F448453

General Info

Members Datasets Scaffolds Average Seq Length
459 275 918 218

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_703332_c1|nmdc:mga0n895_703332_c1_39_812
Length 257
Sequence LISCRQTTSARCAAIQGNSPLLTAERMPFKFSVIIRNGACGLDFRQEFIEYALAQHVLRFGEFITKAGRSSPYFFNAGLFHDGAALHRLGQFYAKAITASGIEFDQLFGPAYKGIPLVTAAAMGLAENGRNVPISFNRKEIKDHGEGGQLIGAPLTGRTLIVDDVISAGTSVRESIDIIARAGGTPCGVVIALDRMERGTGTLSAVQEVRETFGLPVASIATLDDLVEFLRGRDGMARELQRVGLYRSQYGVQEHAS

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
150 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
160 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
161 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
165 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
166 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
171 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
172 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
173 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
174 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
175 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
185 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
189 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
190 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
193 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
210 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
244 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
245 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
249 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
250 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
251 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
252 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
253 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
254 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
255 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
256 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
257 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
258 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
259 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
260 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
261 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
262 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
263 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
264 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
265 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
266 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
267 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
268 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
269 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
270 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
271 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
272 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
273 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
274 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
275 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.9
Metatranscriptomes 0.22
Isolates 5.88

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 1.09
Nodule 0
Rhizoplane 2.18
Rhizosphere 92.59
Stem 0
Stem Tuber 0
Unclassified 0.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_703332_c1 3300050512 Bacteria 1006
2 Ga0065712_10097950 3300005290 Bacteria 2134
3 Ga0070658_10025343 3300005327 Bacteria 4756
4 Ga0070676_10201579 3300005328 Bacteria 1304
5 Ga0070683_100003177 3300005329 Bacteria 13256
6 Ga0070670_100023010 3300005331 Bacteria 5361
7 Ga0070677_10013323 3300005333 Bacteria 2874
8 Ga0070677_10206312 3300005333 Bacteria 951
9 Ga0068869_100044684 3300005334 Bacteria 3186
10 Ga0068869_100148343 3300005334 Bacteria 1817
11 Ga0068869_100378661 3300005334 Bacteria 1159
12 Ga0070666_10013759 3300005335 Bacteria 5138
13 Ga0068868_100003334 3300005338 Bacteria 11172
14 Ga0068868_100032341 3300005338 Bacteria 4024
15 Ga0068868_100166419 3300005338 Bacteria 1824
16 Ga0068868_100787351 3300005338 Bacteria 857
17 Ga0070689_100035273 3300005340 Bacteria 3821
18 Ga0070689_100061893 3300005340 Bacteria 2911
19 Ga0070689_100100868 3300005340 Bacteria 2284
20 Ga0070689_100687036 3300005340 Bacteria 893
21 Ga0070661_100001429 3300005344 Bacteria 16602
22 Ga0070661_100262685 3300005344 Bacteria 1335
23 Ga0070661_100312983 3300005344 Bacteria 1225
24 Ga0070692_10027806 3300005345 Bacteria 2807
25 Ga0070668_100048990 3300005347 Bacteria 3250
26 Ga0070675_100025860 3300005354 Bacteria 4707
27 Ga0070675_100117917 3300005354 Bacteria 2253
28 Ga0070675_100305903 3300005354 Bacteria 1402
29 Ga0070675_100336004 3300005354 Bacteria 1337
