F448411

General Info

Members Datasets Scaffolds Average Seq Length
459 279 406 230

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0001931|Ga0466957_0001931_6923_7732
Length 269
Sequence MTKKHYWCEAYGSVETNVLFIIDGTPEFCEPENTTTKVKMRNQIKTIAFDADDTLWVNEPYFQEAENRFCELLADHLPAEAASQELYNTEMKNIPLYGYGIKGVILCMIETITRVSNGTAQLQLINQVLEMGHDLMQKPIEILAGVPETLEALYGKYRLVMATKGDLLDQERKLNKSGLQHYFHHIEIMSNKQVANYQKLLKHLDCSPANFLMLGNSVKSDILPVLALEAFAGHIPFHTTWKHELHEEEVIHPNLVSLNNIADIIPYLD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
4 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
5 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
6 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
7 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
8 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
9 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
10 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
11 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
12 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
13 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
14 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
15 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
16 2738541278 Niastella sp. CF465 Isolate Unclassified
17 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
18 2739367651 Pedobacter sp. OK291 Isolate Unclassified
19 2739367656 Pedobacter sp. CF523 Isolate Unclassified
20 2739367663 Pedobacter sp. YR510 Isolate Unclassified
21 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
22 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
23 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
24 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
25 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
26 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
27 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
28 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
29 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
30 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
31 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
32 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
33 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
34 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
35 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
36 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
37 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
38 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
39 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
40 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
41 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
42 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
43 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
44 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
45 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
46 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
47 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
48 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
49 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
50 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
51 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
52 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
53 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
54 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
55 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
56 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
57 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
58 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
59 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
60 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
61 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
62 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
63 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
64 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
65 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
66 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
68 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
69 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
70 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
71 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
72 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
73 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
74 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
75 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
76 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
77 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
78 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
79 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
80 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
81 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
82 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
83 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
84 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
85 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
86 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
87 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
88 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
89 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
90 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
91 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
92 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
93 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
94 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
95 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
96 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
97 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
98 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
99 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
102 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
103 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
104 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
105 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
106 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
107 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
108 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
109 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
110 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
111 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
112 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
113 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
119 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
142 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
143 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
146 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
148 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
150 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
155 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
157 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
199 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
200 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
201 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
207 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
208 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
211 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
215 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
216 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
217 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
218 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
219 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
220 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
221 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
222 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
223 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
224 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
225 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
226 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
227 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
