
215 Ga0307416_100267202 3300032002 Unclassified 1676
216 Ga0307416_100590030 3300032002 Bacteria 1189
217 Ga0307416_100605213 3300032002 Bacteria 1176
218 Ga0307416_101091391 3300032002 Unclassified 902
219 Ga0307414_10036836 3300032004 Bacteria 3270
220 Ga0307414_10087968 3300032004 Bacteria 2298
221 Ga0307414_10132200 3300032004 Bacteria 1939
222 Ga0307414_10399924 3300032004 Bacteria 1193
223 Ga0307414_10415806 3300032004 Bacteria 1171
224 Ga0307414_10856341 3300032004 Unclassified 831
225 Ga0307414_11265818 3300032004 Bacteria 684
226 Ga0307411_10004180 3300032005 Bacteria 6864
227 Ga0307411_10011713 3300032005 Bacteria 4749
228 Ga0307411_10307890 3300032005 Bacteria 1273
229 Ga0307411_10506547 3300032005 Bacteria 1022
230 Ga0307411_10768855 3300032005 Bacteria 845
231 Ga0307415_100000668 3300032126 Bacteria 15179
232 Ga0307415_100001401 3300032126 Bacteria 11512
233 Ga0307415_100003274 3300032126 Bacteria 8234
234 Ga0307415_100005233 3300032126 Bacteria 6863
235 Ga0307415_100008043 3300032126 Bacteria 5818
236 Ga0307415_100009127 3300032126 Bacteria 5539
237 Ga0307415_100017400 3300032126 Bacteria 4309
238 Ga0307415_100119711 3300032126 Bacteria 1971
239 Ga0307415_100203500 3300032126 Bacteria 1573
240 Ga0307415_100209919 3300032126 Unclassified 1552
241 Ga0307415_100460942 3300032126 Bacteria 1101
242 Ga0307415_100490377 3300032126 Bacteria 1072
243 Ga0307415_100643407 3300032126 Unclassified 949
244 Ga0307415_100653221 3300032126 Bacteria 943
245 Ga0307415_100658771 3300032126 Bacteria 939
246 Ga0395900_0038978 3300037418 Bacteria 4898
247 Ga0395900_0052992 3300037418 Bacteria 4176
248 Ga0395900_0103283 3300037418 Bacteria 2928
249 Ga0395900_0152842 3300037418 Bacteria 2358
250 Ga0395898_0198107 3300037466 Bacteria 1918
251 Ga0395898_0224801 3300037466 Unclassified 1790
252 Ga0395898_0574275 3300037466 Bacteria 1070
253 Ga0395898_0935186 3300037466 Bacteria 804
254 Ga0395898_1049585 3300037466 Bacteria 749
255 Ga0395905_0284056 3300037471 Bacteria 1541
256 Ga0395905_0790417 3300037471 Unclassified 852
257 Ga0395905_1352333 3300037471 Bacteria 616
258 Ga0395901_0001965 3300038443 Bacteria 21142
259 Ga0395901_0109130 3300038443 Bacteria 2905
260 Ga0395901_0212165 3300038443 Bacteria 2026
261 Ga0395901_0670957 3300038443 Bacteria 1037
262 Ga0439443_009184 3300042003 Unclassified 1413
263 Ga0439443_090018 3300042003 Unclassified 578
264 Ga0439448_0009822 3300042005 Bacteria 2827
265 Ga0439448_0012030 3300042005 Bacteria 2584
266 Ga0439448_0015429 3300042005 Bacteria 2314
267 Ga0439448_0015689 3300042005 Unclassified 2297
268 Ga0439448_0096445 3300042005 Bacteria 1002
269 Ga0439448_0133814 3300042005 Bacteria 856
270 Ga0439450_000592 3300042008 Bacteria 4797
271 Ga0439450_035225 3300042008 Bacteria 1141
272 Ga0439450_110941 3300042008 Bacteria 701
273 Ga0439454_001013 3300042011 Unclassified 2533
274 Ga0439455_0000847 3300042012 Bacteria 4681
275 Ga0439456_004836 3300042013 Bacteria 2730
