F448440

General Info

Members Datasets Scaffolds Average Seq Length
459 196 918 116

Family's Representative Sequence

Representative Sequence 3300049525|Ga0501302_029969|Ga0501302_029969_91_495
Length 134
Sequence MELLLAIIAGVLYATGLYLMLRRRLAQLIVGLGLLSNGSNVLILAAAGVTRGNPPIVTGTTVAADQFADPVPQALILTAIVIGFGVLAFSLVLAHRVHQSVESDDIDMVRSHSAAPSSDRPDSVRASSGRSDRA

Samples

Sample ID Description Type Environment
1 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
114 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
115 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
116 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
117 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
120 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
121 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
122 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
123 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
124 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
125 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
126 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
127 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
128 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
129 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
130 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
131 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
132 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
133 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
134 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
135 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
142 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
143 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
144 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
169 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
174 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
175 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
179 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
192 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.02
Nodule 0
Rhizoplane 1.74
Rhizosphere 87.58
Stem 0
Stem Tuber 0
Unclassified 5.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501302_029969 3300049525 Bacteria 513
2 Ga0065712_10005605 3300005290 Bacteria 4015
3 Ga0065712_10094795 3300005290 Bacteria 2241
4 Ga0065712_10135227 3300005290 Bacteria 1504
5 Ga0065712_10159233 3300005290 Bacteria 1314
6 Ga0065712_10708509 3300005290 Unclassified 544
7 Ga0065715_10109553 3300005293 Bacteria 2663
8 Ga0070658_10161798 3300005327 Bacteria 1878
9 Ga0070676_10318601 3300005328 Bacteria 1060
10 Ga0070670_100002793 3300005331 Bacteria 14437
11 Ga0070670_100368159 3300005331 Bacteria 1265
12 Ga0070670_100739517 3300005331 Bacteria 886
13 Ga0070677_10049345 3300005333 Bacteria 1695
14 Ga0070677_10295539 3300005333 Bacteria 821
15 Ga0070677_10311477 3300005333 Bacteria 803
16 Ga0068869_100032228 3300005334 Bacteria 3692
17 Ga0070666_11097621 3300005335 Unclassified 591
18 Ga0068868_100601456 3300005338 Bacteria 974
19 Ga0068868_100785583 3300005338 Bacteria 858
20 Ga0070661_100060189 3300005344 Bacteria 2787
21 Ga0070668_100663440 3300005347 Bacteria 917
22 Ga0070669_100680857 3300005353 Bacteria 867
23 Ga0070675_100371244 3300005354 Bacteria 1272
24 Ga0070675_100827921 3300005354 Bacteria 847
25 Ga0070675_100839634 3300005354 Bacteria 840
26 Ga0070675_100870097 3300005354 Bacteria 825
27 Ga0070675_101035126 3300005354 Bacteria 754
28 Ga0070675_101180269 3300005354 Bacteria 704
29 Ga0070671_100376910 3300005355 Bacteria 1212
30 Ga0070671_101113937 3300005355 Bacteria 693
31 Ga0070674_100701380 3300005356 Bacteria 865
32 Ga0070674_100784507 3300005356 Bacteria 821
33 Ga0070673_100011805 3300005364 Bacteria 5978
34 Ga0070673_100620509 3300005364 Unclassified 988
35 Ga0070673_102272243 3300005364 Bacteria 515
36 Ga0070659_100444677 3300005366 Bacteria 1099
37 Ga0070705_100557659 3300005440 Bacteria 879
38 Ga0070700_100251735 3300005441 Bacteria 1267
39 Ga0070700_100441598 3300005441 Bacteria 988
40 Ga0070700_100707795 3300005441 Bacteria 801
41 Ga0070700_101862388 3300005441 Unclassified 519
42 Ga0070663_100098767 3300005455 Bacteria 2176
43 Ga0070663_100243258 3300005455 Bacteria 1421
44 Ga0070663_101218128 3300005455 Unclassified 662
45 Ga0070663_102057734 3300005455 Bacteria 514