30 Ga0070675_100614362 3300005354 Bacteria 986
31 Ga0070671_100001144 3300005355 Bacteria 19755
32 Ga0070671_100230290 3300005355 Bacteria 1572
33 Ga0070674_100053403 3300005356 Bacteria 2790
34 Ga0070674_100088802 3300005356 Bacteria 2225
35 Ga0070673_100022353 3300005364 Bacteria 4601
36 Ga0070673_100080904 3300005364 Bacteria 2633
37 Ga0070673_100218548 3300005364 Bacteria 1648
38 Ga0070688_100064078 3300005365 Bacteria 2331
39 Ga0070688_100092235 3300005365 Bacteria 1981
40 Ga0070688_100231016 3300005365 Bacteria 1308
41 Ga0070659_100118693 3300005366 Bacteria 2140
42 Ga0070659_100442717 3300005366 Bacteria 1101
43 Ga0070667_100027069 3300005367 Bacteria 4770
44 Ga0070667_100251027 3300005367 Bacteria 1581
45 Ga0070703_10115503 3300005406 Bacteria 966
46 Ga0070701_10191876 3300005438 Bacteria 1202
47 Ga0070700_100027327 3300005441 Bacteria 3382
48 Ga0070700_100181779 3300005441 Bacteria 1464
49 Ga0070694_100065541 3300005444 Bacteria 2489
50 Ga0070694_100170994 3300005444 Bacteria 1601
51 Ga0070678_100160581 3300005456 Bacteria 1820
52 Ga0070662_100072339 3300005457 Bacteria 2545
53 Ga0070662_100102281 3300005457 Bacteria 2170
54 Ga0070662_100747970 3300005457 Bacteria 829
55 Ga0068867_100042712 3300005459 Bacteria 3318
56 Ga0070685_10136733 3300005466 Bacteria 1538
57 Ga0070685_10158925 3300005466 Bacteria 1439
58 Ga0070699_100563758 3300005518 Bacteria 1037
59 Ga0070684_100053863 3300005535 Bacteria 3504
60 Ga0070684_100074610 3300005535 Bacteria 2990
61 Ga0068853_100130734 3300005539 Bacteria 2247
62 Ga0068853_100133788 3300005539 Bacteria 2221
63 Ga0070672_100001750 3300005543 Bacteria 13591
64 Ga0070686_100157879 3300005544 Bacteria 1594
65 Ga0070686_100158165 3300005544 Bacteria 1593
66 Ga0070696_100587907 3300005546 Bacteria 896
67 Ga0070693_100038548 3300005547 Bacteria 2671
68 Ga0070693_100326764 3300005547 Bacteria 1042
69 Ga0070665_100058907 3300005548 Bacteria 3850
70 Ga0070665_100307379 3300005548 Bacteria 1589
71 Ga0070665_100438360 3300005548 Bacteria 1316
72 Ga0070704_100009095 3300005549 Bacteria 5993
73 Ga0068855_100014417 3300005563 Bacteria 9515
74 Ga0068855_100021177 3300005563 Bacteria 7793
75 Ga0070664_100000701 3300005564 Bacteria 25591
76 Ga0070664_100084049 3300005564 Bacteria 2747
77 Ga0070664_100737965 3300005564 Bacteria 919
78 Ga0068857_100149204 3300005577 Bacteria 2117
79 Ga0068854_100008673 3300005578 Bacteria 6545
80 Ga0068854_100984324 3300005578 Bacteria 746
81 Ga0068856_100036980 3300005614 Bacteria 4788
82 Ga0068856_100046756 3300005614 Bacteria 4263
83 Ga0068856_100646795 3300005614 Bacteria 1078
84 Ga0070702_100248821 3300005615 Bacteria 1204
85 Ga0070702_100448448 3300005615 Bacteria 935
86 Ga0068852_100026121 3300005616 Bacteria 4742
87 Ga0068852_100236759 3300005616 Bacteria 1743
88 Ga0068859_100117342 3300005617 Bacteria 2726
89 Ga0068859_100232332 3300005617 Bacteria 1932
90 Ga0068859_100297045 3300005617 Bacteria 1708
91 Ga0068864_100040299 3300005618 Bacteria 3995
92 Ga0068864_100050149 3300005618 Bacteria 3592
93 Ga0068864_100406175 3300005618 Bacteria 1295
94 Ga0068864_100684376 3300005618 Bacteria 1001
95 Ga0068866_10052544 3300005718 Bacteria 2080
96 Ga0068861_100245382 3300005719 Bacteria 1525
97 Ga0068870_10131657 3300005840 Bacteria 1453
98 Ga0068863_100102999 3300005841 Bacteria 2714
99 Ga0068858_100004362 3300005842 Bacteria 13881
100 Ga0068860_100200324 3300005843 Bacteria 1934
101 Ga0068860_100265538 3300005843 Bacteria 1674
102 Ga0068862_100216666 3300005844 Bacteria 1732
103 Ga0081455_10001170 3300005937 Bacteria 32840
104 Ga0075364_10015740 3300006051 Bacteria 4695
105 Ga0070715_10180266 3300006163 Bacteria 1059
106 Ga0097621_100008059 3300006237 Bacteria 7563
107 Ga0097621_100012861 3300006237 Bacteria 6217
108 Ga0097621_100028204 3300006237 Bacteria 4424
109 Ga0097621_100052232 3300006237 Bacteria 3329
110 Ga0068871_100002805 3300006358 Bacteria 11918
111 Ga0068871_100028741 3300006358 Bacteria 4362
112 Ga0068871_100315425 3300006358 Bacteria 1375
113 Ga0075434_100566995 3300006871 Bacteria 1155
114 Ga0068865_100052673 3300006881 Bacteria 2822
115 Ga0068865_100151183 3300006881 Bacteria 1761
116 Ga0068865_100436813 3300006881 Bacteria 1079
117 Ga0097620_100117354 3300006931 Bacteria 2726
118 Ga0097620_100232341 3300006931 Bacteria 1932
119 Ga0097620_100297073 3300006931 Bacteria 1708
120 Ga0075435_100386250 3300007076 Bacteria 1203
121 Ga0105251_10004031 3300009011 Bacteria 10349
122 Ga0105251_10053863 3300009011 Bacteria 1912
123 Ga0105244_10040656 3300009036 Bacteria 2413
124 Ga0105240_10005084 3300009093 Bacteria 19712
125 Ga0105240_10507866 3300009093 Bacteria 1339
126 Ga0111539_10288062 3300009094 Bacteria 1911