276 Ga0439456_108908 3300042013 Bacteria 630
277 Ga0439463_001721 3300042016 Bacteria 5712
278 Ga0439463_029156 3300042016 Bacteria 1390
279 Ga0439463_091356 3300042016 Bacteria 783
280 Ga0450913_016551 3300042117 Bacteria 645
281 Ga0450914_009041 3300042118 Bacteria 937
282 Ga0450917_006753 3300042120 Bacteria 869
283 Ga0450900_008109 3300042136 Bacteria 1306
284 Ga0450902_004077 3300042137 Unclassified 2165
285 Ga0450902_009443 3300042137 Bacteria 1536
286 Ga0450905_009992 3300042142 Bacteria 1310
287 Ga0439458_0124300 3300042157 Bacteria 681
288 Ga0439435_0171462 3300042436 Bacteria 705
289 Ga0439444_0023010 3300042437 Bacteria 1115
290 Ga0439444_0026760 3300042437 Bacteria 1057
291 Ga0439459_0013073 3300042438 Bacteria 1488
292 Ga0439459_0020428 3300042438 Unclassified 1264
293 Ga0439459_0051966 3300042438 Unclassified 903
294 Ga0439464_0004119 3300042439 Bacteria 3699
295 Ga0439464_0004347 3300042439 Bacteria 3624
296 Ga0439464_0020983 3300042439 Bacteria 1791
297 Ga0439464_0059872 3300042439 Bacteria 1113
298 Ga0439464_0145256 3300042439 Unclassified 740
299 Ga0439460_0006675 3300042461 Bacteria 2867
300 Ga0450916_003889 3300042530 Unclassified 1660
301 Ga0450916_026494 3300042530 Bacteria 824
302 Ga0450901_024237 3300042533 Bacteria 658
303 Ga0439440_0013886 3300042993 Bacteria 1733
304 Ga0439440_0014640 3300042993 Bacteria 1695
305 Ga0439440_0020557 3300042993 Bacteria 1481
306 Ga0495584_0280396 3300046491 Bacteria 847
307 Ga0495596_0254026 3300046500 Bacteria 682
308 Ga0495607_0399982 3300046501 Bacteria 625
309 Ga0495644_0248932 3300046523 Bacteria 690
310 Ga0495663_0030419 3300046525 Bacteria 1600
311 Ga0495589_0291876 3300046794 Bacteria 757
312 Ga0495589_0421689 3300046794 Bacteria 612
313 Ga0496108_0394833 3300048911 Bacteria 1208
314 Ga0496109_0233131 3300048912 Bacteria 1732
315 Ga0496109_0982474 3300048912 Bacteria 782
316 Ga0496110_0557360 3300048913 Bacteria 1041
317 Ga0501031_0015963 3300049568 Bacteria 4875
318 Ga0501031_0057509 3300049568 Bacteria 2534
319 Ga0501031_0061204 3300049568 Bacteria 2453
320 Ga0501032_0035699 3300049569 Bacteria 3397
321 Ga0501032_0080723 3300049569 Bacteria 2164
322 Ga0501033_0015016 3300049570 Bacteria 5879
323 Ga0501033_0015984 3300049570 Bacteria 5685
324 Ga0501033_0155939 3300049570 Bacteria 1645
325 Ga0501034_0174053 3300049571 Bacteria 2119
326 Ga0501036_0000787 3300049572 Bacteria 23494
327 Ga0501036_0056122 3300049572 Bacteria 3337
328 Ga0501036_0225583 3300049572 Bacteria 1572
329 Ga0501037_0071125 3300049573 Bacteria 2531
330 Ga0501037_0130865 3300049573 Bacteria 1799
331 Ga0501037_0144394 3300049573 Bacteria 1702
332 Ga0501038_0005187 3300049574 Bacteria 12117
333 Ga0501038_0008944 3300049574 Bacteria 9187
334 Ga0501038_0013322 3300049574 Bacteria 7499
335 Ga0501038_0050825 3300049574 Bacteria 3581
336 Ga0501038_0380808 3300049574 Bacteria 1094
337 Ga0501039_0000677 3300049575 Bacteria 24598
338 Ga0501039_0004745 3300049575 Bacteria 10293
339 Ga0501039_0095210 3300049575 Bacteria 2321