46 Ga0070678_100105960 3300005456 Bacteria 2190
47 Ga0070678_100117087 3300005456 Bacteria 2095
48 Ga0070678_100386139 3300005456 Bacteria 1213
49 Ga0070678_100995883 3300005456 Bacteria 770
50 Ga0070662_100466971 3300005457 Bacteria 1049
51 Ga0070662_100977900 3300005457 Bacteria 724
52 Ga0070662_101087158 3300005457 Bacteria 686
53 Ga0068867_100230163 3300005459 Bacteria 1498
54 Ga0070672_100145434 3300005543 Bacteria 1959
55 Ga0070672_100361437 3300005543 Bacteria 1239
56 Ga0070672_100453143 3300005543 Bacteria 1105
57 Ga0070672_100597585 3300005543 Bacteria 961
58 Ga0070686_100104332 3300005544 Bacteria 1920
59 Ga0070696_101566538 3300005546 Bacteria 565
60 Ga0070665_100039718 3300005548 Bacteria 4731
61 Ga0070665_100047750 3300005548 Bacteria 4296
62 Ga0070665_100827227 3300005548 Bacteria 939
63 Ga0070665_101491020 3300005548 Archaea 685
64 Ga0070665_102640757 3300005548 Bacteria 503
65 Ga0070664_100008355 3300005564 Bacteria 8370
66 Ga0070664_100022042 3300005564 Bacteria 5253
67 Ga0070664_101086699 3300005564 Bacteria 753
68 Ga0070664_101896224 3300005564 Bacteria 565
69 Ga0068854_100110822 3300005578 Bacteria 2070
70 Ga0068854_101521125 3300005578 Bacteria 608
71 Ga0070702_100242082 3300005615 Unclassified 1218
72 Ga0068859_102495855 3300005617 Bacteria 569
73 Ga0068864_100051261 3300005618 Bacteria 3554
74 Ga0068864_100066339 3300005618 Bacteria 3133
75 Ga0068861_100180928 3300005719 Bacteria 1755
76 Ga0068861_100889626 3300005719 Bacteria 842
77 Ga0068861_101324004 3300005719 Bacteria 701
78 Ga0068870_10398535 3300005840 Bacteria 895
79 Ga0068863_100115477 3300005841 Bacteria 2558
80 Ga0068860_101763103 3300005843 Bacteria 641
81 Ga0081538_10080218 3300005981 Unclassified 1742
82 Ga0075365_11086672 3300006038 Bacteria 563
83 Ga0075368_10010659 3300006042 Bacteria 3327
84 Ga0075368_10012636 3300006042 Bacteria 3092
85 Ga0075368_10091241 3300006042 Bacteria 1246
86 Ga0075363_100019894 3300006048 Bacteria 3361
87 Ga0075364_10006616 3300006051 Bacteria 6826
88 Ga0075364_10009895 3300006051 Bacteria 5736
89 Ga0075364_10672168 3300006051 Bacteria 707
90 Ga0075364_10766566 3300006051 Bacteria 658
91 Ga0075362_10000713 3300006177 Bacteria 9824
92 Ga0075367_10004088 3300006178 Bacteria 7065
93 Ga0075367_10004938 3300006178 Bacteria 6574
94 Ga0075367_10212462 3300006178 Bacteria 1210
95 Ga0075367_10214832 3300006178 Bacteria 1203
96 Ga0075367_10945115 3300006178 Archaea 550
97 Ga0075369_10244304 3300006186 Bacteria 833
98 Ga0075366_10013802 3300006195 Bacteria 4606
99 Ga0075366_10024464 3300006195 Bacteria 3522
100 Ga0075366_10026591 3300006195 Bacteria 3390
101 Ga0075366_10313784 3300006195 Bacteria 960
102 Ga0097621_100105126 3300006237 Bacteria 2380
103 Ga0097621_100527797 3300006237 Bacteria 1072
104 Ga0075370_10025079 3300006353 Bacteria 3296
105 Ga0075370_10154816 3300006353 Bacteria 1344
106 Ga0068871_100188236 3300006358 Bacteria 1777
107 Ga0068871_100415042 3300006358 Bacteria 1201
108 Ga0068871_101508429 3300006358 Bacteria 635
109 Ga0075428_100003380 3300006844 Bacteria 17454
110 Ga0075428_100255931 3300006844 Bacteria 1886
111 Ga0075430_100002854 3300006846 Bacteria 14465
112 Ga0075430_100580127 3300006846 Unclassified 925
113 Ga0075430_100752587 3300006846 Bacteria 803
114 Ga0075430_101524447 3300006846 Unclassified 549
115 Ga0075431_100064204 3300006847 Bacteria 3791
116 Ga0075431_100589164 3300006847 Bacteria 1097
117 Ga0075429_100021320 3300006880 Bacteria 5617
118 Ga0097620_102495930 3300006931 Bacteria 569
119 Ga0111539_10000435 3300009094 Bacteria 52742
120 Ga0111539_10001942 3300009094 Bacteria 27552
121 Ga0111539_10003663 3300009094 Bacteria 20237
122 Ga0111539_10005117 3300009094 Bacteria 17008
123 Ga0111539_10013016 3300009094 Bacteria 10410
124 Ga0111539_10043970 3300009094 Bacteria 5353
125 Ga0111539_10376673 3300009094 Bacteria 1652
126 Ga0114129_10010365 3300009147 Bacteria 13292
127 Ga0114129_11262922 3300009147 Bacteria 917
128 Ga0105242_11210610 3300009176 Bacteria 775
129 Ga0105248_10010570 3300009177 Bacteria 10169
130 Ga0105238_10156237 3300009551 Bacteria 2256
131 Ga0105249_10018171 3300009553 Bacteria 6250
132 Ga0157319_1027881 3300012497 Bacteria 592
133 Ga0157375_10456630 3300013308 Bacteria 1443
134 Ga0157375_12257700 3300013308 Bacteria 649
135 Ga0163163_10009141 3300014325 Bacteria 8831
136 Ga0157380_10249294 3300014326 Bacteria 1606