127 Ga0105245_10034084 3300009098 Bacteria 4513
128 Ga0105245_10069370 3300009098 Bacteria 3196
129 Ga0105245_10095030 3300009098 Bacteria 2749
130 Ga0105245_10121102 3300009098 Bacteria 2445
131 Ga0105245_10132242 3300009098 Bacteria 2341
132 Ga0105247_10240437 3300009101 Bacteria 1233
133 Ga0105247_10305923 3300009101 Unclassified 1104
134 Ga0114129_10353166 3300009147 Bacteria 1947
135 Ga0105243_10098929 3300009148 Bacteria 2417
136 Ga0105243_10117965 3300009148 Bacteria 2232
137 Ga0105241_10049524 3300009174 Bacteria 3200
138 Ga0105241_10389868 3300009174 Bacteria 1219
139 Ga0105242_10179412 3300009176 Bacteria 1867
140 Ga0105242_10379606 3300009176 Bacteria 1313
141 Ga0105242_10569104 3300009176 Bacteria 1089
142 Ga0105248_10037647 3300009177 Bacteria 5412
143 Ga0105248_10667688 3300009177 Bacteria 1173
144 Ga0105237_10688589 3300009545 Bacteria 1029
145 Ga0105238_10041767 3300009551 Bacteria 4645
146 Ga0105249_10153207 3300009553 Bacteria 2221
147 Ga0105249_10301144 3300009553 Bacteria 1608
148 Ga0105239_10356951 3300010375 Bacteria 1650
149 Ga0105239_10424671 3300010375 Bacteria 1506
150 Ga0105239_11357174 3300010375 Bacteria 820
151 Ga0105246_10102779 3300011119 Bacteria 2084
152 Ga0105246_10376565 3300011119 Bacteria 1171
153 Ga0157373_10354670 3300013100 Bacteria 1046
154 Ga0157371_10038151 3300013102 Bacteria 3438
155 Ga0157370_10004332 3300013104 Bacteria 16314
156 Ga0157370_10240887 3300013104 Bacteria 1673
157 Ga0157369_10007804 3300013105 Bacteria 12317
158 Ga0157369_10145233 3300013105 Bacteria 2509
159 Ga0157374_10001961 3300013296 Bacteria 17262
160 Ga0157374_10159514 3300013296 Bacteria 2197
161 Ga0157374_10172781 3300013296 Bacteria 2108
162 Ga0157378_10026879 3300013297 Bacteria 5075
163 Ga0157378_10061440 3300013297 Bacteria 3353
164 Ga0157378_10170114 3300013297 Bacteria 2043
165 Ga0157378_10308294 3300013297 Bacteria 1534
166 Ga0163162_10035385 3300013306 Bacteria 4975
167 Ga0163162_10096431 3300013306 Bacteria 3046
168 Ga0163162_10120785 3300013306 Bacteria 2724
169 Ga0157372_10081701 3300013307 Bacteria 3658
170 Ga0157375_10003680 3300013308 Bacteria 13309
171 Ga0157375_10121335 3300013308 Bacteria 2723
172 Ga0157375_10155870 3300013308 Bacteria 2422
173 Ga0157377_10047216 3300014745 Bacteria 2412
174 Ga0157377_10048208 3300014745 Bacteria 2389
175 Ga0157379_10057965 3300014968 Bacteria 3461
176 Ga0157379_10184358 3300014968 Bacteria 1886
177 Ga0157376_10007665 3300014969 Bacteria 7730
178 Ga0157376_10030341 3300014969 Bacteria 4317
179 Ga0157376_10512113 3300014969 Unclassified 1181
180 Ga0157376_10609658 3300014969 Bacteria 1087
181 Ga0163161_10228976 3300017792 Bacteria 1442
182 Ga0206356_10645588 3300020070 Bacteria 1096
183 Ga0207666_1006069 3300025271 Bacteria 1559
184 Ga0207697_10023247 3300025315 Bacteria 2538
185 Ga0207655_1059831 3300025728 Bacteria 1480
186 Ga0207713_1004765 3300025735 Bacteria 8718
187 Ga0207653_10112182 3300025885 Bacteria 974
188 Ga0207682_10001584 3300025893 Bacteria 10465
189 Ga0207642_10068167 3300025899 Bacteria 1682
190 Ga0207642_10253961 3300025899 Bacteria 999
191 Ga0207688_10002343 3300025901 Bacteria 10177
192 Ga0207680_10040306 3300025903 Bacteria 2717
193 Ga0207647_10241472 3300025904 Bacteria 1037
194 Ga0207685_10180930 3300025905 Bacteria 977
195 Ga0207645_10026236 3300025907 Bacteria 3766
196 Ga0207643_10011107 3300025908 Bacteria 4860
197 Ga0207705_10037976 3300025909 Bacteria 3447
198 Ga0207705_10116052 3300025909 Bacteria 1982
199 Ga0207654_10050254 3300025911 Bacteria 2395
200 Ga0207654_10438400 3300025911 Bacteria 914
201 Ga0207695_10006155 3300025913 Bacteria 15644
202 Ga0207660_10226012 3300025917 Bacteria 1470
203 Ga0207662_10017453 3300025918 Bacteria 4060
204 Ga0207649_10038772 3300025920 Bacteria 2886
205 Ga0207649_10142744 3300025920 Bacteria 1641
206 Ga0207649_10252842 3300025920 Bacteria 1270
207 Ga0207650_10004814 3300025925 Bacteria 9221
208 Ga0207659_10007788 3300025926 Bacteria 6617
209 Ga0207659_10072092 3300025926 Bacteria 2524
210 Ga0207659_10083150 3300025926 Bacteria 2372
211 Ga0207659_10131858 3300025926 Bacteria 1930
212 Ga0207687_10048878 3300025927 Bacteria 2939
213 Ga0207687_10096153 3300025927 Bacteria 2170
214 Ga0207644_10010320 3300025931 Bacteria 6155
215 Ga0207706_10007731 3300025933 Bacteria 9922
216 Ga0207706_10011863 3300025933 Bacteria 7934
217 Ga0207706_10234306 3300025933 Unclassified 1605
218 Ga0207706_10287526 3300025933 Bacteria 1433
219 Ga0207686_10143145 3300025934 Bacteria 1655
220 Ga0207709_10089551 3300025935 Bacteria 2007
221 Ga0207709_10240662 3300025935 Bacteria 1316
222 Ga0207670_10012370 3300025936 Bacteria 4993
223 Ga0207670_10038693 3300025936 Bacteria 3117