340 Ga0501039_0140149 3300049575 Bacteria 1899
341 Ga0501040_0002615 3300049576 Bacteria 11604
342 Ga0501040_0003346 3300049576 Bacteria 10361
343 Ga0501040_0014999 3300049576 Bacteria 5119
344 Ga0501040_0032971 3300049576 Bacteria 3506
345 Ga0501040_0040015 3300049576 Bacteria 3189
346 Ga0501041_0001267 3300049577 Bacteria 13879
347 Ga0501041_0001907 3300049577 Bacteria 11681
348 Ga0501041_0005945 3300049577 Bacteria 7137
349 Ga0501042_0000288 3300049578 Bacteria 24839
350 Ga0501042_0002863 3300049578 Bacteria 10694
351 Ga0501042_0003633 3300049578 Bacteria 9729
352 Ga0501042_0099836 3300049578 Bacteria 2086
353 Ga0501042_0202379 3300049578 Bacteria 1431
354 Ga0501043_0049919 3300049579 Bacteria 3289
355 Ga0501043_0052589 3300049579 Bacteria 3198
356 Ga0501046_0013029 3300049580 Bacteria 7056
357 Ga0501046_0013160 3300049580 Bacteria 7020
358 Ga0501046_0017595 3300049580 Bacteria 5961
359 Ga0501046_0133996 3300049580 Bacteria 1877
360 Ga0501046_0476770 3300049580 Bacteria 895
361 Ga0501047_0176687 3300049581 Bacteria 2003
362 Ga0501047_0292653 3300049581 Bacteria 1472
363 Ga0501048_0000481 3300049582 Bacteria 27939
364 Ga0501048_0004449 3300049582 Bacteria 10672
365 Ga0501048_0007140 3300049582 Bacteria 8489
366 Ga0501048_0021370 3300049582 Bacteria 4738
367 Ga0501048_0092111 3300049582 Bacteria 2137
368 Ga0501068_0037991 3300049584 Bacteria 2883
369 Ga0501068_0067368 3300049584 Bacteria 2181
370 Ga0501068_0093514 3300049584 Bacteria 1857
371 Ga0501069_0081014 3300049585 Bacteria 1828
372 Ga0501069_0401613 3300049585 Bacteria 811
373 Ga0501070_0014668 3300049586 Bacteria 6594
374 Ga0501070_0303086 3300049586 Bacteria 1301
375 Ga0501071_0000131 3300049587 Bacteria 30323
376 Ga0501071_0005068 3300049587 Bacteria 8428
377 Ga0501071_0045737 3300049587 Bacteria 3142
378 Ga0501071_0077091 3300049587 Bacteria 2434
379 Ga0501072_0000411 3300049588 Bacteria 30561
380 Ga0501072_0022320 3300049588 Bacteria 4910
381 Ga0501072_0047105 3300049588 Bacteria 3395
382 Ga0501072_0070923 3300049588 Bacteria 2752
383 Ga0501072_0214089 3300049588 Bacteria 1535
384 Ga0501073_0034906 3300049589 Bacteria 3577
385 Ga0501073_0088270 3300049589 Bacteria 2156
386 Ga0501073_0624631 3300049589 Bacteria 744
387 Ga0501074_0024983 3300049590 Bacteria 4340
388 Ga0501074_0056839 3300049590 Bacteria 2819
389 Ga0501074_0084940 3300049590 Bacteria 2268
390 Ga0501075_0005285 3300049591 Bacteria 8825
391 Ga0501075_0006207 3300049591 Bacteria 8213
392 Ga0501075_0009244 3300049591 Bacteria 6891
393 Ga0501075_0078508 3300049591 Bacteria 2498
394 Ga0501076_0000661 3300049592 Bacteria 22080
395 Ga0501076_0002186 3300049592 Bacteria 13393
396 Ga0501076_0004187 3300049592 Bacteria 10215
397 Ga0501076_0006316 3300049592 Bacteria 8587
398 Ga0501076_0063001 3300049592 Bacteria 2954
399 Ga0501077_0010653 3300049593 Bacteria 5725
400 Ga0501077_0025140 3300049593 Bacteria 3782
401 Ga0501077_0027676 3300049593 Bacteria 3599
402 Ga0501077_0029299 3300049593 Bacteria 3500