137 Ga0157380_10393435 3300014326 Bacteria 1312
138 Ga0157380_10533803 3300014326 Bacteria 1147
139 Ga0157377_10110364 3300014745 Bacteria 1652
140 Ga0157377_10405576 3300014745 Bacteria 930
141 Ga0157377_11691510 3300014745 Bacteria 510
142 Ga0157376_10970218 3300014969 Bacteria 871
143 Ga0163161_10270655 3300017792 Bacteria 1329
144 Ga0207682_10034734 3300025893 Bacteria 2034
145 Ga0207682_10038277 3300025893 Bacteria 1945
146 Ga0207645_10667354 3300025907 Bacteria 706
147 Ga0207643_10203094 3300025908 Bacteria 1207
148 Ga0207643_10293918 3300025908 Unclassified 1010
149 Ga0207643_10328311 3300025908 Unclassified 957
150 Ga0207705_10252518 3300025909 Bacteria 1345
151 Ga0207649_10062837 3300025920 Bacteria 2342
152 Ga0207649_10973554 3300025920 Bacteria 667
153 Ga0207681_10298091 3300025923 Bacteria 1275
154 Ga0207681_10872562 3300025923 Bacteria 753
155 Ga0207650_10032556 3300025925 Bacteria 3771
156 Ga0207650_10078521 3300025925 Bacteria 2497
157 Ga0207650_10740694 3300025925 Bacteria 831
158 Ga0207659_10291895 3300025926 Bacteria 1336
159 Ga0207659_10397076 3300025926 Bacteria 1153
160 Ga0207659_10502754 3300025926 Bacteria 1026
161 Ga0207659_10541049 3300025926 Bacteria 989
162 Ga0207690_10381914 3300025932 Bacteria 1120
163 Ga0207706_10241319 3300025933 Bacteria 1580
164 Ga0207669_10117466 3300025937 Bacteria 1798
165 Ga0207704_10574880 3300025938 Bacteria 919
166 Ga0207691_10030934 3300025940 Bacteria 4998
167 Ga0207691_10937213 3300025940 Unclassified 724
168 Ga0207691_11763955 3300025940 Archaea 500
169 Ga0207711_10087897 3300025941 Bacteria 2728
170 Ga0207689_10074432 3300025942 Bacteria 2790
171 Ga0207679_10015287 3300025945 Bacteria 5067
172 Ga0207679_10176145 3300025945 Bacteria 1765
173 Ga0207679_10249282 3300025945 Bacteria 1509
174 Ga0207651_12109320 3300025960 Bacteria 506
175 Ga0207668_10031238 3300025972 Bacteria 3506
176 Ga0207668_10128744 3300025972 Bacteria 1930
177 Ga0207668_11157307 3300025972 Bacteria 694
178 Ga0207658_10081287 3300025986 Bacteria 2485
179 Ga0207677_10558977 3300026023 Bacteria 998
180 Ga0207678_10019860 3300026067 Bacteria 5905
181 Ga0207678_10209004 3300026067 Bacteria 1669
182 Ga0207678_11323576 3300026067 Bacteria 637
183 Ga0207708_10099660 3300026075 Bacteria 2247
184 Ga0207708_11213782 3300026075 Bacteria 660
185 Ga0207708_11843690 3300026075 Bacteria 530
186 Ga0207648_10470019 3300026089 Bacteria 1147
187 Ga0207675_100068243 3300026118 Bacteria 3324
188 Ga0207675_100312785 3300026118 Bacteria 1532
189 Ga0207675_100496635 3300026118 Bacteria 1214
190 Ga0207683_10034727 3300026121 Bacteria 4383
191 Ga0207683_11405423 3300026121 Bacteria 645
192 Ga0209982_1026118 3300027552 Bacteria 910
193 Ga0209983_1021229 3300027665 Bacteria 1356
194 Ga0209983_1033481 3300027665 Bacteria 1099
195 Ga0209971_1016732 3300027682 Bacteria 1739
196 Ga0209971_1153582 3300027682 Bacteria 568
197 Ga0209966_1154082 3300027695 Bacteria 535
198 Ga0209813_10055575 3300027866 Bacteria 1251
199 Ga0209813_10055941 3300027866 Bacteria 1247
200 Ga0207428_10002366 3300027907 Bacteria 18833
201 Ga0207428_10007033 3300027907 Bacteria 10302
202 Ga0207428_10009715 3300027907 Bacteria 8620
203 Ga0207428_10020105 3300027907 Bacteria 5680
204 Ga0207428_10020686 3300027907 Bacteria 5583
205 Ga0207428_10615005 3300027907 Bacteria 782
206 Ga0268266_10033252 3300028379 Bacteria 4385
207 Ga0268266_10062023 3300028379 Bacteria 3225
208 Ga0268266_11179144 3300028379 Bacteria 741
209 Ga0268266_11278395 3300028379 Archaea 709
210 Ga0268264_11347362 3300028381 Unclassified 724
211 Ga0268264_11581064 3300028381 Bacteria 666
212 Ga0307408_100000763 3300031548 Bacteria 25884
213 Ga0307408_100003355 3300031548 Bacteria 10997
214 Ga0307408_100076046 3300031548 Bacteria 2496
215 Ga0307408_100272802 3300031548 Bacteria 1405
216 Ga0307408_102341002 3300031548 Unclassified 518
217 Ga0307405_10001197 3300031731 Bacteria 10735
218 Ga0307405_10137089 3300031731 Bacteria 1700
219 Ga0307405_10358604 3300031731 Bacteria 1127
220 Ga0307413_10021894 3300031824 Bacteria 3432
221 Ga0307413_10173555 3300031824 Bacteria 1529
222 Ga0307413_10639456 3300031824 Bacteria 876
223 Ga0307410_10001916 3300031852 Bacteria 9748
224 Ga0307410_10040241 3300031852 Bacteria 3075
225 Ga0307410_10040253 3300031852 Bacteria 3074
226 Ga0307410_10364314 3300031852 Bacteria 1158
227 Ga0307410_11356968 3300031852 Bacteria 623
