metagRoot

F448434

General Info

Members	Datasets	Scaffolds	Average Seq Length
459	276	418	311

Family's Representative Sequence

Representative Sequence	3300048912\|Ga0496109_0220316\|Ga0496109_0220316_511_1557
Length	348
Sequence	MNARFIGPNENSFRAADDNQRMNLPLSASGTELLRIDGAVRLDHLGVMRAQGADAASFLHSQLTQDFKVLGLSQARLAAYLSPKGRMLASFVAFRRPRVGDEDESVWLVTDRSTLPASLKRLSMFVLRSKARLSDAGDALSVVGLAGSAADGLLESAGSAPWSKLDRGDASVVRLPQGNGQSRALWVGPAAQSQELLASLAPISSSLWSWLEVRSGVARIQAETVDQFVPQMLNYELVGGVDFQKGCYPGQEIVARSQYRGTLKRRSFLVHGDEAMTPGQEVFWQNDPAQPCGIVAASAANPQGGFDAVAELKLAALDGATLHLGSPGGPILQLLDLPYAVPRDAAAA

Samples

	Sample ID	Description	Type	Environment
1	2511231002	Polaromonas sp. CF318	Isolate	Rhizosphere
2	2513020051	Variovorax sp. CF313	Isolate	Rhizosphere
3	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
4	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
5	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
6	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
7	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
8	2643221654	Rhizobacter sp. Root404	Isolate	Unclassified
9	2643221658	Variovorax sp. Root411	Isolate	Unclassified
10	2643221672	Variovorax sp. Root434	Isolate	Unclassified
11	2643221683	Variovorax sp. Root473	Isolate	Unclassified
12	2738541277	Variovorax sp. GV051	Isolate	Unclassified
13	2738541307	Variovorax sp. GV008	Isolate	Unclassified
14	2738543013	Variovorax sp. BT01	Isolate	Unclassified
15	2738543019	Variovorax sp. GV040	Isolate	Unclassified
16	2818991446	Variovorax sp. 1180	Isolate	Unclassified
17	2831265667	Variovorax guangxiensis DSM 27352	Isolate	Rhizosphere
18	2838054893	Variovorax guangxiensis 34/80	Isolate	Nodule
19	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
20	2842733646	Variovorax sp. R-72446	Isolate	Unclassified
21	2885192300	Variovorax sp. MHTC-1	Isolate	Rhizosphere
22	2885198086	Variovorax sp. 679	Isolate	Unclassified
23	2885211737	Variovorax sp. 553	Isolate	Unclassified
24	2899924645	Variovorax sp. 369	Isolate	Unclassified
25	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
26	2904456579	Variovorax sp. 2002	Isolate	Unclassified
27	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
28	2928037797	Variovorax sp. 1126	Isolate	Unclassified
29	2928044640	Variovorax sp. 1128	Isolate	Unclassified
30	2928051484	Variovorax sp. 1133	Isolate	Unclassified
31	2928064002	Variovorax sp. 1140	Isolate	Rhizosphere
32	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
33	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
34	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
35	2932422444	Comamonas sp. 4034	Isolate	Rhizosphere
36	2939631187	Ottowia thiooxydans 2709	Isolate	Rhizosphere
37	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
38	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
39	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
40	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
41	2954767861	Variovorax sp. TBS-050B	Isolate	Rhizosphere
42	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
43	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
44	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
45	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
46	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
47	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
48	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
49	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
50	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
51	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
52	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
53	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
54	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
55	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
56	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
57	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
58	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
59	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
60	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
61	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
62	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
63	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
64	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
65	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
66	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
67	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
68	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
69	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
70	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
71	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
72	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
73	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
74	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
75	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
76	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
77	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
78	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
79	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
80	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
81	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
82	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
83	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
84	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
85	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
86	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
87	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
88	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
89	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
90	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
91	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
92	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
93	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
94	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
95	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
96	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
97	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
98	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
99	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
100	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
101	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
102	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
103	3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Metagenome	Rhizosphere
104	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
105	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
106	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
107	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
108	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
109	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
110	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
111	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
112	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
113	3300015683	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04	Metagenome	Rhizosphere
114	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
115	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
116	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
117	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
118	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
119	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
120	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
121	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
122	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
123	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
124	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
125	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
126	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
127	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
128	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
129	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
130	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
131	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
132	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
133	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
134	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
135	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
136	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
137	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
138	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
139	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
160	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
161	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
162	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
163	3300030734	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5	Metagenome	Rhizosphere
164	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
165	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
166	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
167	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
168	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
169	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
170	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
171	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
172	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
173	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
174	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
175	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
176	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
177	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
178	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
179	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
180	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
181	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
182	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
183	3300039093	Seagrass microbial communities from Seahorse Key, FL, USA - TH0818	Metagenome	Unclassified
184	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
185	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
186	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
187	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
188	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
189	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
190	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
191	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
192	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
193	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
194	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
195	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
196	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
197	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
198	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
199	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
200	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
201	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
202	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
203	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
204	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
205	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
206	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
207	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
208	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
209	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
210	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
211	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
212	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
213	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
214	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
215	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
216	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
217	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
218	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
219	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
220	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
221	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
222	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
223	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
224	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
225	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
226	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
227	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
228	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
229	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
230	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
231	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
232	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
233	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
234	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
235	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
236	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
237	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
238	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
239	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
240	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
241	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
242	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
243	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
244	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
245	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
246	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
247	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
248	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
249	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
250	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
251	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
252	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
253	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
254	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
255	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
256	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
257	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
258	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
259	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
260	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
261	3300053110	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere	Metagenome	Endosphere
262	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
263	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
264	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
265	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
266	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
267	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
268	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
269	3300053141	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere	Metagenome	Endosphere
270	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
271	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
272	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
273	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
274	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
275	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
276	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	90.41
Metatranscriptomes	0.65
Isolates	8.93

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	41.18
Nodule	0.87
Rhizoplane	3.49
Rhizosphere	40.09
Stem	0
Stem Tuber	0
Unclassified	14.38