224 Ga0207670_10064301 3300025936 Bacteria 2514
225 Ga0207670_10193311 3300025936 Bacteria 1541
226 Ga0207669_10015011 3300025937 Bacteria 3896
227 Ga0207704_10107068 3300025938 Bacteria 1880
228 Ga0207691_10004456 3300025940 Bacteria 13575
229 Ga0207691_10142730 3300025940 Bacteria 2109
230 Ga0207711_10476530 3300025941 Bacteria 1163
231 Ga0207689_10014402 3300025942 Bacteria 6727
232 Ga0207689_10319412 3300025942 Bacteria 1288
233 Ga0207661_10015309 3300025944 Bacteria 5641
234 Ga0207661_10156055 3300025944 Bacteria 1977
235 Ga0207679_10026031 3300025945 Bacteria 4030
236 Ga0207679_10107745 3300025945 Bacteria 2193
237 Ga0207679_10556518 3300025945 Bacteria 1030
238 Ga0207667_10002749 3300025949 Bacteria 21743
239 Ga0207667_10031384 3300025949 Bacteria 5736
240 Ga0207667_10065744 3300025949 Bacteria 3781
241 Ga0207651_10007776 3300025960 Bacteria 5732
242 Ga0207651_10104329 3300025960 Bacteria 2112
243 Ga0207668_10036473 3300025972 Bacteria 3281
244 Ga0207640_10030714 3300025981 Bacteria 3312
245 Ga0207658_10424720 3300025986 Bacteria 1173
246 Ga0207677_10022298 3300026023 Bacteria 3890
247 Ga0207677_10164536 3300026023 Bacteria 1727
248 Ga0207703_10298610 3300026035 Bacteria 1468
249 Ga0207708_10098512 3300026075 Bacteria 2260
250 Ga0207708_10460169 3300026075 Bacteria 1061
251 Ga0207702_10555939 3300026078 Bacteria 1123
252 Ga0207648_10030972 3300026089 Bacteria 4732
253 Ga0207648_10079551 3300026089 Bacteria 2860
254 Ga0207676_10033534 3300026095 Bacteria 3880
255 Ga0207676_10090372 3300026095 Bacteria 2513
256 Ga0207674_10039716 3300026116 Bacteria 4877
257 Ga0207674_10074117 3300026116 Bacteria 3417
258 Ga0207675_100015862 3300026118 Bacteria 7026
259 Ga0207683_10000544 3300026121 Bacteria 34864
260 Ga0207683_10029595 3300026121 Bacteria 4742
261 Ga0207698_10000379 3300026142 Bacteria 25834
262 Ga0207698_10070389 3300026142 Bacteria 2771
263 Ga0207698_10224260 3300026142 Bacteria 1701
264 Ga0207698_10270298 3300026142 Bacteria 1567
265 Ga0209371_1012989 3300027312 Bacteria 2373
266 Ga0209966_1021780 3300027695 Bacteria 1249
267 Ga0207428_10092290 3300027907 Bacteria 2350
268 Ga0268266_10437907 3300028379 Bacteria 1241
269 Ga0268265_10057759 3300028380 Bacteria 2959
270 Ga0268265_10060733 3300028380 Bacteria 2898
271 Ga0268264_10543366 3300028381 Bacteria 1139
272 Ga0265324_10000018 3300029957 Bacteria 184238
273 Ga0265324_10000612 3300029957 Bacteria 24383
274 Ga0268256_1014256 3300030500 Bacteria 2370
275 Ga0265325_10000035 3300031241 Bacteria 99051
276 Ga0265325_10001853 3300031241 Bacteria 14598
277 Ga0265331_10017178 3300031250 Bacteria 3780
278 Ga0265331_10103858 3300031250 Bacteria 1306
279 Ga0265327_10006092 3300031251 Bacteria 9776
280 Ga0265316_10068783 3300031344 Bacteria 2734
281 Ga0265316_10139916 3300031344 Bacteria 1819
282 Ga0307509_10000145 3300031507 Bacteria 107492
283 Ga0307408_100000019 3300031548 Bacteria 344502
284 Ga0316579_10000679 3300031691 Bacteria 11541
285 Ga0316579_10000955 3300031691 Bacteria 10108
286 Ga0265314_10001810 3300031711 Bacteria 23057
287 Ga0265314_10062888 3300031711 Bacteria 2520
288 Ga0316578_10048714 3300031728 Bacteria 2475
289 Ga0316577_10143722 3300031733 Bacteria 1344
290 Ga0316583_10046805 3300032133 Bacteria 1526
291 Ga0373924_0094118 3300035410 Bacteria 1284
292 Ga0373937_0104927 3300036401 Bacteria 2626
293 Ga0373937_0115881 3300036401 Bacteria 2495
294 Ga0316582_0039967 3300036647 Bacteria 2924
295 Ga0316582_0048594 3300036647 Unclassified 2683
296 Ga0316584_0038679 3300036712 Bacteria 3550
297 Ga0316584_0181222 3300036712 Bacteria 1559
298 Ga0316581_0000807 3300037588 Bacteria 6506
299 Ga0436361_0523086 3300039447 Bacteria 5071
300 Ga0436363_0996184 3300039450 Bacteria 1042
301 Ga0451853_2097694 3300041512 Bacteria 921
302 Ga0439431_0053476 3300041997 Bacteria 1051
303 Ga0439437_003641 3300042000 Bacteria 1663
304 Ga0439456_000220 3300042013 Bacteria 15563
305 Ga0439456_001653 3300042013 Bacteria 4503
306 Ga0450911_000011 3300042115 Bacteria 130739
307 Ga0439464_0000312 3300042439 Bacteria 9273
308 Ga0439464_0065999 3300042439 Bacteria 1065
309 Ga0450893_0008751 3300042532 Bacteria 1650
310 Ga0451577_0000002 3300042876 Bacteria 1731375
311 Ga0451577_0007738 3300042876 Bacteria 10532
312 Ga0451577_0016080 3300042876 Bacteria 6939
313 Ga0451577_0129228 3300042876 Bacteria 2265
314 Ga0451577_0362006 3300042876 Bacteria 1316
315 Ga0453683_0000013 3300044673 Bacteria 371932
316 Ga0453683_0215180 3300044673 Bacteria 1221
317 Ga0453684_0000002 3300044712 Bacteria 1731375
318 Ga0453684_0016594 3300044712 Bacteria 11494
319 Ga0451576_0000037 3300045051 Bacteria 372173
320 Ga0451576_0000320 3300045051 Bacteria 116612