228 Ga0307406_10106844 3300031901 Bacteria 1918
229 Ga0307406_10122432 3300031901 Bacteria 1811
230 Ga0307406_10863086 3300031901 Bacteria 768
231 Ga0307407_10000745 3300031903 Bacteria 10677
232 Ga0307407_10015445 3300031903 Bacteria 3775
233 Ga0307407_10024860 3300031903 Bacteria 3148
234 Ga0307407_10068039 3300031903 Bacteria 2108
235 Ga0307407_10103016 3300031903 Bacteria 1776
236 Ga0307407_10127548 3300031903 Bacteria 1623
237 Ga0307407_10226612 3300031903 Bacteria 1267
238 Ga0307412_10001455 3300031911 Bacteria 13170
239 Ga0307412_10018502 3300031911 Bacteria 4194
240 Ga0307409_100002587 3300031995 Bacteria 9507
241 Ga0307409_100019409 3300031995 Bacteria 4602
242 Ga0307409_100039445 3300031995 Bacteria 3504
243 Ga0307409_100210751 3300031995 Bacteria 1746
244 Ga0307409_100376493 3300031995 Bacteria 1348
245 Ga0307409_100509885 3300031995 Bacteria 1173
246 Ga0307409_100515222 3300031995 Bacteria 1167
247 Ga0307409_101477565 3300031995 Bacteria 707
248 Ga0307409_101538323 3300031995 Bacteria 693
249 Ga0307409_102119930 3300031995 Bacteria 592
250 Ga0307416_100001088 3300032002 Bacteria 14523
251 Ga0307416_100334105 3300032002 Bacteria 1524
252 Ga0307416_100389632 3300032002 Bacteria 1427
253 Ga0307416_100978348 3300032002 Bacteria 949
254 Ga0307416_102783681 3300032002 Bacteria 585
255 Ga0307414_10011664 3300032004 Bacteria 5165
256 Ga0307414_10039874 3300032004 Bacteria 3168
257 Ga0307414_10042851 3300032004 Bacteria 3079
258 Ga0307414_10308504 3300032004 Bacteria 1342
259 Ga0307414_10541375 3300032004 Bacteria 1036
260 Ga0307414_11085708 3300032004 Bacteria 739
261 Ga0307414_12104684 3300032004 Archaea 527
262 Ga0307411_10000324 3300032005 Bacteria 15938
263 Ga0307411_10012542 3300032005 Bacteria 4632
264 Ga0307411_10077416 3300032005 Bacteria 2276
265 Ga0307411_11520876 3300032005 Bacteria 616
266 Ga0307415_100000372 3300032126 Bacteria 19154
267 Ga0307415_100083366 3300032126 Bacteria 2290
268 Ga0307415_101743958 3300032126 Bacteria 601
269 Ga0307415_101972132 3300032126 Unclassified 568
270 Ga0439439_0108224 3300041406 Bacteria 769
271 Ga0439439_0121535 3300041406 Bacteria 728
272 Ga0439439_0167163 3300041406 Bacteria 629
273 Ga0439453_0184183 3300041408 Bacteria 511
274 Ga0439453_0184713 3300041408 Bacteria 510
275 Ga0451798_0943391 3300041458 Bacteria 754
276 Ga0451802_1905569 3300041460 Bacteria 617
277 Ga0451807_0508395 3300041486 Unclassified 1154
278 Ga0451807_1813522 3300041486 Unclassified 563
279 Ga0451853_0122650 3300041512 Bacteria 1476
280 Ga0451853_0964295 3300041512 Bacteria 885
281 Ga0451853_1096210 3300041512 Bacteria 1521
282 Ga0439433_0018878 3300041999 Bacteria 1536
283 Ga0439445_0252106 3300042004 Unclassified 527
284 Ga0439450_025297 3300042008 Bacteria 1300
285 Ga0439455_0146415 3300042012 Unclassified 671
286 Ga0439456_050313 3300042013 Bacteria 910
287 Ga0439462_0142077 3300042015 Bacteria 673
288 Ga0450920_010176 3300042122 Bacteria 1741
289 Ga0450894_030380 3300042131 Bacteria 752
290 Ga0450896_000985 3300042133 Bacteria 3317
291 Ga0450906_009238 3300042145 Bacteria 1882
292 Ga0439446_0040279 3300042156 Bacteria 1375
293 Ga0439446_0137388 3300042156 Bacteria 796
294 Ga0450908_028325 3300042184 Bacteria 975
295 Ga0439434_0017990 3300042435 Bacteria 2115
296 Ga0439434_0150437 3300042435 Bacteria 770
297 Ga0439434_0236396 3300042435 Bacteria 623
298 Ga0439435_0055218 3300042436 Bacteria 1145
299 Ga0439435_0094416 3300042436 Bacteria 912
300 Ga0439435_0125165 3300042436 Bacteria 808
301 Ga0439464_0004131 3300042439 Bacteria 3697
302 Ga0439464_0008528 3300042439 Bacteria 2686
303 Ga0439464_0082690 3300042439 Bacteria 961
304 Ga0439460_0037240 3300042461 Bacteria 1414
305 Ga0450918_021941 3300042531 Bacteria 1115
306 Ga0451576_0135924 3300045051 Bacteria 2564
307 Ga0496101_1408976 3300048904 Unclassified 544
308 Ga0496106_0466224 3300048909 Bacteria 1015
309 Ga0496110_0350071 3300048913 Bacteria 1346
310 Ga0496114_0635957 3300048917 Bacteria 939
311 Ga0501291_083213 3300049514 Bacteria 641
312 Ga0501296_007316 3300049519 Bacteria 1265
313 Ga0501299_003425 3300049522 Bacteria 2297
314 Ga0501300_045778 3300049523 Bacteria 667
315 Ga0501031_0876969 3300049568 Bacteria 575
316 Ga0501032_0179537 3300049569 Bacteria 1386
317 Ga0501032_0431624 3300049569 Bacteria 845
318 Ga0501033_0650717 3300049570 Bacteria 720
319 Ga0501034_0401274 3300049571 Bacteria 1294