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25155J39150_1000036	3300002704	Bacteria	97790
2	JGI25156J39149_1000047	3300002705	Bacteria	97697
3	JGI25154J39366_1000068	3300002738	Bacteria	97697
4	JGI25157J39369_1000066	3300002741	Bacteria	97697
5	JGI25152J39213_1002296	3300002773	Bacteria	7375
6	JGI25150J39212_1001245	3300002774	Bacteria	7375
7	JGI25159J45721_1001201	3300002987	Bacteria	11034
8	JGI25159J45721_1001231	3300002987	Bacteria	10836
9	JGI25159J45721_1003535	3300002987	Bacteria	5500
10	JGI25151J46595_10001581	3300003187	Bacteria	15162
11	JGI25151J46595_10008473	3300003187	Bacteria	4944
12	JGI25151J46595_10014055	3300003187	Bacteria	3582
13	JGI25153J46596_10007849	3300003215	Bacteria	5182
14	rootH1_10027639	3300003316	Bacteria	2550
15	rootL2_10059414	3300003322	Bacteria	11959
16	rootL2_10094195	3300003322	Bacteria	3697
17	rootH1_10038422	3300003323	Bacteria	2484
18	JGI25160J50197_1000145	3300003354	Bacteria	63479
19	JGI25160J50197_1001897	3300003354	Bacteria	10017
20	JGI25161J50226_1000032	3300003374	Bacteria	138440
21	JGI25161J50226_1000064	3300003374	Bacteria	99448
22	JGI25161J50226_1006193	3300003374	Bacteria	2204
23	Ga0006562J51391_1051999	3300003578	Bacteria	4382
24	Ga0006562J51391_1052002	3300003578	Bacteria	1960
25	Ga0006562J51391_1069556	3300003578	Bacteria	1680
26	Ga0055535_1000305	3300003761	Bacteria	49948
27	Ga0055542_1000021	3300003762	Bacteria	331499
28	Ga0055526_1002303	3300003771	Bacteria	13026
29	Ga0055526_1014041	3300003771	Bacteria	3328
30	Ga0055526_1015980	3300003771	Bacteria	2975
31	Ga0055526_1016174	3300003771	Bacteria	2939
32	Ga0055526_1026129	3300003771	Bacteria	1852
33	Ga0055537_1000036	3300003773	Bacteria	96045
34	Ga0055537_1000043	3300003773	Bacteria	90816
35	Ga0055537_1001219	3300003773	Bacteria	10836
36	Ga0055537_1003375	3300003773	Bacteria	4931
37	Ga0055524_1000012	3300003775	Bacteria	260384
38	Ga0055524_1014132	3300003775	Bacteria	2975
39	Ga0055524_1014186	3300003775	Bacteria	2966
40	Ga0055536_1002959	3300003781	Bacteria	9315
41	Ga0055536_1004300	3300003781	Bacteria	7333
42	Ga0055536_1011820	3300003781	Bacteria	3300
43	Ga0055534_1000018	3300003784	Bacteria	138136
44	Ga0055534_1002944	3300003784	Bacteria	5644
45	Ga0055528_1000647	3300003790	Bacteria	25459
46	Ga0055528_1000903	3300003790	Bacteria	20020
47	Ga0055528_1002148	3300003790	Bacteria	10836
48	Ga0055528_1007234	3300003790	Bacteria	4931
49	Ga0055530_10000015	3300003791	Bacteria	148790
50	Ga0055530_10000086	3300003791	Bacteria	80109
51	Ga0055530_10000991	3300003791	Bacteria	22764
52	Ga0055530_10030359	3300003791	Bacteria	1432
53	Ga0055540_1000012	3300003792	Bacteria	262667
54	Ga0055540_1000039	3300003792	Bacteria	161844
55	Ga0055540_1000405	3300003792	Bacteria	34908
56	Ga0055540_1001568	3300003792	Bacteria	13345
57	Ga0055540_1004907	3300003792	Bacteria	5838
58	Ga0055540_1010188	3300003792	Bacteria	3149
59	Ga0055531_10000515	3300003794	Bacteria	34908
60	Ga0055531_10007067	3300003794	Bacteria	6208
61	Ga0055531_10008849	3300003794	Bacteria	5233
62	Ga0055531_10016358	3300003794	Bacteria	3204
63	Ga0055543_1000479	3300004625	Bacteria	23428
64	Ga0055543_1005343	3300004625	Bacteria	3294
65	Ga0065165_1001252	3300005262	Bacteria	28771
66	Ga0065165_1020173	3300005262	Bacteria	2354
67	Ga0065714_10077385	3300005288	Bacteria	2696
68	Ga0070658_10087271	3300005327	Bacteria	2568
69	Ga0070676_10003448	3300005328	Bacteria	8245
70	Ga0070676_10039763	3300005328	Bacteria	2721
71	Ga0070670_100016508	3300005331	Bacteria	6338
72	Ga0070670_100123483	3300005331	Bacteria	2234
73	Ga0068868_100011186	3300005338	Bacteria	6534
74	Ga0070675_100029593	3300005354	Bacteria	4419
75	Ga0070671_100016332	3300005355	Bacteria	6003
76	Ga0070671_100027728	3300005355	Bacteria	4663
77	Ga0070673_100032298	3300005364	Bacteria	3940
78	Ga0070667_100000558	3300005367	Bacteria	36933
79	Ga0070678_100012338	3300005456	Bacteria	5307
80	Ga0070678_100101452	3300005456	Bacteria	2231
81	Ga0070662_100064301	3300005457	Bacteria	2686
82	Ga0070662_100119580	3300005457	Bacteria	2018
83	Ga0068867_100001670	3300005459	Bacteria	15459
84	Ga0068867_100026624	3300005459	Bacteria	4153
85	Ga0070679_100149845	3300005530	Bacteria	2310
86	Ga0068853_100044709	3300005539	Bacteria	3791
87	Ga0070672_100019005	3300005543	Bacteria	4980
88	Ga0070664_100284526	3300005564	Bacteria	1491
89	Ga0068857_100029089	3300005577	Bacteria	4875
90	Ga0068857_100409577	3300005577	Bacteria	1262
91	Ga0068854_100098251	3300005578	Bacteria	2191
92	Ga0068864_100050153	3300005618	Bacteria	3592
93	Ga0068863_100066516	3300005841	Bacteria	3409
94	Ga0068862_100064391	3300005844	Bacteria	3156
95	Ga0075364_10022128	3300006051	Bacteria	4012
96	Ga0075362_10014387	3300006177	Bacteria	3192
97	Ga0075362_10019636	3300006177	Bacteria	2813
98	Ga0075366_10000121	3300006195	Bacteria	32479
99	Ga0075366_10001175	3300006195	Bacteria	12977
100	Ga0075366_10050723	3300006195	Bacteria	2464
101	Ga0075366_10054593	3300006195	Bacteria	2373
102	Ga0075370_10012797	3300006353	Bacteria	4443
103	Ga0075370_10023115	3300006353	Bacteria	3421
104	Ga0075370_10032014	3300006353	Bacteria	2937
105	Ga0075370_10043305	3300006353	Bacteria	2544
106	Ga0075370_10074326	3300006353	Bacteria	1948
107	Ga0075370_10098326	3300006353	Bacteria	1692
108	Ga0075370_10161597	3300006353	Bacteria	1315
109	Ga0068871_100545446	3300006358	Bacteria	1050
110	Ga0068865_100151260	3300006881	Bacteria	1761
111	Ga0099826_10003330	3300006948	Bacteria	10855
112	Ga0099826_10039893	3300006948	Bacteria	3279
113	Ga0105240_10093187	3300009093	Bacteria	3677
114	Ga0105243_10000481	3300009148	Bacteria	40913
115	Ga0105243_10016483	3300009148	Bacteria	5585
116	Ga0105242_10010594	3300009176	Bacteria	7079
117	Ga0105242_10447651	3300009176	Bacteria	1217
118	Ga0105237_10022949	3300009545	Bacteria	6399
119	Ga0105246_10053033	3300011119	Bacteria	2789
120	Ga0105246_10080432	3300011119	Bacteria	2320
121	Ga0157326_1001054	3300012513	Bacteria	3115
122	Ga0157373_10130573	3300013100	Bacteria	1767
123	Ga0157370_10008744	3300013104	Bacteria	10889
124	Ga0157369_10043195	3300013105	Bacteria	4914
125	Ga0163162_10011471	3300013306	Bacteria	8643
126	Ga0157380_10602349	3300014326	Bacteria	1087
127	Ga0182008_10002841	3300014497	Bacteria	10711
128	Ga0182008_10004507	3300014497	Bacteria	8130
129	Ga0182008_10008085	3300014497	Bacteria	5760
130	Ga0182008_10013856	3300014497	Bacteria	4234
131	Ga0157377_10116899	3300014745	Bacteria	1611
132	Ga0182006_1002817	3300015261	Bacteria	9274
133	Ga0182006_1042796	3300015261	Bacteria	1772
134	Ga0182007_10000727	3300015262	Bacteria	18605
135	Ga0182007_10001320	3300015262	Bacteria	13385
136	Ga0183362_10001	3300015683	Bacteria	2046624
137	Ga0163161_10000578	3300017792	Bacteria	29487
138	Ga0209435_100001	3300025206	Bacteria	1424171