403 Ga0501079_0000102 3300049741 Bacteria 43417
404 Ga0501079_0002292 3300049741 Bacteria 13836
405 Ga0501079_0004369 3300049741 Bacteria 10477
406 Ga0501079_0039019 3300049741 Bacteria 3662
407 Ga0501079_0095270 3300049741 Bacteria 2306
408 Ga0501080_0050764 3300049742 Bacteria 3860
409 Ga0501080_0079052 3300049742 Bacteria 3058
410 Ga0501080_0206499 3300049742 Bacteria 1801
411 Ga0501080_0370041 3300049742 Bacteria 1292
412 Ga0501081_0004922 3300049743 Bacteria 8588
413 Ga0501081_0005271 3300049743 Bacteria 8334
414 Ga0501081_0007523 3300049743 Bacteria 7064
415 Ga0501081_0014371 3300049743 Bacteria 5221
416 Ga0501081_0312211 3300049743 Bacteria 1154
417 Ga0501083_0070826 3300049744 Bacteria 2318
418 Ga0501083_0324518 3300049744 Bacteria 1001
419 Ga0501035_0045882 3300049822 Bacteria 3931
420 Ga0501035_0093705 3300049822 Bacteria 2642
421 Ga0501035_0153831 3300049822 Bacteria 1994
422 Ga0501035_0274665 3300049822 Bacteria 1425
423 Ga0501035_0651980 3300049822 Bacteria 853
424 Ga0501044_0279960 3300049823 Bacteria 1602
425 Ga0501045_0001824 3300049824 Bacteria 14375
426 Ga0501045_0003893 3300049824 Bacteria 10278
427 Ga0501045_0047242 3300049824 Bacteria 3135
428 Ga0501045_0119853 3300049824 Bacteria 1953
429 nmdc:mga05p37_327674_c1 3300050507 Bacteria 1810
430 nmdc:mga05p37_56249_c1 3300050507 Bacteria 4843
431 nmdc:mga05p37_862649_c1 3300050507 Unclassified 982
432 nmdc:mga0qj67_82915_c1 3300050509 Bacteria 2571
433 nmdc:mga06r32_215548_c1 3300050510 Bacteria 1908
434 nmdc:mga08y16_220033_c1 3300050511 Bacteria 1966
435 nmdc:mga08y16_29092_c1 3300050511 Bacteria 5823
436 nmdc:mga08y16_360545_c1 3300050511 Bacteria 1492
437 nmdc:mga08y16_368675_c1 3300050511 Bacteria 1473
438 nmdc:mga08y16_75471_c1 3300050511 Bacteria 3514
439 nmdc:mga0n895_13975_c1 3300050512 Bacteria 7271
440 nmdc:mga0n895_36080_c1 3300050512 Bacteria 4772
441 nmdc:mga0rr50_312268_c1 3300050513 Unclassified 1317
442 nmdc:mga0a205_33857_c1 3300050515 Bacteria 4900
443 nmdc:mga0a205_8059_c1 3300050515 Bacteria 9576
444 Ga0495655_0102668 3300053083 Bacteria 849
445 Ga0495655_0255566 3300053083 Bacteria 590
446 Ga0501084_0000414 3300054114 Bacteria 33024
447 Ga0501084_0007377 3300054114 Bacteria 9062
448 Ga0501084_0020833 3300054114 Bacteria 5468
449 Ga0501084_0029650 3300054114 Bacteria 4577
450 Ga0501084_0452376 3300054114 Bacteria 1085
451 Ga0590071_004647 3300059421 Bacteria 3321
452 Ga0590071_131556 3300059421 Bacteria 643
453 Ga0590075_001691 3300059424 Bacteria 5422
454 Ga0590077_021779 3300059426 Bacteria 1366
455 Ga0501082_0000474 3300060353 Bacteria 35497
456 Ga0501082_0020220 3300060353 Bacteria 5738
457 Ga0501082_0099716 3300060353 Bacteria 2511
458 Ga0530510_0000576 3300061734 Bacteria 23667
459 Ga0530510_0007507 3300061734 Bacteria 7595
460 Ga0530510_0030193 3300061734 Bacteria 3892
461 Ga0105245_10060061
462 JGI25406J46586_10004822
463 JGI25406J46586_10052300
464 JGI25407J50210_10011438
465 JGI25407J50210_10012332