320 Ga0501036_0019667 3300049572 Bacteria 5669
321 Ga0501036_0140664 3300049572 Bacteria 2037
322 Ga0501036_0276913 3300049572 Archaea 1404
323 Ga0501036_0956038 3300049572 Bacteria 702
324 Ga0501036_0967242 3300049572 Bacteria 697
325 Ga0501036_0978202 3300049572 Bacteria 693
326 Ga0501036_1142413 3300049572 Bacteria 636
327 Ga0501036_1360686 3300049572 Bacteria 576
328 Ga0501037_0636444 3300049573 Bacteria 714
329 Ga0501039_0731329 3300049575 Bacteria 773
330 Ga0501039_0833601 3300049575 Bacteria 719
331 Ga0501039_1171964 3300049575 Bacteria 595
332 Ga0501039_1226217 3300049575 Bacteria 580
333 Ga0501040_0485046 3300049576 Bacteria 891
334 Ga0501040_0549081 3300049576 Bacteria 834
335 Ga0501041_0021755 3300049577 Bacteria 3841
336 Ga0501041_0937979 3300049577 Bacteria 556
337 Ga0501041_1073050 3300049577 Bacteria 519
338 Ga0501041_1129507 3300049577 Bacteria 505
339 Ga0501042_0110562 3300049578 Bacteria 1979
340 Ga0501042_0203581 3300049578 Bacteria 1427
341 Ga0501042_0296021 3300049578 Bacteria 1169
342 Ga0501042_0375617 3300049578 Bacteria 1029
343 Ga0501042_0515014 3300049578 Bacteria 869
344 Ga0501042_0825920 3300049578 Bacteria 675
345 Ga0501042_1033800 3300049578 Unclassified 599
346 Ga0501046_0439579 3300049580 Bacteria 939
347 Ga0501048_0012255 3300049582 Bacteria 6381
348 Ga0501048_0174609 3300049582 Bacteria 1523
349 Ga0501048_0686657 3300049582 Bacteria 735
350 Ga0501048_0720024 3300049582 Bacteria 717
351 Ga0501048_0857675 3300049582 Bacteria 653
352 Ga0501067_0032113 3300049583 Bacteria 2914
353 Ga0501068_0056156 3300049584 Bacteria 2387
354 Ga0501068_1206670 3300049584 Bacteria 501
355 Ga0501069_0101790 3300049585 Bacteria 1631
356 Ga0501069_0215527 3300049585 Bacteria 1115
357 Ga0501069_0627139 3300049585 Bacteria 646
358 Ga0501070_0238070 3300049586 Bacteria 1490
359 Ga0501070_0667994 3300049586 Bacteria 824
360 Ga0501071_0015901 3300049587 Bacteria 5168
361 Ga0501071_0040236 3300049587 Bacteria 3345
362 Ga0501071_0107651 3300049587 Bacteria 2058
363 Ga0501071_0138115 3300049587 Bacteria 1814
364 Ga0501071_0295717 3300049587 Bacteria 1227
365 Ga0501071_0475037 3300049587 Bacteria 958
366 Ga0501071_1039719 3300049587 Bacteria 633
367 Ga0501072_0019968 3300049588 Bacteria 5187
368 Ga0501072_0046831 3300049588 Bacteria 3404
369 Ga0501072_0476339 3300049588 Archaea 988
370 Ga0501072_1342089 3300049588 Bacteria 554
371 Ga0501073_0017348 3300049589 Bacteria 5214
372 Ga0501073_0045804 3300049589 Bacteria 3080
373 Ga0501073_0146256 3300049589 Bacteria 1638
374 Ga0501073_0892760 3300049589 Unclassified 612
375 Ga0501074_0054886 3300049590 Bacteria 2873
376 Ga0501075_0018773 3300049591 Bacteria 5011
377 Ga0501075_0059259 3300049591 Bacteria 2884
378 Ga0501075_0189851 3300049591 Bacteria 1567
379 Ga0501075_0418702 3300049591 Bacteria 1021
380 Ga0501075_0897540 3300049591 Bacteria 674
381 Ga0501076_0004795 3300049592 Bacteria 9651
382 Ga0501076_0007991 3300049592 Bacteria 7723
383 Ga0501076_0079308 3300049592 Bacteria 2635
384 Ga0501076_0200327 3300049592 Bacteria 1630
385 Ga0501076_0318559 3300049592 Bacteria 1276
386 Ga0501076_0499233 3300049592 Bacteria 1003
387 Ga0501076_0673852 3300049592 Bacteria 854
388 Ga0501077_0026655 3300049593 Bacteria 3668
389 Ga0501216_130631 3300049660 Bacteria 582
390 Ga0501261_008277 3300049690 Bacteria 1342
391 Ga0501079_0314004 3300049741 Bacteria 1227
392 Ga0501079_0517289 3300049741 Bacteria 938
393 Ga0501079_0747436 3300049741 Bacteria 770
394 Ga0501079_1095311 3300049741 Bacteria 628
395 Ga0501080_0090066 3300049742 Bacteria 2850
396 Ga0501080_0150148 3300049742 Bacteria 2154
397 Ga0501080_0170433 3300049742 Archaea 2008
398 Ga0501080_0773120 3300049742 Bacteria 843
399 Ga0501080_0987241 3300049742 Bacteria 731
400 Ga0501080_1851248 3300049742 Bacteria 506
401 Ga0501081_0057667 3300049743 Bacteria 2686
402 Ga0501081_0109686 3300049743 Bacteria 1958
403 Ga0501081_0139011 3300049743 Bacteria 1740
404 Ga0501081_0166515 3300049743 Bacteria 1590
405 Ga0501081_1270443 3300049743 Bacteria 558
406 Ga0501081_1534358 3300049743 Archaea 506
407 Ga0501264_040650 3300049761 Bacteria 569
408 Ga0501268_029095 3300049765 Archaea 991
409 Ga0501283_007466 3300049779 Bacteria 1557
410 Ga0501035_1180391 3300049822 Bacteria 595
411 Ga0501045_0037348 3300049824 Bacteria 3530
412 nmdc:mga03683_21254_c1 3300050489 Bacteria 2499