139	Ga0209436_106016	3300025208	Bacteria	2708
140	Ga0209436_111567	3300025208	Bacteria	1543
141	Ga0209672_101100	3300025228	Bacteria	11442
142	Ga0209147_100716	3300025229	Bacteria	16796
143	Ga0209258_100058	3300025242	Bacteria	331567
144	Ga0207425_1000087	3300025245	Bacteria	93219
145	Ga0207425_1000861	3300025245	Bacteria	14859
146	Ga0207425_1005711	3300025245	Bacteria	3507
147	Ga0209646_1000001	3300025246	Bacteria	3092932
148	Ga0209026_1000003	3300025250	Bacteria	1060571
149	Ga0209148_1000071	3300025254	Bacteria	331551
150	Ga0209759_1000001	3300025256	Bacteria	2799452
151	Ga0209129_1000007	3300025258	Bacteria	771325
152	Ga0209129_1002386	3300025258	Bacteria	9246
153	Ga0209565_1000004	3300025263	Bacteria	983150
154	Ga0209565_1000038	3300025263	Bacteria	286433
155	Ga0209565_1000075	3300025263	Bacteria	162259
156	Ga0209565_1000407	3300025263	Bacteria	35850
157	Ga0209565_1001142	3300025263	Bacteria	12781
158	Ga0209673_1000066	3300025273	Bacteria	250037
159	Ga0209673_1000080	3300025273	Bacteria	223503
160	Ga0209673_1000357	3300025273	Bacteria	82249
161	Ga0209673_1002015	3300025273	Bacteria	15619
162	Ga0209673_1003648	3300025273	Bacteria	8902
163	Ga0209130_1000082	3300025284	Bacteria	164441
164	Ga0209130_1000094	3300025284	Bacteria	145569
165	Ga0209130_1000131	3300025284	Bacteria	119977
166	Ga0209130_1000137	3300025284	Bacteria	116784
167	Ga0209675_1000061	3300025291	Bacteria	181096
168	Ga0209675_1000074	3300025291	Bacteria	162260
169	Ga0209675_1000102	3300025291	Bacteria	123742
170	Ga0209675_1001838	3300025291	Bacteria	11553
171	Ga0209675_1018037	3300025291	Bacteria	1989
172	Ga0209676_1000005	3300025292	Bacteria	1076001
173	Ga0209676_1000029	3300025292	Bacteria	520536
174	Ga0209676_1000139	3300025292	Bacteria	177886
175	Ga0209676_1000186	3300025292	Bacteria	142440
176	Ga0209676_1000703	3300025292	Bacteria	46688
177	Ga0209676_1001078	3300025292	Bacteria	30809
178	Ga0209676_1012175	3300025292	Bacteria	3406
179	Ga0209676_1013120	3300025292	Bacteria	3204
180	Ga0209025_1000056	3300025294	Bacteria	316188
181	Ga0209025_1000104	3300025294	Bacteria	226895
182	Ga0209025_1004416	3300025294	Bacteria	12237
183	Ga0209025_1008022	3300025294	Bacteria	7690
184	Ga0209025_1054700	3300025294	Bacteria	1551
185	Ga0209564_1000073	3300025295	Bacteria	288080
186	Ga0209564_1000090	3300025295	Bacteria	249298
187	Ga0209564_1000969	3300025295	Bacteria	36292
188	Ga0209564_1001231	3300025295	Bacteria	28910
189	Ga0209564_1005591	3300025295	Bacteria	7089
190	Ga0209564_1038292	3300025295	Bacteria	1336
191	Ga0209758_1000044	3300025297	Bacteria	398448
192	Ga0209758_1010359	3300025297	Bacteria	5593
193	Ga0209758_1022492	3300025297	Bacteria	2886
194	Ga0209050_1000003	3300025298	Bacteria	1609245
195	Ga0209050_1000007	3300025298	Bacteria	1187891
196	Ga0209050_1000250	3300025298	Bacteria	115980
197	Ga0209050_1003639	3300025298	Bacteria	11147
198	Ga0209256_1000001	3300025299	Bacteria	2166974
199	Ga0209256_1000020	3300025299	Bacteria	542402
200	Ga0209256_1000022	3300025299	Bacteria	481843
201	Ga0207426_1000001	3300025302	Bacteria	1341301
202	Ga0207426_1000025	3300025302	Bacteria	532921
203	Ga0207426_1000031	3300025302	Bacteria	460699
204	Ga0207426_1004459	3300025302	Bacteria	6816
205	Ga0209051_1000003	3300025303	Bacteria	1609245
206	Ga0209051_1000036	3300025303	Bacteria	339863
207	Ga0209051_1000160	3300025303	Bacteria	126473
208	Ga0209051_1000213	3300025303	Bacteria	98755
209	Ga0209051_1000257	3300025303	Bacteria	88842
210	Ga0209051_1020453	3300025303	Bacteria	2849
211	Ga0209051_1021786	3300025303	Bacteria	2715
212	Ga0209257_1000011	3300025304	Bacteria	1112630
213	Ga0209257_1000018	3300025304	Bacteria	836016
214	Ga0209257_1000116	3300025304	Bacteria	228733
215	Ga0209257_1000222	3300025304	Bacteria	134717
216	Ga0209257_1003620	3300025304	Bacteria	13011
217	Ga0209257_1012728	3300025304	Bacteria	3844
218	Ga0207655_1005759	3300025728	Bacteria	8346
219	Ga0207645_10004843	3300025907	Bacteria	9885
220	Ga0207645_10007783	3300025907	Bacteria	7540
221	Ga0207650_10328978	3300025925	Bacteria	1253
222	Ga0207659_10018641	3300025926	Bacteria	4553
223	Ga0207644_10019659	3300025931	Bacteria	4586
224	Ga0207644_10083287	3300025931	Bacteria	2368
225	Ga0207706_10016241	3300025933	Bacteria	6725
226	Ga0207706_10148308	3300025933	Bacteria	2064
227	Ga0207706_10161418	3300025933	Bacteria	1970
228	Ga0207709_10002968	3300025935	Bacteria	10339
229	Ga0207704_10135037	3300025938	Bacteria	1716
230	Ga0207691_10033246	3300025940	Bacteria	4801
231	Ga0207711_10011484	3300025941	Bacteria	7362
232	Ga0207679_10069722	3300025945	Bacteria	2647
233	Ga0207651_10006261	3300025960	Bacteria	6205
234	Ga0207651_10065945	3300025960	Bacteria	2542
235	Ga0207658_10000412	3300025986	Bacteria	40643
236	Ga0207677_10046760	3300026023	Bacteria	2900
237	Ga0207639_10035526	3300026041	Bacteria	3688
238	Ga0207641_10032922	3300026088	Bacteria	4306
239	Ga0207648_10002367	3300026089	Bacteria	20334
240	Ga0207648_10029814	3300026089	Bacteria	4837
241	Ga0207674_10039311	3300026116	Bacteria	4905
242	Ga0207683_10005862	3300026121	Bacteria	10536
243	Ga0207698_10342337	3300026142	Bacteria	1409
244	Ga0209282_1000221	3300027666	Bacteria	29591
245	Ga0307515_10000306	3300028794	Bacteria	121448
246	Ga0307515_10148441	3300028794	Bacteria	2467
247	Ga0307512_10164425	3300030522	Bacteria	1290
248	Ga0314311_1089929	3300030733	Bacteria	2666
249	Ga0316179_1007458	3300030734	Bacteria	3038
250	Ga0316178_1153589	3300030735	Bacteria	1234
251	Ga0316183_1039891	3300030742	Bacteria	7261
252	Ga0316181_1017561	3300030744	Bacteria	2211
253	Ga0265327_10028797	3300031251	Bacteria	3169
254	Ga0307513_10000051	3300031456	Bacteria	149733
255	Ga0307513_10018453	3300031456	Bacteria	8334
256	Ga0307509_10171509	3300031507	Bacteria	2048
257	Ga0307408_100006460	3300031548	Bacteria	7773
258	Ga0307408_100182625	3300031548	Bacteria	1683
259	Ga0307408_100266877	3300031548	Bacteria	1419
260	Ga0307516_10000068	3300031730	Bacteria	111515
261	Ga0307516_10000692	3300031730	Bacteria	45835
262	Ga0307516_10002056	3300031730	Bacteria	27419
263	Ga0307405_10001524	3300031731	Bacteria	9813
264	Ga0307413_10323317	3300031824	Bacteria	1179
265	Ga0307406_10003567	3300031901	Bacteria	8482
266	Ga0307412_10009488	3300031911	Bacteria	5586
267	Ga0307412_10079797	3300031911	Bacteria	2258
268	Ga0307409_100046914	3300031995	Bacteria	3274
269	Ga0307416_100015608	3300032002	Bacteria	5252
270	Ga0307416_100048382	3300032002	Bacteria	3373
271	Ga0307416_100145590	3300032002	Bacteria	2162
272	Ga0307416_100340639	3300032002	Bacteria	1512
273	Ga0307414_10269241	3300032004	Bacteria	1426
274	Ga0307411_10215828	3300032005	Bacteria	1485
275	Ga0307415_100005787	3300032126	Bacteria	6600
276	Ga0395905_0062082	3300037471	Bacteria	3495
277	Ga0395905_0074895	3300037471	Bacteria	3172