321 Ga0451576_0003253 3300045051 Bacteria 22534
322 Ga0451576_0073619 3300045051 Bacteria 3555
323 Ga0451576_0281564 3300045051 Bacteria 1739
324 Ga0451576_1171896 3300045051 Bacteria 803
325 Ga0451576_1228452 3300045051 Bacteria 782
326 Ga0495592_0005543 3300046454 Bacteria 9334
327 Ga0495651_0120351 3300046462 Bacteria 1929
328 Ga0495653_0053443 3300046463 Bacteria 3090
329 Ga0495664_0131208 3300046477 Bacteria 1517
330 Ga0495585_0015171 3300046492 Bacteria 4478
331 Ga0495607_0004339 3300046501 Bacteria 10463
332 Ga0495606_0013714 3300046507 Bacteria 6380
333 Ga0495608_0102668 3300046511 Bacteria 1843
334 Ga0495616_0113423 3300046513 Bacteria 1257
335 Ga0495631_0273620 3300046518 Bacteria 719
336 Ga0495637_0030344 3300046520 Bacteria 2399
337 Ga0495637_0083705 3300046520 Bacteria 1268
338 Ga0495652_0181589 3300046529 Bacteria 1614
339 Ga0495654_0133944 3300046530 Bacteria 1110
340 Ga0495598_0008804 3300046537 Bacteria 2363
341 Ga0495621_0073599 3300046539 Bacteria 1263
342 Ga0495635_0231717 3300046663 Bacteria 1247
343 Ga0495661_0000050 3300046665 Bacteria 143435
344 Ga0495657_0124307 3300046675 Bacteria 1622
345 Ga0495599_0037179 3300046678 Bacteria 3058
346 Ga0495604_0060002 3300047317 Bacteria 2914
347 Ga0495680_0084439 3300047322 Bacteria 2393
348 Ga0495683_0000055 3300047323 Bacteria 119199
349 Ga0495684_0104193 3300047471 Bacteria 2144
350 Ga0496105_0590090 3300048908 Bacteria 863
351 Ga0496108_0010236 3300048911 Bacteria 7615
352 Ga0496108_0325568 3300048911 Bacteria 1340
353 Ga0496109_0005148 3300048912 Bacteria 10913
354 Ga0496110_0022876 3300048913 Bacteria 5311
355 Ga0496114_0040038 3300048917 Bacteria 3879
356 Ga0496123_0027774 3300048926 Bacteria 4207
357 Ga0496123_0349350 3300048926 Bacteria 688
358 Ga0495678_022196 3300049459 Bacteria 2779
359 Ga0495682_0000573 3300049460 Bacteria 24941
360 Ga0501031_0272349 3300049568 Bacteria 1099
361 Ga0501031_0461375 3300049568 Bacteria 820
362 Ga0501032_0001373 3300049569 Bacteria 19318
363 Ga0501032_0020712 3300049569 Bacteria 4578
364 Ga0501032_0063460 3300049569 Bacteria 2473
365 Ga0501032_0132413 3300049569 Bacteria 1644
366 Ga0501033_0001864 3300049570 Bacteria 18331
367 Ga0501033_0091461 3300049570 Bacteria 2225
368 Ga0501034_0011029 3300049571 Bacteria 9381
369 Ga0501034_0056305 3300049571 Bacteria 3956
370 Ga0501034_0173751 3300049571 Bacteria 2121
371 Ga0501036_0001661 3300049572 Bacteria 17238
372 Ga0501036_0013638 3300049572 Bacteria 6757
373 Ga0501036_0065391 3300049572 Bacteria 3078
374 Ga0501037_0000474 3300049573 Bacteria 32555
375 Ga0501038_0006477 3300049574 Bacteria 10835
376 Ga0501038_0011073 3300049574 Bacteria 8237
377 Ga0501038_0029427 3300049574 Bacteria 4867
378 Ga0501038_0042237 3300049574 Bacteria 3971
379 Ga0501039_0037972 3300049575 Bacteria 3719
380 Ga0501039_0054337 3300049575 Bacteria 3100
381 Ga0501039_0074856 3300049575 Bacteria 2632
382 Ga0501039_0103243 3300049575 Bacteria 2225
383 Ga0501040_0000260 3300049576 Bacteria 30935
384 Ga0501040_0012330 3300049576 Bacteria 5600
385 Ga0501041_0002647 3300049577 Bacteria 10212
386 Ga0501041_0368317 3300049577 Bacteria 909
387 Ga0501042_0005609 3300049578 Bacteria 8092
388 Ga0501042_0010996 3300049578 Bacteria 6092
389 Ga0501043_0005740 3300049579 Bacteria 10000
390 Ga0501043_0062399 3300049579 Bacteria 2926
391 Ga0501043_0141690 3300049579 Bacteria 1882
392 Ga0501043_0194914 3300049579 Bacteria 1574
393 Ga0501046_0002898 3300049580 Bacteria 15906
394 Ga0501046_0165334 3300049580 Bacteria 1662
395 Ga0501046_0211425 3300049580 Bacteria 1440
396 Ga0501047_0004440 3300049581 Bacteria 13210
397 Ga0501047_0095380 3300049581 Bacteria 2853
398 Ga0501048_0002369 3300049582 Bacteria 14395
399 Ga0501048_0015895 3300049582 Bacteria 5552
400 Ga0501067_0017247 3300049583 Bacteria 3991
401 Ga0501068_0001753 3300049584 Bacteria 11532
402 Ga0501068_0170058 3300049584 Bacteria 1375
403 Ga0501069_0001227 3300049585 Bacteria 12517
404 Ga0501070_0001841 3300049586 Bacteria 18702
405 Ga0501070_0051509 3300049586 Bacteria 3417
406 Ga0501073_0000127 3300049589 Bacteria 49817
407 Ga0501074_0087485 3300049590 Bacteria 2231
408 Ga0501075_0018092 3300049591 Bacteria 5096
409 Ga0501076_0000858 3300049592 Bacteria 19723
410 Ga0501079_0008772 3300049741 Bacteria 7662
411 Ga0501079_0054850 3300049741 Bacteria 3074
412 Ga0501080_0007745 3300049742 Bacteria 9710
413 Ga0501081_0031370 3300049743 Bacteria 3601
414 Ga0501083_0003616 3300049744 Bacteria 10842
415 Ga0501035_0001968 3300049822 Bacteria 20568
416 Ga0501035_0086085 3300049822 Bacteria 2769
417 Ga0501035_0117850 3300049822 Bacteria 2323
418 Ga0501035_0144625 3300049822 Bacteria 2065
419 Ga0501044_0014044 3300049823 Bacteria 8647