466 JGI25407J50210_10016022
467 JGI25407J50210_10023816
468 JGI25407J50210_10026554
469 JGI25407J50210_10097646
470 JGI25407J50210_10099748
471 JGI25407J50210_10102723
472 JGI25407J50210_10119178
473 Ga0070676_10368913
474 Ga0070676_10921245
475 Ga0070682_100469732
476 Ga0070661_100896338
477 Ga0070668_100185624
478 Ga0070674_100140001
479 Ga0070659_100175995
480 Ga0070700_100093364
481 Ga0070663_100599733
482 Ga0070678_100675222
483 Ga0070662_100177174
484 Ga0070662_100387322
485 Ga0068867_100277688
486 Ga0070684_100357494
487 Ga0070665_100561281
488 Ga0070664_100202959
489 Ga0070664_100206893
490 Ga0070664_100542694
491 Ga0068857_101009738
492 Ga0068854_100320543
493 Ga0068854_100492591
494 Ga0070702_100737403
495 Ga0068864_101373079
496 Ga0068861_100204539
497 Ga0068861_100387269
498 Ga0068862_101343734
499 Ga0081455_10035255
500 Ga0081455_10065193
501 Ga0081455_10541153
502 Ga0081538_10000517
503 Ga0081538_10001979
504 Ga0081538_10003192
505 Ga0081538_10003617
506 Ga0081538_10007842
507 Ga0081538_10008425
508 Ga0081538_10014362
509 Ga0081538_10014541
510 Ga0081538_10016087
511 Ga0081538_10021228
512 Ga0081538_10021461
513 Ga0081538_10022405
514 Ga0081538_10027756
515 Ga0081538_10029181
516 Ga0081538_10032794
517 Ga0081538_10033687
518 Ga0081538_10038377
519 Ga0081538_10051783
520 Ga0081538_10059367
521 Ga0081538_10063161
522 Ga0081538_10064731
523 Ga0081538_10154216
524 Ga0081538_10167565
525 Ga0081538_10218562
526 Ga0081540_1022650
527 Ga0081539_10002553
528 Ga0081539_10003404
529 Ga0081539_10003764
530 Ga0081539_10009333
531 Ga0081539_10063444
532 Ga0081539_10089012
533 Ga0081539_10142458
534 Ga0081539_10231696
535 Ga0075432_10024118
536 Ga0075428_100735798
537 Ga0075428_100915858
538 Ga0075428_101003755
539 Ga0075428_101368633
540 Ga0075430_100024681
541 Ga0075431_100287633
542 Ga0075433_10013824
543 Ga0075433_10032833
544 Ga0075434_100007620
545 Ga0075434_100057631
546 Ga0075429_100351497
547 Ga0075435_100305882
548 Ga0111539_10044738
549 Ga0111539_10076964
550 Ga0111539_10125649
551 Ga0111539_10360368
552 Ga0111539_11119040
553 Ga0111539_12487682
554 Ga0105245_10700548
555 Ga0114129_10012071
556 Ga0114129_10492970
557 Ga0114129_10808542
558 Ga0105248_12163527
559 Ga0105249_10252511
560 Ga0105239_10295331
561 Ga0163162_10293295
562 Ga0182008_10149710
563 Ga0157379_10545256
564 Ga0207688_10137922
565 Ga0207705_10465361
566 Ga0207657_10319265
567 Ga0207659_10376988
568 Ga0207687_10528910
569 Ga0207690_10940123
570 Ga0207706_10013703
571 Ga0207706_10020732
572 Ga0207709_10380539
573 Ga0207661_10443379
574 Ga0207661_11270802
575 Ga0207679_10227543
576 Ga0207679_10242920
577 Ga0207712_10344942
578 Ga0207668_10718290
579 Ga0207640_10090961
580 Ga0207640_10822447
581 Ga0207678_10223272
582 Ga0207708_10592863
583 Ga0207648_10209376
584 Ga0207648_10393533
585 Ga0207676_10832885
586 Ga0207674_10626353
587 Ga0207675_100032765
588 Ga0207675_100342695
589 Ga0207675_100979741
590 Ga0207698_11192517
591 Ga0207428_10008257