278	Ga0395905_0146570	3300037471	Bacteria	2221
279	Ga0400483_105589	3300039062	Bacteria	2713
280	Ga0400489_21421	3300039093	Unclassified	2898
281	Ga0436361_0863474	3300039447	Bacteria	30106
282	Ga0439436_0000212	3300041404	Bacteria	14029
283	Ga0439436_0013879	3300041404	Bacteria	2435
284	Ga0439438_028671	3300041405	Bacteria	1496
285	Ga0439439_0007289	3300041406	Bacteria	2584
286	Ga0439447_027243	3300041407	Bacteria	1459
287	Ga0439453_0005707	3300041408	Bacteria	1906
288	Ga0439466_0007229	3300041411	Bacteria	4202
289	Ga0439466_0021575	3300041411	Bacteria	2279
290	Ga0439465_0001922	3300041413	Bacteria	6811
291	Ga0439465_0018958	3300041413	Bacteria	2151
292	Ga0451851_0783330	3300041507	Bacteria	851
293	Ga0439433_0008213	3300041999	Bacteria	2261
294	Ga0439442_009191	3300042002	Bacteria	1999
295	Ga0439442_017864	3300042002	Bacteria	1465
296	Ga0439445_0007193	3300042004	Bacteria	2576
297	Ga0439432_005007	3300042006	Bacteria	4791
298	Ga0439449_0000162	3300042007	Bacteria	22807
299	Ga0439449_0003331	3300042007	Bacteria	6268
300	Ga0439449_0003523	3300042007	Bacteria	6078
301	Ga0439449_0076528	3300042007	Bacteria	1234
302	Ga0439452_000749	3300042010	Bacteria	15562
303	Ga0439462_0004283	3300042015	Bacteria	3473
304	Ga0450923_008704	3300042125	Bacteria	1754
305	Ga0439446_0023025	3300042156	Bacteria	1769
306	Ga0450909_001473	3300042185	Bacteria	3287
307	Ga0450909_005319	3300042185	Bacteria	1852
308	Ga0439434_0004431	3300042435	Bacteria	4105
309	Ga0439434_0004585	3300042435	Bacteria	4045
310	Ga0439434_0026278	3300042435	Bacteria	1758
311	Ga0450918_015841	3300042531	Bacteria	1309
312	Ga0451577_0006355	3300042876	Bacteria	11801
313	Ga0495627_004409	3300046453	Bacteria	5896
314	Ga0495627_007076	3300046453	Bacteria	4344
315	Ga0495629_0076517	3300046459	Bacteria	2337
316	Ga0495638_0014132	3300046460	Bacteria	5406
317	Ga0495639_0021226	3300046475	Bacteria	2841
318	Ga0495606_0128891	3300046507	Bacteria	1506
319	Ga0495610_0090427	3300046512	Bacteria	1388
320	Ga0495616_0001622	3300046513	Bacteria	15416
321	Ga0495628_0197079	3300046516	Bacteria	1519
322	Ga0495631_0000314	3300046518	Bacteria	33596
323	Ga0495637_0008897	3300046520	Bacteria	4914
324	Ga0495637_0016342	3300046520	Bacteria	3470
325	Ga0495654_0008494	3300046530	Bacteria	5667
326	Ga0495656_0000193	3300046615	Bacteria	21880
327	Ga0495625_0000057	3300046660	Bacteria	181623
328	Ga0495625_0010154	3300046660	Bacteria	7818
329	Ga0495661_0081537	3300046665	Bacteria	1864
330	Ga0495588_0013015	3300046674	Bacteria	3953
331	Ga0495670_0035417	3300046691	Bacteria	2488
332	Ga0495670_0074149	3300046691	Bacteria	1726
333	Ga0495670_0125393	3300046691	Bacteria	1336
334	Ga0495671_0001783	3300046692	Bacteria	13918
335	Ga0495676_0025847	3300047321	Bacteria	5061
336	Ga0495676_0056858	3300047321	Bacteria	3090
337	Ga0495686_0003746	3300047472	Bacteria	12938
338	Ga0495593_0024903	3300047673	Bacteria	3312
339	Ga0495593_0038531	3300047673	Bacteria	2581
340	Ga0495614_0011892	3300048089	Bacteria	3825
341	Ga0496100_0024495	3300048903	Bacteria	3682
342	Ga0496101_0005850	3300048904	Bacteria	7869
343	Ga0496102_0022275	3300048905	Bacteria	5613
344	Ga0496104_0001081	3300048907	Bacteria	23265
345	Ga0496105_0031728	3300048908	Bacteria	4332
346	Ga0496106_0002144	3300048909	Bacteria	14740
347	Ga0496107_0048140	3300048910	Bacteria	3071
348	Ga0496109_0220316	3300048912	Bacteria	1784
349	Ga0496110_0027049	3300048913	Bacteria	4914
350	Ga0496110_0042538	3300048913	Bacteria	3965
351	Ga0496111_0049261	3300048914	Bacteria	3037
352	Ga0496112_0136316	3300048915	Bacteria	2424
353	Ga0496113_0097611	3300048916	Bacteria	2273
354	Ga0496116_0025716	3300048919	Bacteria	4322
355	Ga0496116_0143305	3300048919	Bacteria	1340
356	Ga0496117_0028546	3300048920	Bacteria	4319
357	Ga0496117_0039193	3300048920	Bacteria	3500
358	Ga0496118_0016121	3300048921	Bacteria	6872
359	Ga0496118_0039128	3300048921	Bacteria	3788
360	Ga0496118_0089483	3300048921	Bacteria	2125
361	Ga0496121_0042381	3300048924	Bacteria	3960
362	Ga0496121_0269531	3300048924	Bacteria	1171
363	Ga0496123_0051394	3300048926	Bacteria	2745
364	Ga0496123_0127123	3300048926	Bacteria	1420
365	Ga0496124_0008708	3300048927	Bacteria	10546
366	Ga0496124_0114967	3300048927	Bacteria	2160
367	Ga0496124_0289770	3300048927	Bacteria	1189
368	Ga0496125_0008866	3300048928	Bacteria	10448
369	Ga0496125_0041445	3300048928	Bacteria	3935
370	Ga0496125_0104927	3300048928	Bacteria	2068
371	Ga0501038_0519513	3300049574	Bacteria	909
372	Ga0501249_034046	3300049679	Bacteria	1142
373	Ga0501225_0006457	3300049705	Bacteria	3423
374	Ga0501044_0090000	3300049823	Bacteria	3097
375	nmdc:mga03683_1803_c1	3300050489	Bacteria	6494
376	nmdc:mga03683_38727_c1	3300050489	Bacteria	1949
377	nmdc:mga03683_87699_c1	3300050489	Bacteria	1352
378	nmdc:mga00v17_76160_c1	3300050491	Bacteria	2087
379	nmdc:mga0yw44_252100_c1	3300050492	Bacteria	1175
380	nmdc:mga0k408_10715_c1	3300050493	Bacteria	4967
381	nmdc:mga0k408_121992_c1	3300050493	Bacteria	1544
382	nmdc:mga0k408_149647_c1	3300050493	Bacteria	1390
383	nmdc:mga0k408_25037_c1	3300050493	Bacteria	3377
384	nmdc:mga0k408_505_c1	3300050493	Bacteria	21413
385	nmdc:mga06z11_64631_c1	3300050494	Bacteria	1918
386	nmdc:mga07m45_30581_c1	3300050496	Bacteria	2983
387	nmdc:mga07m45_7705_c1	3300050496	Bacteria	5511
388	nmdc:mga07m45_87074_c1	3300050496	Bacteria	1787
389	nmdc:mga07m45_89064_c1	3300050496	Bacteria	1767
390	nmdc:mga07m45_92220_c1	3300050496	Bacteria	1736
391	nmdc:mga07m45_9224_c1	3300050496	Bacteria	4460
392	Ga0500610_0002251	3300053079	Bacteria	6999
393	Ga0500578_0038377	3300053086	Bacteria	3076
394	Ga0500643_004866	3300053087	Bacteria	5928
395	Ga0500647_0046808	3300053091	Bacteria	2079
396	Ga0500651_0000090	3300053093	Bacteria	58811
397	Ga0500571_000014	3300053110	Bacteria	67097
398	Ga0500594_0002517	3300053118	Bacteria	3984
399	Ga0500607_000328	3300053121	Bacteria	44883
400	Ga0500607_022055	3300053121	Bacteria	3582
401	Ga0500655_001389	3300053133	Bacteria	4586
402	Ga0500658_0000018	3300053134	Bacteria	141217
403	Ga0500658_0000322	3300053134	Bacteria	21148
404	Ga0500559_0024628	3300053136	Bacteria	2561
405	Ga0500561_0034283	3300053137	Bacteria	1302
406	Ga0500568_0003081	3300053139	Bacteria	9517
407	Ga0500574_003150	3300053141	Bacteria	2862
408	Ga0500590_001777	3300053148	Bacteria	9087
409	Ga0500616_0007996	3300053153	Bacteria	6630
410	Ga0500627_0001126	3300053158	Bacteria	7324
411	Ga0500634_0022086	3300053161	Bacteria	3450
412	Ga0500634_0040567	3300053161	Bacteria	2530
413	Ga0500636_0110162	3300053177	Bacteria	1557
414	Ga0500645_000155	3300053730	Bacteria	53212
415	Ga0500645_002447	3300053730	Bacteria	8255
416	Ga0500645_008573	3300053730	Bacteria	3482
417	Ga0500645_027351	3300053730	Bacteria	1729
418	Ga0590075_018680	3300059424	Bacteria	1716