413 nmdc:mga03n38_20844_c1 3300050490 Bacteria 2628
414 nmdc:mga00v17_278739_c1 3300050491 Bacteria 1085
415 nmdc:mga00v17_535156_c1 3300050491 Bacteria 758
416 nmdc:mga00v17_60873_c2 3300050491 Bacteria 1434
417 nmdc:mga00v17_6747_c1 3300050491 Bacteria 6099
418 nmdc:mga00v17_734394_c1 3300050491 Bacteria 632
419 nmdc:mga00v17_818537_c1 3300050491 Unclassified 593
420 nmdc:mga0yw44_74218_c1 3300050492 Bacteria 2118
421 nmdc:mga0k408_20378_c1 3300050493 Bacteria 3714
422 nmdc:mga0k408_24557_c1 3300050493 Bacteria 3408
423 nmdc:mga06z11_101969_c1 3300050494 Bacteria 1576
424 nmdc:mga06z11_154252_c1 3300050494 Bacteria 1308
425 nmdc:mga06z11_22772_c1 3300050494 Bacteria 2931
426 nmdc:mga06z11_32684_c1 3300050494 Bacteria 2539
427 nmdc:mga06z11_73246_c1 3300050494 Bacteria 1818
428 nmdc:mga04h51_4586_c1 3300050495 Bacteria 3454
429 nmdc:mga04h51_66811_c1 3300050495 Bacteria 1246
430 nmdc:mga07m45_41382_c2 3300050496 Bacteria 2265
431 nmdc:mga07m45_9158_c1 3300050496 Bacteria 5118
432 nmdc:mga05p37_1446190_c1 3300050507 Bacteria 689
433 nmdc:mga05p37_9592_c1 3300050507 Bacteria 11464
434 nmdc:mga09592_3651_c1 3300050508 Bacteria 12407
435 nmdc:mga0qj67_251453_c1 3300050509 Bacteria 1434
436 nmdc:mga0qj67_67912_c1 3300050509 Bacteria 2841
437 nmdc:mga06r32_25166_c1 3300050510 Bacteria 5533
438 nmdc:mga06r32_26168_c1 3300050510 Bacteria 5436
439 nmdc:mga06r32_433469_c1 3300050510 Bacteria 1295
440 nmdc:mga08y16_1639_c1 3300050511 Bacteria 22669
441 nmdc:mga08y16_195_c1 3300050511 Bacteria 54659
442 nmdc:mga08y16_209_c1 3300050511 Bacteria 52522
443 nmdc:mga08y16_2237_c1 3300050511 Bacteria 19836
444 nmdc:mga08y16_28022_c1 3300050511 Bacteria 5938
445 nmdc:mga08y16_4564_c1 3300050511 Bacteria 14433
446 nmdc:mga0sz30_150248_c1 3300050516 Bacteria 1030
447 Ga0500641_0001878 3300053096 Bacteria 7458
448 Ga0501084_0014833 3300054114 Bacteria 6462
449 Ga0501084_0158355 3300054114 Bacteria 1910
450 Ga0501084_0206923 3300054114 Bacteria 1656
451 Ga0590077_160012 3300059426 Bacteria 540
452 Ga0501082_0400567 3300060353 Bacteria 1198
453 Ga0501082_0708442 3300060353 Bacteria 881
454 Ga0501082_1041168 3300060353 Unclassified 716
455 Ga0501082_1501413 3300060353 Bacteria 588
456 Ga0530510_0086088 3300061734 Bacteria 2290
457 Ga0530510_0714505 3300061734 Bacteria 764
458 Ga0530510_1012187 3300061734 Viruses 636
459 Ga0530510_1012839 3300061734 Bacteria 636
460 Ga0501302_029969
461 Ga0065712_10005605
462 Ga0065712_10094795
463 Ga0065712_10135227
464 Ga0065712_10159233
465 Ga0065712_10708509
466 Ga0065715_10109553
467 Ga0070658_10161798
468 Ga0070676_10318601
469 Ga0070670_100002793
470 Ga0070670_100368159
471 Ga0070670_100739517
472 Ga0070677_10049345
473 Ga0070677_10295539
474 Ga0070677_10311477
475 Ga0068869_100032228
476 Ga0070666_11097621
477 Ga0068868_100601456
478 Ga0068868_100785583
479 Ga0070661_100060189
480 Ga0070668_100663440
481 Ga0070669_100680857
482 Ga0070675_100371244
483 Ga0070675_100827921
484 Ga0070675_100839634
485 Ga0070675_100870097
486 Ga0070675_101035126
487 Ga0070675_101180269
488 Ga0070671_100376910
489 Ga0070671_101113937
490 Ga0070674_100701380
491 Ga0070674_100784507
492 Ga0070673_100011805
493 Ga0070673_100620509
494 Ga0070673_102272243
495 Ga0070659_100444677
496 Ga0070705_100557659
497 Ga0070700_100251735
498 Ga0070700_100441598
499 Ga0070700_100707795
500 Ga0070700_101862388
501 Ga0070663_100098767
502 Ga0070663_100243258
503 Ga0070663_101218128
504 Ga0070663_102057734
505 Ga0070678_100105960
506 Ga0070678_100117087
507 Ga0070678_100386139
508 Ga0070678_100995883
509 Ga0070662_100466971
510 Ga0070662_100977900
511 Ga0070662_101087158
512 Ga0068867_100230163
513 Ga0070672_100145434
514 Ga0070672_100361437
515 Ga0070672_100453143
516 Ga0070672_100597585
517 Ga0070686_100104332
518 Ga0070696_101566538
519 Ga0070665_100039718
520 Ga0070665_100047750
521 Ga0070665_100827227
522 Ga0070665_101491020
523 Ga0070665_102640757
524 Ga0070664_100008355
525 Ga0070664_100022042
526 Ga0070664_101086699
527 Ga0070664_101896224
528 Ga0068854_100110822
529 Ga0068854_101521125
530 Ga0070702_100242082
531 Ga0068859_102495855
532 Ga0068864_100051261
533 Ga0068864_100066339
534 Ga0068861_100180928
535 Ga0068861_100889626
536 Ga0068861_101324004
537 Ga0068870_10398535
538 Ga0068863_100115477
539 Ga0068860_101763103
540 Ga0081538_10080218
541 Ga0075365_11086672
542 Ga0075368_10010659
543 Ga0075368_10012636