420 Ga0501044_0452648 3300049823 Bacteria 1190
421 Ga0501045_0003520 3300049824 Bacteria 10729
422 Ga0501045_0006849 3300049824 Bacteria 7895
423 nmdc:mga00v17_643_c2 3300050491 Bacteria 4697
424 nmdc:mga08y16_371590_c1 3300050511 Bacteria 1467
425 Ga0500641_0001591 3300053096 Bacteria 8083
426 Ga0500650_0276134 3300053098 Bacteria 748
427 Ga0500618_009688 3300053125 Bacteria 2620
428 Ga0501084_0011299 3300054114 Bacteria 7392
429 Ga0501084_0115185 3300054114 Bacteria 2259
430 Ga0501082_0004486 3300060353 Bacteria 12196
431 Ga0501082_0075305 3300060353 Bacteria 2908
432 Ga0530510_0015757 3300061734 Bacteria 5344
433 2510282626 2510065053 Bacteria 5005518
434 2510295280 2510065055 Bacteria 5037935
435 2510311094 2510065058 Bacteria 5005894
436 2600442640 2600254954 Bacteria 5100516
437 2602011015 2600255389 Bacteria 5275336
438 2608385089 2606217733 Bacteria 6360972
439 2644454838 2643221681 Bacteria 3707866
440 2644536235 2643221697 Bacteria 3575694
441 2645722060 2643221961 Bacteria 3919167
442 2645724902 2643221962 Bacteria 3874254
443 2774129132 2773857672 Bacteria 4993178
444 2808906141 2808606373 Bacteria 4423627
445 2812369611 2811994881 Bacteria 6298475
446 2823421512 2823421272 Bacteria 5372474
447 2912969004 2912963787 Bacteria 5646108
448 2917833239 2917832318 Bacteria 5346010
449 2919126220 2919125081 Bacteria 5385106
450 2919505926 2919501602 Bacteria 5286340
451 2923523698 2923519811 Bacteria 6298479
452 2926067797 2926063275 Bacteria 5285848
453 2939654264 2939651529 Bacteria 5895393
454 2974302256 2974298342 Bacteria 4840922
455 2984500172 2984499530 Bacteria 5020881
456 2984506619 2984504281 Bacteria 5262371
457 8016731356 8016728285 Bacteria 5263933
458 8034964389 8034962539 Bacteria 4884839
459 8055881773 8055878733 Bacteria 5907058
460 nmdc:mga0n895_703332_c1
461 Ga0065712_10097950
462 Ga0070658_10025343
463 Ga0070676_10201579
464 Ga0070683_100003177
465 Ga0070670_100023010
466 Ga0070677_10013323
467 Ga0070677_10206312
468 Ga0068869_100044684
469 Ga0068869_100148343
470 Ga0068869_100378661
471 Ga0070666_10013759
472 Ga0068868_100003334
473 Ga0068868_100032341
474 Ga0068868_100166419
475 Ga0068868_100787351
476 Ga0070689_100035273
477 Ga0070689_100061893
478 Ga0070689_100100868
479 Ga0070689_100687036
480 Ga0070661_100001429
481 Ga0070661_100262685
482 Ga0070661_100312983
483 Ga0070692_10027806
484 Ga0070668_100048990
485 Ga0070675_100025860
486 Ga0070675_100117917
487 Ga0070675_100305903
488 Ga0070675_100336004
489 Ga0070675_100614362
490 Ga0070671_100001144
491 Ga0070671_100230290
492 Ga0070674_100053403
493 Ga0070674_100088802
494 Ga0070673_100022353
495 Ga0070673_100080904
496 Ga0070673_100218548
497 Ga0070688_100064078
498 Ga0070688_100092235
499 Ga0070688_100231016
500 Ga0070659_100118693
501 Ga0070659_100442717
502 Ga0070667_100027069
503 Ga0070667_100251027
504 Ga0070703_10115503
505 Ga0070701_10191876
506 Ga0070700_100027327
507 Ga0070700_100181779
508 Ga0070694_100065541
509 Ga0070694_100170994
510 Ga0070678_100160581
511 Ga0070662_100072339
512 Ga0070662_100102281
513 Ga0070662_100747970
514 Ga0068867_100042712
515 Ga0070685_10136733
516 Ga0070685_10158925
517 Ga0070699_100563758
518 Ga0070684_100053863
519 Ga0070684_100074610
520 Ga0068853_100130734
521 Ga0068853_100133788
522 Ga0070672_100001750
523 Ga0070686_100157879
524 Ga0070686_100158165
525 Ga0070696_100587907
526 Ga0070693_100038548
527 Ga0070693_100326764
528 Ga0070665_100058907
529 Ga0070665_100307379
530 Ga0070665_100438360
531 Ga0070704_100009095
532 Ga0068855_100014417
533 Ga0068855_100021177
534 Ga0070664_100000701
535 Ga0070664_100084049
536 Ga0070664_100737965
537 Ga0068857_100149204
538 Ga0068854_100008673
539 Ga0068854_100984324
540 Ga0068856_100036980
541 Ga0068856_100046756
542 Ga0068856_100646795
543 Ga0070702_100248821
544 Ga0070702_100448448
545 Ga0068852_100026121
546 Ga0068852_100236759
547 Ga0068859_100117342
548 Ga0068859_100232332
549 Ga0068859_100297045
550 Ga0068864_100040299
551 Ga0068864_100050149
552 Ga0068864_100406175
553 Ga0068864_100684376
554 Ga0068866_10052544
555 Ga0068861_100245382
556 Ga0068870_10131657
557 Ga0068863_100102999
558 Ga0068858_100004362
559 Ga0068860_100200324
560 Ga0068860_100265538
561 Ga0068862_100216666
562 Ga0081455_10001170
563 Ga0075364_10015740
564 Ga0070715_10180266
565 Ga0097621_100008059
566 Ga0097621_100012861
567 Ga0097621_100028204
568 Ga0097621_100052232
569 Ga0068871_100002805
570 Ga0068871_100028741
571 Ga0068871_100315425
572 Ga0075434_100566995
573 Ga0068865_100052673
574 Ga0068865_100151183
575 Ga0068865_100436813
576 Ga0097620_100117354
577 Ga0097620_100232341
578 Ga0097620_100297073
579 Ga0075435_100386250
580 Ga0105251_10004031