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300003323	rootH1_10038422	rootH1_100384222	235
2	3300041507	Ga0451851_0783330	Ga0451851_0783330_31_810	249
3	3300047472	Ga0495686_0003746	Ga0495686_0003746_5971_6936	261
4	3300031730	Ga0307516_10000692	Ga0307516_1000069237	266
5	3300009176	Ga0105242_10010594	Ga0105242_100105944	277
6	3300017792	Ga0163161_10000578	Ga0163161_1000057816	284
7	3300005328	Ga0070676_10003448	Ga0070676_100034482	286
8	3300005331	Ga0070670_100123483	Ga0070670_1001234832	286
9	3300005459	Ga0068867_100026624	Ga0068867_1000266245	286
10	3300006051	Ga0075364_10022128	Ga0075364_100221282	286
11	3300006177	Ga0075362_10019636	Ga0075362_100196363	286
12	3300006948	Ga0099826_10039893	Ga0099826_100398932	286
13	3300050491	nmdc:mga00v17_76160_c1	nmdc:mga00v17_76160_c1_833_1759	286
14	3300050493	nmdc:mga0k408_121992_c1	nmdc:mga0k408_121992_c1_440_1366	286
15	3300053148	Ga0500590_001777	Ga0500590_001777_7785_8702	286
16	iso_pu_bacteria	2932422444	2932425741	288
17	3300014497	Ga0182008_10002841	Ga0182008_100028415	289
18	3300039062	Ga0400483_105589	Ga0400483_105589_177_1211	289
19	3300039093	Ga0400489_21421	Ga0400489_21421_468_1502	289
20	3300049574	Ga0501038_0519513	Ga0501038_0519513_15_887	289
21	iso_pu_bacteria	2643221654	2644304727	289
22	3300005578	Ga0068854_100098251	Ga0068854_1000982512	290
23	3300025292	Ga0209676_1012175	Ga0209676_10121754	290
24	3300025295	Ga0209564_1038292	Ga0209564_10382922	290
25	3300025303	Ga0209051_1020453	Ga0209051_10204533	290
26	3300025907	Ga0207645_10007783	Ga0207645_100077835	290
27	3300025925	Ga0207650_10328978	Ga0207650_103289782	290
28	3300025931	Ga0207644_10019659	Ga0207644_100196595	290
29	3300026089	Ga0207648_10029814	Ga0207648_100298145	290
30	3300031730	Ga0307516_10002056	Ga0307516_1000205618	290
31	3300032002	Ga0307416_100340639	Ga0307416_1003406391	290
32	iso_pu_bacteria	2738541307	2738879584	290
33	3300005327	Ga0070658_10087271	Ga0070658_100872713	291
34	3300005331	Ga0070670_100016508	Ga0070670_1000165083	291
35	3300005355	Ga0070671_100016332	Ga0070671_1000163328	291
36	3300025933	Ga0207706_10148308	Ga0207706_101483082	291
37	3300031995	Ga0307409_100046914	Ga0307409_1000469142	291
38	3300032002	Ga0307416_100048382	Ga0307416_1000483823	291
39	3300032126	Ga0307415_100005787	Ga0307415_1000057878	291
40	3300039447	Ga0436361_0863474	Ga0436361_0863474_17657_18589	291
41	iso_pu_bacteria	2599185214	2599626502	291
42	iso_pu_bacteria	2599185226	2599675566	291
43	iso_pu_bacteria	2599185227	2599684039	291
44	iso_pu_bacteria	2599185229	2599696053	291
45	iso_pu_bacteria	2643221628	2644163323	291
46	iso_pu_bacteria	2643221658	2644327816	291
47	iso_pu_bacteria	2643221672	2644400511	291
48	iso_pu_bacteria	2643221683	2644468389	291
49	iso_pu_bacteria	2738541277	2738717927	291
50	iso_pu_bacteria	2738543019	2739278613	291
51	iso_pu_bacteria	2818991446	2819597456	291
52	iso_pu_bacteria	2831265667	2831266634	291
53	iso_pu_bacteria	2838054893	2838057287	291
54	iso_pu_bacteria	2842677519	2842679572	291
55	iso_pu_bacteria	2842733646	2842734859	291
56	iso_pu_bacteria	2885192300	2885192568	291
57	iso_pu_bacteria	2885198086	2885201343	291
58	iso_pu_bacteria	2885211737	2885214975	291
59	iso_pu_bacteria	2899924645	2899924966	291
60	iso_pu_bacteria	2904449895	2904455671	291
61	iso_pu_bacteria	2904456579	2904462819	291
62	iso_pu_bacteria	2919462493	2919467332	291
63	iso_pu_bacteria	2928037797	2928038910	291
64	iso_pu_bacteria	2928044640	2928045485	291
65	iso_pu_bacteria	2928051484	2928058382	291
66	iso_pu_bacteria	2928064002	2928064037	291
67	iso_pu_bacteria	2928070936	2928071410	291
68	iso_pu_bacteria	2928084124	2928084649	291
69	iso_pu_bacteria	2929520902	2929522659	291
70	iso_pu_bacteria	2945909444	2945912123	291
71	iso_pu_bacteria	2945945610	2945947816	291
72	iso_pu_bacteria	2945972063	2945977339	291
73	iso_pu_bacteria	2945984333	2945985592	291
74	iso_pu_bacteria	2954767861	2954772136	291
75	3300005367	Ga0070667_100000558	Ga0070667_10000055822	292
76	3300014326	Ga0157380_10602349	Ga0157380_106023491	292
77	3300025986	Ga0207658_10000412	Ga0207658_1000041222	292
78	3300028794	Ga0307515_10148441	Ga0307515_101484413	292
79	3300031456	Ga0307513_10018453	Ga0307513_100184532	292
80	3300031507	Ga0307509_10171509	Ga0307509_101715093	292
81	3300031730	Ga0307516_10000068	Ga0307516_1000006879	292
82	3300046453	Ga0495627_004409	Ga0495627_004409_155_1051	292
83	3300046507	Ga0495606_0128891	Ga0495606_0128891_427_1356	292
84	3300048909	Ga0496106_0002144	Ga0496106_0002144_8687_9616	292
85	3300048924	Ga0496121_0269531	Ga0496121_0269531_52_981	292
86	3300048927	Ga0496124_0114967	Ga0496124_0114967_511_1419	292
87	3300053086	Ga0500578_0038377	Ga0500578_0038377_1639_2568	292
88	3300053730	Ga0500645_008573	Ga0500645_008573_814_1743	292
89	3300005328	Ga0070676_10039763	Ga0070676_100397632	293
90	3300005338	Ga0068868_100011186	Ga0068868_1000111863	293
91	3300005354	Ga0070675_100029593	Ga0070675_1000295932	293
92	3300005364	Ga0070673_100032298	Ga0070673_1000322982	293
93	3300005456	Ga0070678_100101452	Ga0070678_1001014522	293
94	3300005459	Ga0068867_100001670	Ga0068867_10000167015	293
95	3300005543	Ga0070672_100019005	Ga0070672_1000190052	293
96	3300005564	Ga0070664_100284526	Ga0070664_1002845262	293
97	3300005577	Ga0068857_100029089	Ga0068857_1000290895	293
98	3300006195	Ga0075366_10054593	Ga0075366_100545932	293
99	3300006881	Ga0068865_100151260	Ga0068865_1001512601	293
100	3300014745	Ga0157377_10116899	Ga0157377_101168992	293
101	3300025907	Ga0207645_10004843	Ga0207645_1000484311	293
102	3300025926	Ga0207659_10018641	Ga0207659_100186414	293
103	3300025933	Ga0207706_10016241	Ga0207706_100162418	293
104	3300025938	Ga0207704_10135037	Ga0207704_101350371	293
105	3300025940	Ga0207691_10033246	Ga0207691_100332464	293
106	3300025960	Ga0207651_10006261	Ga0207651_100062615	293
107	3300026023	Ga0207677_10046760	Ga0207677_100467603	293
108	3300026089	Ga0207648_10002367	Ga0207648_1000236716	293
109	3300026116	Ga0207674_10039311	Ga0207674_100393112	293
110	3300037471	Ga0395905_0062082	Ga0395905_0062082_475_1428	293
111	3300037471	Ga0395905_0146570	Ga0395905_0146570_1224_2174	293
112	3300050493	nmdc:mga0k408_25037_c1	nmdc:mga0k408_25037_c1_1636_2568	293
113	iso_pu_bacteria	2939631187	2939631838	293
114	3300053730	Ga0500645_027351	Ga0500645_027351_762_1688	294
115	3300002773	JGI25152J39213_1002296	JGI25152J39213_10022966	295
116	3300002774	JGI25150J39212_1001245	JGI25150J39212_10012456	295
117	3300002987	JGI25159J45721_1001231	JGI25159J45721_10012318	295
118	3300003187	JGI25151J46595_10001581	JGI25151J46595_1000158112	295
119	3300003187	JGI25151J46595_10008473	JGI25151J46595_100084734	295
120	3300003215	JGI25153J46596_10007849	JGI25153J46596_100078494	295
121	3300003322	rootL2_10094195	rootL2_100941953	295
122	3300003354	JGI25160J50197_1001897	JGI25160J50197_10018978	295
123	3300003374	JGI25161J50226_1006193	JGI25161J50226_10061932	295
124	3300003578	Ga0006562J51391_1051999	Ga0006562J51391_10519993	295
125	3300003578	Ga0006562J51391_1052002	Ga0006562J51391_10520022	295
126	3300003578	Ga0006562J51391_1069556	Ga0006562J51391_10695562	295
127	3300003761	Ga0055535_1000305	Ga0055535_100030536	295
128	3300003762	Ga0055542_1000021	Ga0055542_1000021115	295
129	3300003771	Ga0055526_1015980	Ga0055526_10159803	295
130	3300003771	Ga0055526_1016174	Ga0055526_10161743	295
131	3300003773	Ga0055537_1000036	Ga0055537_100003671	295
132	3300003773	Ga0055537_1001219	Ga0055537_10012198	295
133	3300003773	Ga0055537_1003375	Ga0055537_10033752	295
134	3300003775	Ga0055524_1014132	Ga0055524_10141323	295
135	3300003775	Ga0055524_1014186	Ga0055524_10141863	295
136	3300003781	Ga0055536_1002959	Ga0055536_10029599	295
137	3300003781	Ga0055536_1004300	Ga0055536_10043003	295
138	3300003781	Ga0055536_1011820	Ga0055536_10118203	295
139	3300003784	Ga0055534_1000018	Ga0055534_100001813	295
140	3300003784	Ga0055534_1002944	Ga0055534_10029443	295
141	3300003790	Ga0055528_1000903	Ga0055528_100090314	295
142	3300003790	Ga0055528_1002148	Ga0055528_10021488	295
143	3300003790	Ga0055528_1007234	Ga0055528_10072342	295
144	3300003791	Ga0055530_10000086	Ga0055530_1000008639	295
145	3300003791	Ga0055530_10000991	Ga0055530_100009915	295
146	3300003792	Ga0055540_1000405	Ga0055540_10004058	295
147	3300003792	Ga0055540_1001568	Ga0055540_10015682	295
148	3300003792	Ga0055540_1004907	Ga0055540_10049076	295
149	3300003792	Ga0055540_1010188	Ga0055540_10101884	295
150	3300003794	Ga0055531_10000515	Ga0055531_100005158	295
151	3300003794	Ga0055531_10016358	Ga0055531_100163584	295
152	3300004625	Ga0055543_1000479	Ga0055543_10004792	295
153	3300005262	Ga0065165_1001252	Ga0065165_100125222	295
154	3300005456	Ga0070678_100012338	Ga0070678_1000123387	295
155	3300005577	Ga0068857_100409577	Ga0068857_1004095771	295
156	3300005844	Ga0068862_100064391	Ga0068862_1000643914	295
157	3300006195	Ga0075366_10001175	Ga0075366_100011752	295
158	3300006195	Ga0075366_10050723	Ga0075366_100507233	295
159	3300006353	Ga0075370_10012797	Ga0075370_100127974	295
160	3300006353	Ga0075370_10023115	Ga0075370_100231153	295
161	3300006353	Ga0075370_10032014	Ga0075370_100320142	295