544 Ga0075368_10091241
545 Ga0075363_100019894
546 Ga0075364_10006616
547 Ga0075364_10009895
548 Ga0075364_10672168
549 Ga0075364_10766566
550 Ga0075362_10000713
551 Ga0075367_10004088
552 Ga0075367_10004938
553 Ga0075367_10212462
554 Ga0075367_10214832
555 Ga0075367_10945115
556 Ga0075369_10244304
557 Ga0075366_10013802
558 Ga0075366_10024464
559 Ga0075366_10026591
560 Ga0075366_10313784
561 Ga0097621_100105126
562 Ga0097621_100527797
563 Ga0075370_10025079
564 Ga0075370_10154816
565 Ga0068871_100188236
566 Ga0068871_100415042
567 Ga0068871_101508429
568 Ga0075428_100003380
569 Ga0075428_100255931
570 Ga0075430_100002854
571 Ga0075430_100580127
572 Ga0075430_100752587
573 Ga0075430_101524447
574 Ga0075431_100064204
575 Ga0075431_100589164
576 Ga0075429_100021320
577 Ga0097620_102495930
578 Ga0111539_10000435
579 Ga0111539_10001942
580 Ga0111539_10003663
581 Ga0111539_10005117
582 Ga0111539_10013016
583 Ga0111539_10043970
584 Ga0111539_10376673
585 Ga0114129_10010365
586 Ga0114129_11262922
587 Ga0105242_11210610
588 Ga0105248_10010570
589 Ga0105238_10156237
590 Ga0105249_10018171
591 Ga0157319_1027881
592 Ga0157375_10456630
593 Ga0157375_12257700
594 Ga0163163_10009141
595 Ga0157380_10249294
596 Ga0157380_10393435
597 Ga0157380_10533803
598 Ga0157377_10110364
599 Ga0157377_10405576
600 Ga0157377_11691510
601 Ga0157376_10970218
602 Ga0163161_10270655
603 Ga0207682_10034734
604 Ga0207682_10038277
605 Ga0207645_10667354
606 Ga0207643_10203094
607 Ga0207643_10293918
608 Ga0207643_10328311
609 Ga0207705_10252518
610 Ga0207649_10062837
611 Ga0207649_10973554
612 Ga0207681_10298091
613 Ga0207681_10872562
614 Ga0207650_10032556
615 Ga0207650_10078521
616 Ga0207650_10740694
617 Ga0207659_10291895
618 Ga0207659_10397076
619 Ga0207659_10502754
620 Ga0207659_10541049
621 Ga0207690_10381914
622 Ga0207706_10241319
623 Ga0207669_10117466
624 Ga0207704_10574880
625 Ga0207691_10030934
626 Ga0207691_10937213
627 Ga0207691_11763955
628 Ga0207711_10087897
629 Ga0207689_10074432
630 Ga0207679_10015287
631 Ga0207679_10176145
632 Ga0207679_10249282
633 Ga0207651_12109320
634 Ga0207668_10031238
635 Ga0207668_10128744
636 Ga0207668_11157307
637 Ga0207658_10081287
638 Ga0207677_10558977
639 Ga0207678_10019860
640 Ga0207678_10209004
641 Ga0207678_11323576
642 Ga0207708_10099660
643 Ga0207708_11213782
644 Ga0207708_11843690
645 Ga0207648_10470019
646 Ga0207675_100068243
647 Ga0207675_100312785
648 Ga0207675_100496635
649 Ga0207683_10034727
650 Ga0207683_11405423
651 Ga0209982_1026118
652 Ga0209983_1021229
653 Ga0209983_1033481
654 Ga0209971_1016732
655 Ga0209971_1153582
656 Ga0209966_1154082
657 Ga0209813_10055575
658 Ga0209813_10055941
659 Ga0207428_10002366
660 Ga0207428_10007033
661 Ga0207428_10009715
662 Ga0207428_10020105
663 Ga0207428_10020686
664 Ga0207428_10615005
665 Ga0268266_10033252
666 Ga0268266_10062023
667 Ga0268266_11179144
668 Ga0268266_11278395
669 Ga0268264_11347362
670 Ga0268264_11581064
671 Ga0307408_100000763
672 Ga0307408_100003355
673 Ga0307408_100076046
674 Ga0307408_100272802
675 Ga0307408_102341002
676 Ga0307405_10001197
677 Ga0307405_10137089
678 Ga0307405_10358604
679 Ga0307413_10021894
680 Ga0307413_10173555
681 Ga0307413_10639456
682 Ga0307410_10001916
683 Ga0307410_10040241
684 Ga0307410_10040253
685 Ga0307410_10364314
686 Ga0307410_11356968
687 Ga0307406_10106844
688 Ga0307406_10122432
689 Ga0307406_10863086
690 Ga0307407_10000745
691 Ga0307407_10015445
692 Ga0307407_10024860
693 Ga0307407_10068039
694 Ga0307407_10103016
695 Ga0307407_10127548
696 Ga0307407_10226612
697 Ga0307412_10001455
698 Ga0307412_10018502
699 Ga0307409_100002587
700 Ga0307409_100019409
701 Ga0307409_100039445
702 Ga0307409_100210751
703 Ga0307409_100376493
704 Ga0307409_100509885
705 Ga0307409_100515222
706 Ga0307409_101477565
707 Ga0307409_101538323
708 Ga0307409_102119930
709 Ga0307416_100001088
710 Ga0307416_100334105
711 Ga0307416_100389632
712 Ga0307416_100978348
713 Ga0307416_102783681
714 Ga0307414_10011664
715 Ga0307414_10039874
716 Ga0307414_10042851
717 Ga0307414_10308504
718 Ga0307414_10541375
719 Ga0307414_11085708
720 Ga0307414_12104684
721 Ga0307411_10000324
722 Ga0307411_10012542
723 Ga0307411_10077416
724 Ga0307411_11520876
725 Ga0307415_100000372
726 Ga0307415_100083366
727 Ga0307415_101743958
728 Ga0307415_101972132
729 Ga0439439_0108224
730 Ga0439439_0121535
731 Ga0439439_0167163