581 Ga0105251_10053863
582 Ga0105244_10040656
583 Ga0105240_10005084
584 Ga0105240_10507866
585 Ga0111539_10288062
586 Ga0105245_10034084
587 Ga0105245_10069370
588 Ga0105245_10095030
589 Ga0105245_10121102
590 Ga0105245_10132242
591 Ga0105247_10240437
592 Ga0105247_10305923
593 Ga0114129_10353166
594 Ga0105243_10098929
595 Ga0105243_10117965
596 Ga0105241_10049524
597 Ga0105241_10389868
598 Ga0105242_10179412
599 Ga0105242_10379606
600 Ga0105242_10569104
601 Ga0105248_10037647
602 Ga0105248_10667688
603 Ga0105237_10688589
604 Ga0105238_10041767
605 Ga0105249_10153207
606 Ga0105249_10301144
607 Ga0105239_10356951
608 Ga0105239_10424671
609 Ga0105239_11357174
610 Ga0105246_10102779
611 Ga0105246_10376565
612 Ga0157373_10354670
613 Ga0157371_10038151
614 Ga0157370_10004332
615 Ga0157370_10240887
616 Ga0157369_10007804
617 Ga0157369_10145233
618 Ga0157374_10001961
619 Ga0157374_10159514
620 Ga0157374_10172781
621 Ga0157378_10026879
622 Ga0157378_10061440
623 Ga0157378_10170114
624 Ga0157378_10308294
625 Ga0163162_10035385
626 Ga0163162_10096431
627 Ga0163162_10120785
628 Ga0157372_10081701
629 Ga0157375_10003680
630 Ga0157375_10121335
631 Ga0157375_10155870
632 Ga0157377_10047216
633 Ga0157377_10048208
634 Ga0157379_10057965
635 Ga0157379_10184358
636 Ga0157376_10007665
637 Ga0157376_10030341
638 Ga0157376_10512113
639 Ga0157376_10609658
640 Ga0163161_10228976
641 Ga0206356_10645588
642 Ga0207666_1006069
643 Ga0207697_10023247
644 Ga0207655_1059831
645 Ga0207713_1004765
646 Ga0207653_10112182
647 Ga0207682_10001584
648 Ga0207642_10068167
649 Ga0207642_10253961
650 Ga0207688_10002343
651 Ga0207680_10040306
652 Ga0207647_10241472
653 Ga0207685_10180930
654 Ga0207645_10026236
655 Ga0207643_10011107
656 Ga0207705_10037976
657 Ga0207705_10116052
658 Ga0207654_10050254
659 Ga0207654_10438400
660 Ga0207695_10006155
661 Ga0207660_10226012
662 Ga0207662_10017453
663 Ga0207649_10038772
664 Ga0207649_10142744
665 Ga0207649_10252842
666 Ga0207650_10004814
667 Ga0207659_10007788
668 Ga0207659_10072092
669 Ga0207659_10083150
670 Ga0207659_10131858
671 Ga0207687_10048878
672 Ga0207687_10096153
673 Ga0207644_10010320
674 Ga0207706_10007731
675 Ga0207706_10011863
676 Ga0207706_10234306
677 Ga0207706_10287526
678 Ga0207686_10143145
679 Ga0207709_10089551
680 Ga0207709_10240662
681 Ga0207670_10012370
682 Ga0207670_10038693
683 Ga0207670_10064301
684 Ga0207670_10193311
685 Ga0207669_10015011
686 Ga0207704_10107068
687 Ga0207691_10004456
688 Ga0207691_10142730
689 Ga0207711_10476530
690 Ga0207689_10014402
691 Ga0207689_10319412
692 Ga0207661_10015309
693 Ga0207661_10156055
694 Ga0207679_10026031
695 Ga0207679_10107745
696 Ga0207679_10556518
697 Ga0207667_10002749
698 Ga0207667_10031384
699 Ga0207667_10065744
700 Ga0207651_10007776
701 Ga0207651_10104329
702 Ga0207668_10036473
703 Ga0207640_10030714
704 Ga0207658_10424720
705 Ga0207677_10022298
706 Ga0207677_10164536
707 Ga0207703_10298610
708 Ga0207708_10098512
709 Ga0207708_10460169
710 Ga0207702_10555939
711 Ga0207648_10030972
712 Ga0207648_10079551
713 Ga0207676_10033534
714 Ga0207676_10090372
715 Ga0207674_10039716
716 Ga0207674_10074117
717 Ga0207675_100015862
718 Ga0207683_10000544
719 Ga0207683_10029595
720 Ga0207698_10000379
721 Ga0207698_10070389
722 Ga0207698_10224260
723 Ga0207698_10270298
724 Ga0209371_1012989
725 Ga0209966_1021780
726 Ga0207428_10092290
727 Ga0268266_10437907
728 Ga0268265_10057759
729 Ga0268265_10060733
730 Ga0268264_10543366
731 Ga0265324_10000018
732 Ga0265324_10000612
733 Ga0268256_1014256
734 Ga0265325_10000035
735 Ga0265325_10001853
736 Ga0265331_10017178
737 Ga0265331_10103858
738 Ga0265327_10006092
739 Ga0265316_10068783
740 Ga0265316_10139916
741 Ga0307509_10000145
742 Ga0307408_100000019
743 Ga0316579_10000679
744 Ga0316579_10000955
745 Ga0265314_10001810
746 Ga0265314_10062888
747 Ga0316578_10048714
748 Ga0316577_10143722
749 Ga0316583_10046805
750 Ga0373924_0094118
751 Ga0373937_0104927
752 Ga0373937_0115881
753 Ga0316582_0039967
754 Ga0316582_0048594
755 Ga0316584_0038679
756 Ga0316584_0181222
757 Ga0316581_0000807
758 Ga0436361_0523086
759 Ga0436363_0996184
760 Ga0451853_2097694
761 Ga0439431_0053476
762 Ga0439437_003641
763 Ga0439456_000220
764 Ga0439456_001653
765 Ga0450911_000011
766 Ga0439464_0000312
767 Ga0439464_0065999
768 Ga0450893_0008751
769 Ga0451577_0000002
770 Ga0451577_0007738
771 Ga0451577_0016080
772 Ga0451577_0129228
773 Ga0451577_0362006
774 Ga0453683_0000013
775 Ga0453683_0215180
776 Ga0453684_0000002
777 Ga0453684_0016594
778 Ga0451576_0000037
779 Ga0451576_0000320
780 Ga0451576_0003253
781 Ga0451576_0073619
782 Ga0451576_0281564
783 Ga0451576_1171896
784 Ga0451576_1228452