162	3300006353	Ga0075370_10043305	Ga0075370_100433052	295
163	3300006353	Ga0075370_10161597	Ga0075370_101615971	295
164	3300006358	Ga0068871_100545446	Ga0068871_1005454461	295
165	3300006948	Ga0099826_10003330	Ga0099826_100033309	295
166	3300009093	Ga0105240_10093187	Ga0105240_100931872	295
167	3300009148	Ga0105243_10000481	Ga0105243_1000048115	295
168	3300009148	Ga0105243_10016483	Ga0105243_100164834	295
169	3300009176	Ga0105242_10447651	Ga0105242_104476512	295
170	3300009545	Ga0105237_10022949	Ga0105237_100229493	295
171	3300011119	Ga0105246_10053033	Ga0105246_100530332	295
172	3300011119	Ga0105246_10080432	Ga0105246_100804322	295
173	3300013100	Ga0157373_10130573	Ga0157373_101305732	295
174	3300013104	Ga0157370_10008744	Ga0157370_100087442	295
175	3300013105	Ga0157369_10043195	Ga0157369_100431955	295
176	3300013306	Ga0163162_10011471	Ga0163162_100114711	295
177	3300014497	Ga0182008_10004507	Ga0182008_100045074	295
178	3300014497	Ga0182008_10008085	Ga0182008_100080855	295
179	3300014497	Ga0182008_10013856	Ga0182008_100138565	295
180	3300015261	Ga0182006_1002817	Ga0182006_10028177	295
181	3300015261	Ga0182006_1042796	Ga0182006_10427962	295
182	3300015262	Ga0182007_10000727	Ga0182007_100007274	295
183	3300015262	Ga0182007_10001320	Ga0182007_1000132012	295
184	3300015683	Ga0183362_10001	Ga0183362_100011223	295
185	3300025208	Ga0209436_106016	Ga0209436_1060162	295
186	3300025208	Ga0209436_111567	Ga0209436_1115672	295
187	3300025228	Ga0209672_101100	Ga0209672_1011008	295
188	3300025229	Ga0209147_100716	Ga0209147_1007164	295
189	3300025242	Ga0209258_100058	Ga0209258_100058115	295
190	3300025245	Ga0207425_1000087	Ga0207425_100008762	295
191	3300025245	Ga0207425_1005711	Ga0207425_10057112	295
192	3300025254	Ga0209148_1000071	Ga0209148_1000071115	295
193	3300025258	Ga0209129_1000007	Ga0209129_1000007702	295
194	3300025258	Ga0209129_1002386	Ga0209129_10023865	295
195	3300025263	Ga0209565_1000038	Ga0209565_100003896	295
196	3300025263	Ga0209565_1000075	Ga0209565_1000075144	295
197	3300025263	Ga0209565_1001142	Ga0209565_10011427	295
198	3300025273	Ga0209673_1000066	Ga0209673_100006656	295
199	3300025273	Ga0209673_1000080	Ga0209673_1000080164	295
200	3300025273	Ga0209673_1002015	Ga0209673_10020156	295
201	3300025284	Ga0209130_1000131	Ga0209130_100013188	295
202	3300025284	Ga0209130_1000137	Ga0209130_100013763	295
203	3300025291	Ga0209675_1000074	Ga0209675_1000074144	295
204	3300025291	Ga0209675_1000102	Ga0209675_100010249	295
205	3300025291	Ga0209675_1001838	Ga0209675_10018389	295
206	3300025291	Ga0209675_1018037	Ga0209675_10180372	295
207	3300025292	Ga0209676_1000005	Ga0209676_1000005913	295
208	3300025292	Ga0209676_1000139	Ga0209676_100013949	295
209	3300025292	Ga0209676_1000186	Ga0209676_100018699	295
210	3300025292	Ga0209676_1000703	Ga0209676_100070342	295
211	3300025292	Ga0209676_1001078	Ga0209676_100107822	295
212	3300025294	Ga0209025_1000056	Ga0209025_1000056188	295
213	3300025294	Ga0209025_1000104	Ga0209025_100010417	295
214	3300025294	Ga0209025_1008022	Ga0209025_10080223	295
215	3300025295	Ga0209564_1000073	Ga0209564_1000073224	295
216	3300025295	Ga0209564_1000090	Ga0209564_100009039	295
217	3300025297	Ga0209758_1000044	Ga0209758_1000044175	295
218	3300025297	Ga0209758_1022492	Ga0209758_10224923	295
219	3300025298	Ga0209050_1000007	Ga0209050_1000007184	295
220	3300025298	Ga0209050_1000250	Ga0209050_100025065	295
221	3300025299	Ga0209256_1000020	Ga0209256_1000020178	295
222	3300025299	Ga0209256_1000022	Ga0209256_1000022253	295
223	3300025302	Ga0207426_1000001	Ga0207426_1000001813	295
224	3300025302	Ga0207426_1000031	Ga0207426_1000031410	295
225	3300025303	Ga0209051_1000036	Ga0209051_1000036264	295
226	3300025303	Ga0209051_1000160	Ga0209051_100016073	295
227	3300025303	Ga0209051_1000257	Ga0209051_100025782	295
228	3300025303	Ga0209051_1021786	Ga0209051_10217862	295
229	3300025304	Ga0209257_1000011	Ga0209257_1000011887	295
230	3300025304	Ga0209257_1000116	Ga0209257_100011650	295
231	3300025304	Ga0209257_1000222	Ga0209257_1000222114	295
232	3300025304	Ga0209257_1003620	Ga0209257_100362010	295
233	3300026121	Ga0207683_10005862	Ga0207683_100058627	295
234	3300026142	Ga0207698_10342337	Ga0207698_103423372	295
235	3300027666	Ga0209282_1000221	Ga0209282_100022121	295
236	3300030522	Ga0307512_10164425	Ga0307512_101644252	295
237	3300030733	Ga0314311_1089929	Ga0314311_10899292	295
238	3300030734	Ga0316179_1007458	Ga0316179_10074583	295
239	3300030735	Ga0316178_1153589	Ga0316178_11535891	295
240	3300030742	Ga0316183_1039891	Ga0316183_10398918	295
241	3300030744	Ga0316181_1017561	Ga0316181_10175612	295
242	3300031251	Ga0265327_10028797	Ga0265327_100287973	295
243	3300031548	Ga0307408_100182625	Ga0307408_1001826252	295
244	3300031548	Ga0307408_100266877	Ga0307408_1002668772	295
245	3300031731	Ga0307405_10001524	Ga0307405_100015245	295
246	3300031911	Ga0307412_10009488	Ga0307412_100094885	295
247	3300031911	Ga0307412_10079797	Ga0307412_100797972	295
248	3300032002	Ga0307416_100145590	Ga0307416_1001455901	295
249	3300032004	Ga0307414_10269241	Ga0307414_102692412	295
250	3300041404	Ga0439436_0000212	Ga0439436_0000212_12274_13197	295
251	3300041404	Ga0439436_0013879	Ga0439436_0013879_226_1149	295
252	3300041406	Ga0439439_0007289	Ga0439439_0007289_318_1241	295
253	3300041407	Ga0439447_027243	Ga0439447_027243_189_1112	295
254	3300041411	Ga0439466_0007229	Ga0439466_0007229_1739_2662	295
255	3300041411	Ga0439466_0021575	Ga0439466_0021575_706_1629	295
256	3300041413	Ga0439465_0001922	Ga0439465_0001922_4323_5246	295
257	3300041413	Ga0439465_0018958	Ga0439465_0018958_620_1546	295
258	3300041999	Ga0439433_0008213	Ga0439433_0008213_665_1588	295
259	3300042002	Ga0439442_009191	Ga0439442_009191_515_1441	295
260	3300042002	Ga0439442_017864	Ga0439442_017864_197_1120	295
261	3300042004	Ga0439445_0007193	Ga0439445_0007193_286_1209	295
262	3300042006	Ga0439432_005007	Ga0439432_005007_3219_4142	295
263	3300042007	Ga0439449_0000162	Ga0439449_0000162_7883_8806	295
264	3300042007	Ga0439449_0003331	Ga0439449_0003331_1264_2187	295
265	3300042007	Ga0439449_0003523	Ga0439449_0003523_4414_5337	295
266	3300042007	Ga0439449_0076528	Ga0439449_0076528_185_1111	295
267	3300042010	Ga0439452_000749	Ga0439452_000749_773_1696	295
268	3300042015	Ga0439462_0004283	Ga0439462_0004283_1897_2820	295
269	3300042125	Ga0450923_008704	Ga0450923_008704_407_1333	295
270	3300042156	Ga0439446_0023025	Ga0439446_0023025_117_1040	295
271	3300042185	Ga0450909_001473	Ga0450909_001473_1634_2557	295
272	3300042185	Ga0450909_005319	Ga0450909_005319_401_1324	295
273	3300042435	Ga0439434_0004431	Ga0439434_0004431_977_1900	295
274	3300042435	Ga0439434_0004585	Ga0439434_0004585_732_1655	295
275	3300042435	Ga0439434_0026278	Ga0439434_0026278_229_1155	295
276	3300042531	Ga0450918_015841	Ga0450918_015841_322_1248	295
277	3300046453	Ga0495627_007076	Ga0495627_007076_3094_4029	295
278	3300046459	Ga0495629_0076517	Ga0495629_0076517_399_1325	295
279	3300046460	Ga0495638_0014132	Ga0495638_0014132_3206_4132	295
280	3300046475	Ga0495639_0021226	Ga0495639_0021226_851_1774	295
281	3300046512	Ga0495610_0090427	Ga0495610_0090427_166_1092	295
282	3300046513	Ga0495616_0001622	Ga0495616_0001622_9754_10680	295
283	3300046518	Ga0495631_0000314	Ga0495631_0000314_100_1026	295
284	3300046520	Ga0495637_0008897	Ga0495637_0008897_63_998	295
285	3300046520	Ga0495637_0016342	Ga0495637_0016342_2438_3364	295
286	3300046530	Ga0495654_0008494	Ga0495654_0008494_3370_4296	295
287	3300046615	Ga0495656_0000193	Ga0495656_0000193_18846_19769	295
288	3300046660	Ga0495625_0000057	Ga0495625_0000057_165350_166276	295
289	3300046665	Ga0495661_0081537	Ga0495661_0081537_851_1786	295
290	3300046674	Ga0495588_0013015	Ga0495588_0013015_2264_3190	295
291	3300046691	Ga0495670_0035417	Ga0495670_0035417_805_1740	295
292	3300046691	Ga0495670_0074149	Ga0495670_0074149_19_942	295
293	3300046691	Ga0495670_0125393	Ga0495670_0125393_78_1001	295
294	3300046692	Ga0495671_0001783	Ga0495671_0001783_9199_10134	295
295	3300047321	Ga0495676_0056858	Ga0495676_0056858_458_1384	295
296	3300047673	Ga0495593_0038531	Ga0495593_0038531_627_1553	295
297	3300048089	Ga0495614_0011892	Ga0495614_0011892_1931_2857	295
298	3300048903	Ga0496100_0024495	Ga0496100_0024495_1415_2338	295
299	3300048904	Ga0496101_0005850	Ga0496101_0005850_6106_7050	295
300	3300048905	Ga0496102_0022275	Ga0496102_0022275_1801_2724	295
301	3300048907	Ga0496104_0001081	Ga0496104_0001081_1176_2099	295
302	3300048908	Ga0496105_0031728	Ga0496105_0031728_1651_2574	295
303	3300048910	Ga0496107_0048140	Ga0496107_0048140_61_984	295
304	3300048913	Ga0496110_0027049	Ga0496110_0027049_2124_3047	295
305	3300048913	Ga0496110_0042538	Ga0496110_0042538_2326_3249	295
306	3300048914	Ga0496111_0049261	Ga0496111_0049261_295_1218	295
307	3300048919	Ga0496116_0025716	Ga0496116_0025716_1805_2731	295
308	3300048919	Ga0496116_0143305	Ga0496116_0143305_377_1321	295
309	3300048920	Ga0496117_0028546	Ga0496117_0028546_2662_3588	295
310	3300048920	Ga0496117_0039193	Ga0496117_0039193_781_1707	295
311	3300048921	Ga0496118_0016121	Ga0496118_0016121_4923_5849	295
312	3300048921	Ga0496118_0039128	Ga0496118_0039128_422_1348	295