732 Ga0439453_0184183
733 Ga0439453_0184713
734 Ga0451798_0943391
735 Ga0451802_1905569
736 Ga0451807_0508395
737 Ga0451807_1813522
738 Ga0451853_0122650
739 Ga0451853_0964295
740 Ga0451853_1096210
741 Ga0439433_0018878
742 Ga0439445_0252106
743 Ga0439450_025297
744 Ga0439455_0146415
745 Ga0439456_050313
746 Ga0439462_0142077
747 Ga0450920_010176
748 Ga0450894_030380
749 Ga0450896_000985
750 Ga0450906_009238
751 Ga0439446_0040279
752 Ga0439446_0137388
753 Ga0450908_028325
754 Ga0439434_0017990
755 Ga0439434_0150437
756 Ga0439434_0236396
757 Ga0439435_0055218
758 Ga0439435_0094416
759 Ga0439435_0125165
760 Ga0439464_0004131
761 Ga0439464_0008528
762 Ga0439464_0082690
763 Ga0439460_0037240
764 Ga0450918_021941
765 Ga0451576_0135924
766 Ga0496101_1408976
767 Ga0496106_0466224
768 Ga0496110_0350071
769 Ga0496114_0635957
770 Ga0501291_083213
771 Ga0501296_007316
772 Ga0501299_003425
773 Ga0501300_045778
774 Ga0501031_0876969
775 Ga0501032_0179537
776 Ga0501032_0431624
777 Ga0501033_0650717
778 Ga0501034_0401274
779 Ga0501036_0019667
780 Ga0501036_0140664
781 Ga0501036_0276913
782 Ga0501036_0956038
783 Ga0501036_0967242
784 Ga0501036_0978202
785 Ga0501036_1142413
786 Ga0501036_1360686
787 Ga0501037_0636444
788 Ga0501039_0731329
789 Ga0501039_0833601
790 Ga0501039_1171964
791 Ga0501039_1226217
792 Ga0501040_0485046
793 Ga0501040_0549081
794 Ga0501041_0021755
795 Ga0501041_0937979
796 Ga0501041_1073050
797 Ga0501041_1129507
798 Ga0501042_0110562
799 Ga0501042_0203581
800 Ga0501042_0296021
801 Ga0501042_0375617
802 Ga0501042_0515014
803 Ga0501042_0825920
804 Ga0501042_1033800
805 Ga0501046_0439579
806 Ga0501048_0012255
807 Ga0501048_0174609
808 Ga0501048_0686657
809 Ga0501048_0720024
810 Ga0501048_0857675
811 Ga0501067_0032113
812 Ga0501068_0056156
813 Ga0501068_1206670
814 Ga0501069_0101790
815 Ga0501069_0215527
816 Ga0501069_0627139
817 Ga0501070_0238070
818 Ga0501070_0667994
819 Ga0501071_0015901
820 Ga0501071_0040236
821 Ga0501071_0107651
822 Ga0501071_0138115
823 Ga0501071_0295717
824 Ga0501071_0475037
825 Ga0501071_1039719
826 Ga0501072_0019968
827 Ga0501072_0046831
828 Ga0501072_0476339
829 Ga0501072_1342089
830 Ga0501073_0017348
831 Ga0501073_0045804
832 Ga0501073_0146256
833 Ga0501073_0892760
834 Ga0501074_0054886
835 Ga0501075_0018773
836 Ga0501075_0059259
837 Ga0501075_0189851
838 Ga0501075_0418702
839 Ga0501075_0897540
840 Ga0501076_0004795
841 Ga0501076_0007991
842 Ga0501076_0079308
843 Ga0501076_0200327
844 Ga0501076_0318559
845 Ga0501076_0499233
846 Ga0501076_0673852
847 Ga0501077_0026655
848 Ga0501216_130631
849 Ga0501261_008277
850 Ga0501079_0314004
851 Ga0501079_0517289
852 Ga0501079_0747436
853 Ga0501079_1095311
854 Ga0501080_0090066
855 Ga0501080_0150148
856 Ga0501080_0170433
857 Ga0501080_0773120
858 Ga0501080_0987241
859 Ga0501080_1851248
860 Ga0501081_0057667
861 Ga0501081_0109686
862 Ga0501081_0139011
863 Ga0501081_0166515
864 Ga0501081_1270443
865 Ga0501081_1534358
866 Ga0501264_040650
867 Ga0501268_029095
868 Ga0501283_007466
869 Ga0501035_1180391
870 Ga0501045_0037348
871 nmdc:mga03683_21254_c1
872 nmdc:mga03n38_20844_c1
873 nmdc:mga00v17_278739_c1
874 nmdc:mga00v17_535156_c1
875 nmdc:mga00v17_60873_c2
876 nmdc:mga00v17_6747_c1
877 nmdc:mga00v17_734394_c1
878 nmdc:mga00v17_818537_c1
879 nmdc:mga0yw44_74218_c1
880 nmdc:mga0k408_20378_c1
881 nmdc:mga0k408_24557_c1
882 nmdc:mga06z11_101969_c1
883 nmdc:mga06z11_154252_c1
884 nmdc:mga06z11_22772_c1
885 nmdc:mga06z11_32684_c1
886 nmdc:mga06z11_73246_c1
887 nmdc:mga04h51_4586_c1
888 nmdc:mga04h51_66811_c1
889 nmdc:mga07m45_41382_c2
890 nmdc:mga07m45_9158_c1
891 nmdc:mga05p37_1446190_c1
892 nmdc:mga05p37_9592_c1
893 nmdc:mga09592_3651_c1
894 nmdc:mga0qj67_251453_c1
895 nmdc:mga0qj67_67912_c1
896 nmdc:mga06r32_25166_c1
897 nmdc:mga06r32_26168_c1
898 nmdc:mga06r32_433469_c1
899 nmdc:mga08y16_1639_c1
900 nmdc:mga08y16_195_c1
901 nmdc:mga08y16_209_c1
902 nmdc:mga08y16_2237_c1
903 nmdc:mga08y16_28022_c1
904 nmdc:mga08y16_4564_c1
905 nmdc:mga0sz30_150248_c1
906 Ga0500641_0001878
907 Ga0501084_0014833
908 Ga0501084_0158355
909 Ga0501084_0206923
910 Ga0590077_160012
911 Ga0501082_0400567
912 Ga0501082_0708442
913 Ga0501082_1041168
914 Ga0501082_1501413
915 Ga0530510_0086088
916 Ga0530510_0714505
917 Ga0530510_1012187
918 Ga0530510_1012839

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

4

113

0.97

Map