785 Ga0495592_0005543
786 Ga0495651_0120351
787 Ga0495653_0053443
788 Ga0495664_0131208
789 Ga0495585_0015171
790 Ga0495607_0004339
791 Ga0495606_0013714
792 Ga0495608_0102668
793 Ga0495616_0113423
794 Ga0495631_0273620
795 Ga0495637_0030344
796 Ga0495637_0083705
797 Ga0495652_0181589
798 Ga0495654_0133944
799 Ga0495598_0008804
800 Ga0495621_0073599
801 Ga0495635_0231717
802 Ga0495661_0000050
803 Ga0495657_0124307
804 Ga0495599_0037179
805 Ga0495604_0060002
806 Ga0495680_0084439
807 Ga0495683_0000055
808 Ga0495684_0104193
809 Ga0496105_0590090
810 Ga0496108_0010236
811 Ga0496108_0325568
812 Ga0496109_0005148
813 Ga0496110_0022876
814 Ga0496114_0040038
815 Ga0496123_0027774
816 Ga0496123_0349350
817 Ga0495678_022196
818 Ga0495682_0000573
819 Ga0501031_0272349
820 Ga0501031_0461375
821 Ga0501032_0001373
822 Ga0501032_0020712
823 Ga0501032_0063460
824 Ga0501032_0132413
825 Ga0501033_0001864
826 Ga0501033_0091461
827 Ga0501034_0011029
828 Ga0501034_0056305
829 Ga0501034_0173751
830 Ga0501036_0001661
831 Ga0501036_0013638
832 Ga0501036_0065391
833 Ga0501037_0000474
834 Ga0501038_0006477
835 Ga0501038_0011073
836 Ga0501038_0029427
837 Ga0501038_0042237
838 Ga0501039_0037972
839 Ga0501039_0054337
840 Ga0501039_0074856
841 Ga0501039_0103243
842 Ga0501040_0000260
843 Ga0501040_0012330
844 Ga0501041_0002647
845 Ga0501041_0368317
846 Ga0501042_0005609
847 Ga0501042_0010996
848 Ga0501043_0005740
849 Ga0501043_0062399
850 Ga0501043_0141690
851 Ga0501043_0194914
852 Ga0501046_0002898
853 Ga0501046_0165334
854 Ga0501046_0211425
855 Ga0501047_0004440
856 Ga0501047_0095380
857 Ga0501048_0002369
858 Ga0501048_0015895
859 Ga0501067_0017247
860 Ga0501068_0001753
861 Ga0501068_0170058
862 Ga0501069_0001227
863 Ga0501070_0001841
864 Ga0501070_0051509
865 Ga0501073_0000127
866 Ga0501074_0087485
867 Ga0501075_0018092
868 Ga0501076_0000858
869 Ga0501079_0008772
870 Ga0501079_0054850
871 Ga0501080_0007745
872 Ga0501081_0031370
873 Ga0501083_0003616
874 Ga0501035_0001968
875 Ga0501035_0086085
876 Ga0501035_0117850
877 Ga0501035_0144625
878 Ga0501044_0014044
879 Ga0501044_0452648
880 Ga0501045_0003520
881 Ga0501045_0006849
882 nmdc:mga00v17_643_c2
883 nmdc:mga08y16_371590_c1
884 Ga0500641_0001591
885 Ga0500650_0276134
886 Ga0500618_009688
887 Ga0501084_0011299
888 Ga0501084_0115185
889 Ga0501082_0004486
890 Ga0501082_0075305
891 Ga0530510_0015757
892 2510282626
893 2510295280
894 2510311094
895 2600442640
896 2602011015
897 2608385089
898 2644454838
899 2644536235
900 2645722060
901 2645724902
902 2774129132
903 2808906141
904 2812369611
905 2823421512
906 2912969004
907 2917833239
908 2919126220
909 2919505926
910 2923523698
911 2926067797
912 2939654264
913 2974302256
914 2984500172
915 2984506619
916 8016731356
917 8034964389
918 8055881773

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

78

212

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6taj-assembly2.cif.gz_BBB-2 crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid 1.60 angstrom resolution 0.9804 16 224
6tak-assembly1.cif.gz_BBB crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid and sulfate at 1.25 angstrom resolution 0.9783 15 224
6tak-assembly1.cif.gz_AAA crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid and sulfate at 1.25 angstrom resolution 0.9728 15 224
6taj-assembly1.cif.gz_AAA-2 crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid 1.60 angstrom resolution 0.9645 16 224
6taj-assembly2.cif.gz_BBB-2 crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid 1.60 angstrom resolution 0.9614 16 224
ID Description Score Start End Superfamily
3n2lH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9468 15 203 3.40.50.2020
af_O94331_1_215_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9287 16 225 3.40.50.2020
3mjdC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9255 19 224 3.40.50.2020
3n2lH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9253 15 203 3.40.50.2020
3mjdC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9168 19 224 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A3S4J5G6-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9847 15 206 GO:0000287
GO:0004588
GO:0005737
GO:0006207
GO:0044205
GO:0046132
AF-A0A4Z0P938-F1-model_v4 orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9834 59 224 GO:0004588
GO:0005737
GO:0006207
GO:0044205
GO:0046132
AF-A0A522DMB7-F1-model_v4 orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9832 15 189 GO:0004588
GO:0005737
GO:0006207
GO:0044205
GO:0046132
AF-A0A258SMY8-F1-model_v4 orotate phosphoribosyltransferase (EC 2.4.2.10) 0.983 13 201 GO:0004588
GO:0005737
GO:0006207
GO:0044205
GO:0046132
AF-A0A1W9F1Q8-F1-model_v4 deleted 0.9827 63 224

Map