313	3300048921	Ga0496118_0089483	Ga0496118_0089483_1135_2061	295
314	3300048926	Ga0496123_0051394	Ga0496123_0051394_1153_2097	295
315	3300048926	Ga0496123_0127123	Ga0496123_0127123_39_965	295
316	3300048927	Ga0496124_0008708	Ga0496124_0008708_9151_10077	295
317	3300048927	Ga0496124_0289770	Ga0496124_0289770_229_1155	295
318	3300048928	Ga0496125_0008866	Ga0496125_0008866_8525_9451	295
319	3300048928	Ga0496125_0041445	Ga0496125_0041445_95_1021	295
320	3300048928	Ga0496125_0104927	Ga0496125_0104927_265_1209	295
321	3300049679	Ga0501249_034046	Ga0501249_034046_110_1027	295
322	3300049705	Ga0501225_0006457	Ga0501225_0006457_508_1434	295
323	3300050489	nmdc:mga03683_1803_c1	nmdc:mga03683_1803_c1_451_1377	295
324	3300050489	nmdc:mga03683_38727_c1	nmdc:mga03683_38727_c1_943_1866	295
325	3300050492	nmdc:mga0yw44_252100_c1	nmdc:mga0yw44_252100_c1_34_951	295
326	3300050493	nmdc:mga0k408_149647_c1	nmdc:mga0k408_149647_c1_313_1230	295
327	3300050494	nmdc:mga06z11_64631_c1	nmdc:mga06z11_64631_c1_749_1693	295
328	3300050496	nmdc:mga07m45_30581_c1	nmdc:mga07m45_30581_c1_1047_1970	295
329	3300050496	nmdc:mga07m45_7705_c1	nmdc:mga07m45_7705_c1_2641_3585	295
330	3300050496	nmdc:mga07m45_87074_c1	nmdc:mga07m45_87074_c1_567_1493	295
331	3300050496	nmdc:mga07m45_9224_c1	nmdc:mga07m45_9224_c1_1248_2174	295
332	3300053079	Ga0500610_0002251	Ga0500610_0002251_3317_4252	295
333	3300053087	Ga0500643_004866	Ga0500643_004866_3032_3958	295
334	3300053091	Ga0500647_0046808	Ga0500647_0046808_536_1480	295
335	3300053093	Ga0500651_0000090	Ga0500651_0000090_38363_39289	295
336	3300053110	Ga0500571_000014	Ga0500571_000014_8002_8928	295
337	3300053118	Ga0500594_0002517	Ga0500594_0002517_1856_2782	295
338	3300053121	Ga0500607_000328	Ga0500607_000328_19828_20775	295
339	3300053121	Ga0500607_022055	Ga0500607_022055_1640_2584	295
340	3300053133	Ga0500655_001389	Ga0500655_001389_2534_3460	295
341	3300053134	Ga0500658_0000018	Ga0500658_0000018_64398_65324	295
342	3300053134	Ga0500658_0000322	Ga0500658_0000322_14984_15910	295
343	3300053136	Ga0500559_0024628	Ga0500559_0024628_932_1858	295
344	3300053139	Ga0500568_0003081	Ga0500568_0003081_1569_2495	295
345	3300053141	Ga0500574_003150	Ga0500574_003150_942_1868	295
346	3300053153	Ga0500616_0007996	Ga0500616_0007996_3622_4548	295
347	3300053158	Ga0500627_0001126	Ga0500627_0001126_190_1125	295
348	3300053161	Ga0500634_0022086	Ga0500634_0022086_1651_2586	295
349	3300053161	Ga0500634_0040567	Ga0500634_0040567_942_1868	295
350	3300053177	Ga0500636_0110162	Ga0500636_0110162_543_1469	295
351	3300005355	Ga0070671_100027728	Ga0070671_1000277286	296
352	3300005618	Ga0068864_100050153	Ga0068864_1000501533	296
353	3300005841	Ga0068863_100066516	Ga0068863_1000665163	296
354	3300025931	Ga0207644_10083287	Ga0207644_100832872	296
355	3300025941	Ga0207711_10011484	Ga0207711_100114846	296
356	3300026088	Ga0207641_10032922	Ga0207641_100329223	296
357	3300041405	Ga0439438_028671	Ga0439438_028671_429_1349	296
358	3300041408	Ga0439453_0005707	Ga0439453_0005707_211_1131	296
359	3300053137	Ga0500561_0034283	Ga0500561_0034283_311_1267	296
360	3300053730	Ga0500645_000155	Ga0500645_000155_14531_15487	296
361	iso_pu_bacteria	2511231002	2511247003	296
362	3300006353	Ga0075370_10098326	Ga0075370_100983262	297
363	3300046516	Ga0495628_0197079	Ga0495628_0197079_445_1395	297
364	3300047321	Ga0495676_0025847	Ga0495676_0025847_509_1459	297
365	3300047673	Ga0495593_0024903	Ga0495593_0024903_169_1119	297
366	3300050493	nmdc:mga0k408_10715_c1	nmdc:mga0k408_10715_c1_1289_2296	297
367	3300050496	nmdc:mga07m45_89064_c1	nmdc:mga07m45_89064_c1_395_1402	297
368	iso_pu_bacteria	2738543013	2739250269	297
369	3300049823	Ga0501044_0090000	Ga0501044_0090000_278_1204	298
370	3300006195	Ga0075366_10000121	Ga0075366_100001217	299
371	3300031548	Ga0307408_100006460	Ga0307408_1000064602	299
372	3300032005	Ga0307411_10215828	Ga0307411_102158282	299
373	3300050493	nmdc:mga0k408_505_c1	nmdc:mga0k408_505_c1_17202_18158	299
374	3300003187	JGI25151J46595_10014055	JGI25151J46595_100140553	300
375	3300003771	Ga0055526_1014041	Ga0055526_10140413	300
376	3300005288	Ga0065714_10077385	Ga0065714_100773853	300
377	3300005457	Ga0070662_100064301	Ga0070662_1000643012	300
378	3300005457	Ga0070662_100119580	Ga0070662_1001195802	300
379	3300005530	Ga0070679_100149845	Ga0070679_1001498452	300
380	3300005539	Ga0068853_100044709	Ga0068853_1000447093	300
381	3300006177	Ga0075362_10014387	Ga0075362_100143871	300
382	3300006353	Ga0075370_10074326	Ga0075370_100743262	300
383	3300012513	Ga0157326_1001054	Ga0157326_10010543	300
384	3300025206	Ga0209435_100001	Ga0209435_100001715	300
385	3300025246	Ga0209646_1000001	Ga0209646_10000011084	300
386	3300025250	Ga0209026_1000003	Ga0209026_1000003715	300
387	3300025256	Ga0209759_1000001	Ga0209759_1000001715	300
388	3300025273	Ga0209673_1003648	Ga0209673_10036486	300
389	3300025292	Ga0209676_1013120	Ga0209676_10131202	300
390	3300025295	Ga0209564_1001231	Ga0209564_100123117	300
391	3300025303	Ga0209051_1000213	Ga0209051_100021312	300
392	3300025304	Ga0209257_1012728	Ga0209257_10127283	300
393	3300025728	Ga0207655_1005759	Ga0207655_100575911	300
394	3300025933	Ga0207706_10161418	Ga0207706_101614181	300
395	3300025935	Ga0207709_10002968	Ga0207709_100029686	300
396	3300025945	Ga0207679_10069722	Ga0207679_100697223	300
397	3300025960	Ga0207651_10065945	Ga0207651_100659451	300
398	3300026041	Ga0207639_10035526	Ga0207639_100355263	300
399	3300028794	Ga0307515_10000306	Ga0307515_10000306113	300
400	3300031824	Ga0307413_10323317	Ga0307413_103233171	300
401	3300031901	Ga0307406_10003567	Ga0307406_100035674	300
402	3300032002	Ga0307416_100015608	Ga0307416_1000156084	300
403	3300037471	Ga0395905_0074895	Ga0395905_0074895_1590_2573	300
404	3300046660	Ga0495625_0010154	Ga0495625_0010154_5612_6649	300
405	3300048924	Ga0496121_0042381	Ga0496121_0042381_2835_3872	300
406	3300050489	nmdc:mga03683_87699_c1	nmdc:mga03683_87699_c1_243_1226	300
407	3300050496	nmdc:mga07m45_92220_c1	nmdc:mga07m45_92220_c1_449_1432	300
408	3300053730	Ga0500645_002447	Ga0500645_002447_1278_2216	300
409	3300059424	Ga0590075_018680	Ga0590075_018680_151_1131	300
410	iso_pu_bacteria	2513020051	2513226418	300
411	3300003316	rootH1_10027639	rootH1_100276393	301
412	3300003322	rootL2_10059414	rootL2_1005941410	301
413	3300042876	Ga0451577_0006355	Ga0451577_0006355_1364_2338	303
414	3300031456	Ga0307513_10000051	Ga0307513_1000005125	310
415	3300048912	Ga0496109_0220316	Ga0496109_0220316_511_1557	310
416	3300048915	Ga0496112_0136316	Ga0496112_0136316_1085_2131	310
417	3300048916	Ga0496113_0097611	Ga0496113_0097611_299_1345	310
418	3300002704	JGI25155J39150_1000036	JGI25155J39150_100003687	314
419	3300002705	JGI25156J39149_1000047	JGI25156J39149_10000471	314
420	3300002738	JGI25154J39366_1000068	JGI25154J39366_10000681	314
421	3300002741	JGI25157J39369_1000066	JGI25157J39369_10000661	314
422	3300002987	JGI25159J45721_1001201	JGI25159J45721_100120113	314
423	3300002987	JGI25159J45721_1003535	JGI25159J45721_10035354	314
424	3300003354	JGI25160J50197_1000145	JGI25160J50197_100014547	314
425	3300003374	JGI25161J50226_1000032	JGI25161J50226_1000032126	314
426	3300003374	JGI25161J50226_1000064	JGI25161J50226_100006435	314
427	3300003771	Ga0055526_1002303	Ga0055526_100230313	314
428	3300003771	Ga0055526_1026129	Ga0055526_10261292	314
429	3300003773	Ga0055537_1000043	Ga0055537_100004326	314
430	3300003775	Ga0055524_1000012	Ga0055524_1000012139	314
431	3300003790	Ga0055528_1000647	Ga0055528_100064717	314
432	3300003791	Ga0055530_10000015	Ga0055530_10000015102	314
433	3300003791	Ga0055530_10030359	Ga0055530_100303591	314
434	3300003792	Ga0055540_1000012	Ga0055540_1000012258	314
435	3300003792	Ga0055540_1000039	Ga0055540_100003940	314
436	3300003794	Ga0055531_10007067	Ga0055531_100070677	314
437	3300003794	Ga0055531_10008849	Ga0055531_100088494	314
438	3300004625	Ga0055543_1005343	Ga0055543_10053432	314
439	3300005262	Ga0065165_1020173	Ga0065165_10201731	314
440	3300025245	Ga0207425_1000861	Ga0207425_100086110	314
441	3300025263	Ga0209565_1000004	Ga0209565_1000004496	314
442	3300025263	Ga0209565_1000407	Ga0209565_100040716	314
443	3300025273	Ga0209673_1000357	Ga0209673_100035752	314
444	3300025284	Ga0209130_1000082	Ga0209130_100008226	314
445	3300025284	Ga0209130_1000094	Ga0209130_100009474	314
446	3300025291	Ga0209675_1000061	Ga0209675_100006196	314
447	3300025292	Ga0209676_1000029	Ga0209676_1000029407	314
448	3300025294	Ga0209025_1004416	Ga0209025_10044162	314
449	3300025294	Ga0209025_1054700	Ga0209025_10547002	314
450	3300025295	Ga0209564_1000969	Ga0209564_100096913	314
451	3300025295	Ga0209564_1005591	Ga0209564_10055913	314
452	3300025297	Ga0209758_1010359	Ga0209758_10103596	314
453	3300025298	Ga0209050_1000003	Ga0209050_1000003469	314
454	3300025298	Ga0209050_1003639	Ga0209050_10036393	314
455	3300025299	Ga0209256_1000001	Ga0209256_1000001471	314
456	3300025302	Ga0207426_1000025	Ga0207426_1000025485	314
457	3300025302	Ga0207426_1004459	Ga0207426_10044595	314
458	3300025303	Ga0209051_1000003	Ga0209051_1000003469	314
459	3300025304	Ga0209257_1000018	Ga0209257_1000018469	314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01571