592 Ga0207428_10113535
593 Ga0207428_10454875
594 Ga0268266_11356554
595 Ga0307408_100039693
596 Ga0307408_100175913
597 Ga0307408_100248464
598 Ga0307408_100260001
599 Ga0307408_100291447
600 Ga0307408_100382819
601 Ga0307408_100620591
602 Ga0307405_10012918
603 Ga0307405_10017930
604 Ga0307405_10037756
605 Ga0307405_10111777
606 Ga0307405_10117778
607 Ga0307405_10300609
608 Ga0307405_10444846
609 Ga0307405_10450726
610 Ga0307413_10011755
611 Ga0307413_10012860
612 Ga0307413_10018590
613 Ga0307413_10050358
614 Ga0307413_10089226
615 Ga0307413_10212641
616 Ga0307413_11907458
617 Ga0307410_10020371
618 Ga0307410_10041653
619 Ga0307410_10043157
620 Ga0307410_10050551
621 Ga0307410_10223062
622 Ga0307410_10226632
623 Ga0307410_10347294
624 Ga0307410_10475728
625 Ga0307410_11123120
626 Ga0307406_10002539
627 Ga0307406_10040348
628 Ga0307406_10065140
629 Ga0307406_10111825
630 Ga0307406_10150265
631 Ga0307406_10197856
632 Ga0307406_10259904
633 Ga0307406_10354387
634 Ga0307406_10471911
635 Ga0307406_10723156
636 Ga0307406_11218446
637 Ga0307406_11903034
638 Ga0307407_10001466
639 Ga0307407_10003346
640 Ga0307407_10005504
641 Ga0307407_10021625
642 Ga0307407_10180641
643 Ga0307412_10014802
644 Ga0307412_10046217
645 Ga0307412_10176805
646 Ga0307412_10304015
647 Ga0307412_10323991
648 Ga0307412_11108424
649 Ga0307409_100000251
650 Ga0307409_100000332
651 Ga0307409_100008958
652 Ga0307409_100034543
653 Ga0307409_100076522
654 Ga0307409_100079058
655 Ga0307409_100095002
656 Ga0307409_100128508
657 Ga0307409_100177640
658 Ga0307409_100185628
659 Ga0307409_100793851
660 Ga0307409_100796203
661 Ga0307409_100821157
662 Ga0307409_101028329
663 Ga0307409_101308157
664 Ga0307409_102340876
665 Ga0307416_100001100
666 Ga0307416_100009077
667 Ga0307416_100011100
668 Ga0307416_100044339
669 Ga0307416_100049427
670 Ga0307416_100051565
671 Ga0307416_100061081
672 Ga0307416_100119020
673 Ga0307416_100205463
674 Ga0307416_100250804
675 Ga0307416_100267202
676 Ga0307416_100590030
677 Ga0307416_100605213
678 Ga0307416_101091391
679 Ga0307414_10036836
680 Ga0307414_10087968
681 Ga0307414_10132200
682 Ga0307414_10399924
683 Ga0307414_10415806
684 Ga0307414_10856341
685 Ga0307414_11265818
686 Ga0307411_10004180
687 Ga0307411_10011713
688 Ga0307411_10307890
689 Ga0307411_10506547
690 Ga0307411_10768855
691 Ga0307415_100000668
692 Ga0307415_100001401
693 Ga0307415_100003274
694 Ga0307415_100005233
695 Ga0307415_100008043
696 Ga0307415_100009127
697 Ga0307415_100017400
698 Ga0307415_100119711
699 Ga0307415_100203500
700 Ga0307415_100209919
701 Ga0307415_100460942
702 Ga0307415_100490377
703 Ga0307415_100643407
704 Ga0307415_100653221
705 Ga0307415_100658771
706 Ga0395900_0038978
707 Ga0395900_0052992
708 Ga0395900_0103283
709 Ga0395900_0152842
710 Ga0395898_0198107
711 Ga0395898_0224801
712 Ga0395898_0574275
713 Ga0395898_0935186
714 Ga0395898_1049585
715 Ga0395905_0284056
716 Ga0395905_0790417
717 Ga0395905_1352333
718 Ga0395901_0001965