GCV_T

Aminomethyltransferase folate-binding domain

38

188

0.92 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1vly-assembly1.cif.gz_A	crystal structure of a putative aminomethyltransferase (ygfz) from escherichia coli at 1.30 a resolution	0.8056	6	310
3ttg-assembly1.cif.gz_A	crystal structure of putative aminomethyltransferase from leptospirillum rubarum	0.7879	21	309
1vly-assembly1.cif.gz_A	crystal structure of a putative aminomethyltransferase (ygfz) from escherichia coli at 1.30 a resolution	0.7815	6	310
7z3h-assembly5.cif.gz_E	crystal structure of iba57 from chaetomium thermophilum	0.775	20	307
7z3h-assembly2.cif.gz_B	crystal structure of iba57 from chaetomium thermophilum	0.771	22	307

ID	Description	Score	Start	End	Superfamily
1vlyA02	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains	0.962	22	105	3.30.70.1400
af_G5EE11_2_112_3.30.70.1400	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains	0.9353	19	105	3.30.70.1400
3girA02	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains	0.9333	23	103	3.30.70.1400
1wosA02	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains	0.9309	22	104	3.30.70.1400
af_E9AH81_4_151_3.30.70.1400	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains	0.9265	19	107	3.30.70.1400

ID	Description	Score	Start	End	GO Terms
AF-A0A5C7QTZ2-F1-model_v4	deleted	0.9778	20	107
AF-A0A382EUN2-F1-model_v4	Aminomethyltransferase folate-binding domain-containing protein	0.9714	21	107	GO:0016226
AF-A0A1Q8YBP4-F1-model_v4	Putative folate-binding protein YgfZ	0.9611	20	314	GO:0016226
AF-A0A2V9D826-F1-model_v4	Aminomethyltransferase folate-binding domain-containing protein	0.9508	17	107
AF-A0A847HZ31-F1-model_v4	Aminomethyltransferase folate-binding domain-containing protein	0.9505	18	108	GO:0016226

Feature Viewer

pLDDT	pTM	Quality
86.64	0.87	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F448434

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01571

GCV_T

Aminomethyltransferase folate-binding domain

38

188

0.92

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map