719 Ga0395901_0109130
720 Ga0395901_0212165
721 Ga0395901_0670957
722 Ga0439443_009184
723 Ga0439443_090018
724 Ga0439448_0009822
725 Ga0439448_0012030
726 Ga0439448_0015429
727 Ga0439448_0015689
728 Ga0439448_0096445
729 Ga0439448_0133814
730 Ga0439450_000592
731 Ga0439450_035225
732 Ga0439450_110941
733 Ga0439454_001013
734 Ga0439455_0000847
735 Ga0439456_004836
736 Ga0439456_108908
737 Ga0439463_001721
738 Ga0439463_029156
739 Ga0439463_091356
740 Ga0450913_016551
741 Ga0450914_009041
742 Ga0450917_006753
743 Ga0450900_008109
744 Ga0450902_004077
745 Ga0450902_009443
746 Ga0450905_009992
747 Ga0439458_0124300
748 Ga0439435_0171462
749 Ga0439444_0023010
750 Ga0439444_0026760
751 Ga0439459_0013073
752 Ga0439459_0020428
753 Ga0439459_0051966
754 Ga0439464_0004119
755 Ga0439464_0004347
756 Ga0439464_0020983
757 Ga0439464_0059872
758 Ga0439464_0145256
759 Ga0439460_0006675
760 Ga0450916_003889
761 Ga0450916_026494
762 Ga0450901_024237
763 Ga0439440_0013886
764 Ga0439440_0014640
765 Ga0439440_0020557
766 Ga0495584_0280396
767 Ga0495596_0254026
768 Ga0495607_0399982
769 Ga0495644_0248932
770 Ga0495663_0030419
771 Ga0495589_0291876
772 Ga0495589_0421689
773 Ga0496108_0394833
774 Ga0496109_0233131
775 Ga0496109_0982474
776 Ga0496110_0557360
777 Ga0501031_0015963
778 Ga0501031_0057509
779 Ga0501031_0061204
780 Ga0501032_0035699
781 Ga0501032_0080723
782 Ga0501033_0015016
783 Ga0501033_0015984
784 Ga0501033_0155939
785 Ga0501034_0174053
786 Ga0501036_0000787
787 Ga0501036_0056122
788 Ga0501036_0225583
789 Ga0501037_0071125
790 Ga0501037_0130865
791 Ga0501037_0144394
792 Ga0501038_0005187
793 Ga0501038_0008944
794 Ga0501038_0013322
795 Ga0501038_0050825
796 Ga0501038_0380808
797 Ga0501039_0000677
798 Ga0501039_0004745
799 Ga0501039_0095210
800 Ga0501039_0140149
801 Ga0501040_0002615
802 Ga0501040_0003346
803 Ga0501040_0014999
804 Ga0501040_0032971
805 Ga0501040_0040015
806 Ga0501041_0001267
807 Ga0501041_0001907
808 Ga0501041_0005945
809 Ga0501042_0000288
810 Ga0501042_0002863
811 Ga0501042_0003633
812 Ga0501042_0099836
813 Ga0501042_0202379
814 Ga0501043_0049919
815 Ga0501043_0052589
816 Ga0501046_0013029
817 Ga0501046_0013160
818 Ga0501046_0017595
819 Ga0501046_0133996
820 Ga0501046_0476770
821 Ga0501047_0176687
822 Ga0501047_0292653
823 Ga0501048_0000481
824 Ga0501048_0004449
825 Ga0501048_0007140
826 Ga0501048_0021370
827 Ga0501048_0092111
828 Ga0501068_0037991
829 Ga0501068_0067368
830 Ga0501068_0093514
831 Ga0501069_0081014
832 Ga0501069_0401613
833 Ga0501070_0014668
834 Ga0501070_0303086
835 Ga0501071_0000131
836 Ga0501071_0005068
837 Ga0501071_0045737
838 Ga0501071_0077091
839 Ga0501072_0000411
840 Ga0501072_0022320
841 Ga0501072_0047105
842 Ga0501072_0070923
843 Ga0501072_0214089
844 Ga0501073_0034906
845 Ga0501073_0088270
846 Ga0501073_0624631
847 Ga0501074_0024983
848 Ga0501074_0056839
849 Ga0501074_0084940
850 Ga0501075_0005285
851 Ga0501075_0006207
852 Ga0501075_0009244
853 Ga0501075_0078508
854 Ga0501076_0000661
855 Ga0501076_0002186
856 Ga0501076_0004187
857 Ga0501076_0006316
858 Ga0501076_0063001
859 Ga0501077_0010653
860 Ga0501077_0025140
861 Ga0501077_0027676
862 Ga0501077_0029299
863 Ga0501079_0000102
864 Ga0501079_0002292
865 Ga0501079_0004369
866 Ga0501079_0039019
867 Ga0501079_0095270
868 Ga0501080_0050764
869 Ga0501080_0079052
870 Ga0501080_0206499
871 Ga0501080_0370041
872 Ga0501081_0004922
873 Ga0501081_0005271
874 Ga0501081_0007523
875 Ga0501081_0014371
876 Ga0501081_0312211
877 Ga0501083_0070826
878 Ga0501083_0324518
879 Ga0501035_0045882
880 Ga0501035_0093705
881 Ga0501035_0153831
882 Ga0501035_0274665
883 Ga0501035_0651980
884 Ga0501044_0279960
885 Ga0501045_0001824
886 Ga0501045_0003893
887 Ga0501045_0047242
888 Ga0501045_0119853
889 nmdc:mga05p37_327674_c1
890 nmdc:mga05p37_56249_c1
891 nmdc:mga05p37_862649_c1
892 nmdc:mga0qj67_82915_c1
893 nmdc:mga06r32_215548_c1
894 nmdc:mga08y16_220033_c1
895 nmdc:mga08y16_29092_c1
896 nmdc:mga08y16_360545_c1
897 nmdc:mga08y16_368675_c1
898 nmdc:mga08y16_75471_c1
899 nmdc:mga0n895_13975_c1
900 nmdc:mga0n895_36080_c1
901 nmdc:mga0rr50_312268_c1
902 nmdc:mga0a205_33857_c1
903 nmdc:mga0a205_8059_c1
904 Ga0495655_0102668
905 Ga0495655_0255566
906 Ga0501084_0000414
907 Ga0501084_0007377
908 Ga0501084_0020833
909 Ga0501084_0029650
910 Ga0501084_0452376
911 Ga0590071_004647
912 Ga0590071_131556
913 Ga0590075_001691
914 Ga0590077_021779
915 Ga0501082_0000474
916 Ga0501082_0020220
917 Ga0501082_0099716
918 Ga0530510_0000576
919 Ga0530510_0007507
920 Ga0530510_0030193

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dgy-assembly1.cif.gz_A de novo designed protein h4c2r 0.6437 85 155
6r7h-assembly1.cif.gz_O structural basis of cullin-2 ring e3 ligase regulation by the cop9 signalosome 0.4606 34 155
7dgy-assembly1.cif.gz_A de novo designed protein h4c2r 0.4447 85 155
7b0u-assembly1.cif.gz_A stressosome complex from listeria innocua 0.431 36 154
7oom-assembly1.cif.gz_A n-terminal domain of flsp spidroin from nephila clavipes 0.3754 6 155
ID Description Score Start End Superfamily
4jgiB01 Mainly Alpha;Orthogonal Bundle;Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1;Methionine synthase domain 0.5233 89 156 1.10.1240.10
af_A4HWY4_190_296_1.25.40.90 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.4996 77 154 1.25.40.90
af_A1Z9P3_1388_1576_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4987 7 154 1.10.287.1490
af_M0RB44_648_833_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4566 4 156 1.10.287.1490
af_Q5SX79_610_798_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4435 5 152 1.10.287.1490
ID Description Score Start End GO Terms
AF-A0A0Q8UB11-F1-model_v4 Uncharacterized protein 0.9766 1 153
AF-A0A7Y9E852-F1-model_v4 Uncharacterized protein 0.968 1 154
AF-A0A0Q8UB11-F1-model_v4 Uncharacterized protein 0.952 1 153
AF-A0A7Y9E852-F1-model_v4 Uncharacterized protein 0.9499 1 154
AF-A0A160T3D8-F1-model_v4 LysM domain-containing protein 0.8873 2 153

Map