231 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
232 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
233 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
234 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
235 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
236 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
243 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
244 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
245 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
248 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
249 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
255 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
256 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
257 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
260 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
263 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
264 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
265 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
266 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
267 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
268 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
269 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
270 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
271 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
272 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
273 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
274 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
275 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
276 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
277 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
278 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
279 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.02
Metatranscriptomes 0.22
Isolates 11.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 13.73
Nodule 0.22
Rhizoplane 1.53
Rhizosphere 68.19
Stem 0
Stem Tuber 0
Unclassified 15.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_845328 2162886007 Bacteria 903
2 MBSR1b_contig_255801 2162886012 Bacteria 828
3 JGI24739J22299_10024009 3300001989 Bacteria 2152
4 JGI24739J22299_10049144 3300001989 Bacteria 1369
5 JGI24751J29686_10004269 3300002459 Bacteria 2902
6 JGI25158J39367_1008936 3300002739 Bacteria 1383
7 JGI25153J46596_10028311 3300003215 Bacteria 1946
8 JGI25153J46596_10037166 3300003215 Unclassified 1552
9 rootH1_10043452 3300003316 Bacteria 20626
10 rootH1_10043452 3300003323 Bacteria 4798
11 rootH1_10139959 3300003316 Bacteria 1218
12 rootH2_10034389 3300003320 Bacteria 1568
13 rootH2_10069197 3300003320 Bacteria 7818
14 rootH2_10116291 3300003320 Bacteria 1842
15 rootH2_10141884 3300003320 Bacteria 4770
16 rootH2_10291360 3300003320 Unclassified 2065
17 rootL2_10019594 3300003322 Bacteria 6350
18 rootL2_10028348 3300003322 Bacteria 6889
19 rootL2_10205087 3300003322 Bacteria 4127
20 rootL2_10266067 3300003322 Bacteria 4050
21 rootL2_10301189 3300003322 Bacteria 2194
22 rootH1_10045658 3300003323 Bacteria 10051
23 rootH1_10046734 3300003323 Bacteria 5879
24 rootH1_10054390 3300003323 Bacteria 1506
25 rootH1_10092032 3300003323 Bacteria 12617
26 rootH1_10289241 3300003323 Bacteria 1424
27 rootH1_10297169 3300003323 Bacteria 2204
28 JGI25160J50197_1000735 3300003354 Bacteria 17879
29 JGI25160J50197_1002721 3300003354 Bacteria 8127
30 JGI25160J50197_1038322 3300003354 Bacteria 1136
31 Ga0055535_1001332 3300003761 Bacteria 13061
32 Ga0055526_1015408 3300003771 Bacteria 3069
33 Ga0055526_1016070 3300003771 Bacteria 2958
34 Ga0055528_1001241 3300003790 Bacteria 16212
35 Ga0055530_10001539 3300003791 Bacteria 16575
36 Ga0055531_10000045 3300003794 Bacteria 132131
37 Ga0055543_1004533 3300004625 Bacteria 3753
38 Ga0058862_11127928 3300004803 Bacteria 802
39 Ga0065165_1000525 3300005262 Bacteria 58607
40 Ga0065165_1001928 3300005262 Bacteria 19799
41 Ga0065165_1003790 3300005262 Bacteria 10113
42 Ga0065165_1006134 3300005262 Bacteria 6430
43 Ga0065714_10016178 3300005288 Bacteria 2431
44 Ga0065714_10074157 3300005288 Bacteria 3077
45 Ga0065704_10089094 3300005289 Bacteria 2886
46 Ga0065712_10079637 3300005290 Bacteria 3179
47 Ga0070658_10236187 3300005327 Bacteria 1549
48 Ga0070676_10512916 3300005328 Unclassified 853
49 Ga0070683_100004076 3300005329 Bacteria 11976
50 Ga0070683_100431415 3300005329 Bacteria 1257
51 Ga0070690_100107708 3300005330 Bacteria 1855
52 Ga0070670_100042351 3300005331 Bacteria 3914
53 Ga0070670_100194666 3300005331 Bacteria 1761
54 Ga0070670_100440402 3300005331 Bacteria 1154
55 Ga0070666_10000343 3300005335 Bacteria 29213
56 Ga0070666_10035489 3300005335 Bacteria 3307
57 Ga0070680_100014310 3300005336 Bacteria 6197
58 Ga0070682_100000206 3300005337 Bacteria 43560
59 Ga0068868_100496314 3300005338 Bacteria 1068
60 Ga0070660_100044793 3300005339 Bacteria 3385
61 Ga0070689_100032970 3300005340 Unclassified 3944
62 Ga0070687_100181345 3300005343 Bacteria 1261
63 Ga0070687_100494711 3300005343 Bacteria 822
64 Ga0070661_100229499 3300005344 Bacteria 1426
65 Ga0070669_100016630 3300005353 Bacteria 5250
66 Ga0070669_100090022 3300005353 Bacteria 2299
67 Ga0070675_100008578 3300005354 Bacteria 7934
68 Ga0070674_100044220 3300005356 Bacteria 3035
69 Ga0070688_100034971 3300005365 Unclassified 3048
70 Ga0070659_100809061 3300005366 Bacteria 815
71 Ga0070667_100240220 3300005367 Bacteria 1617
72 Ga0070667_100302331 3300005367 Bacteria 1441
73 Ga0070667_100808406 3300005367 Bacteria 870
74 Ga0070700_100320716 3300005441 Bacteria 1138
75 Ga0070663_100006861 3300005455 Bacteria 6891
76 Ga0070678_100304157 3300005456 Bacteria 1356
77 Ga0070662_100041790 3300005457 Unclassified 3273
78 Ga0070662_100390096 3300005457 Bacteria 1147
79 Ga0070681_10140783 3300005458 Bacteria 2342
80 Ga0070681_10714040 3300005458 Bacteria 918
81 Ga0068867_100080482 3300005459 Unclassified 2453
82 Ga0070698_100183728 3300005471 Bacteria 2029
83 Ga0070679_100005495 3300005530 Bacteria 11747
84 Ga0070684_100405373 3300005535 Bacteria 1257
85 Ga0070672_100011839 3300005543 Bacteria 6094
86 Ga0070672_100051714 3300005543 Bacteria 3206
87 Ga0070665_100047170 3300005548 Bacteria 4325
88 Ga0070665_100914400 3300005548 Bacteria 890
89 Ga0070664_100066719 3300005564 Bacteria 3073
90 Ga0068857_100024355 3300005577 Bacteria 5327
91 Ga0068857_100253793 3300005577 Unclassified 1613
92 Ga0068857_100840556 3300005577 Bacteria 878
93 Ga0068856_100000015 3300005614 Bacteria 157353
94 Ga0068856_100005760 3300005614 Bacteria 12209
95 Ga0068852_100066682 3300005616 Bacteria 3144
96 Ga0068852_100754948 3300005616 Bacteria 985
97 Ga0068859_100000066 3300005617 Bacteria 100640
98 Ga0068859_100023773 3300005617 Bacteria 6151
99 Ga0068859_100094773 3300005617 Bacteria 3037
100 Ga0068864_100123820 3300005618 Bacteria 2314
101 Ga0068864_100467907 3300005618 Bacteria 1208
102 Ga0068861_100007965 3300005719 Bacteria 7293
103 Ga0068863_100009096 3300005841 Bacteria 9698
104 Ga0068858_100020536 3300005842 Bacteria 6172
105 Ga0068858_100480012 3300005842 Bacteria 1200
106 Ga0068860_100002424 3300005843 Bacteria 19584
107 Ga0068862_100210840 3300005844 Bacteria 1755
108 Ga0070715_10135950 3300006163 Bacteria 1188
109 Ga0075366_10051389 3300006195 Bacteria 2449
110 Ga0097621_100458542 3300006237 Bacteria 1149
111 Ga0068871_100073180 3300006358 Bacteria 2825
112 Ga0068865_100354717 3300006881 Bacteria 1189
113 Ga0097620_100000066 3300006931 Bacteria 100640
114 Ga0097620_100023771 3300006931 Bacteria 6151
115 Ga0097620_100094776 3300006931 Bacteria 3037
116 Ga0105244_10000114 3300009036 Bacteria 84368
117 Ga0111539_10002347 3300009094 Bacteria 25205
118 Ga0111539_10004999 3300009094 Bacteria 17236
119 Ga0111539_10225314 3300009094 Bacteria 2184
120 Ga0105245_10293301 3300009098 Bacteria 1594
121 Ga0105247_10005082 3300009101 Bacteria 8339
122 Ga0105243_10000002 3300009148 Bacteria 856281
123 Ga0105243_10001230 3300009148 Bacteria 23083
124 Ga0105243_10474490 3300009148 Bacteria 1179
125 Ga0105241_10001905 3300009174 Bacteria 15791
126 Ga0105248_10444086 3300009177 Bacteria 1461
127 Ga0105249_10006240 3300009553 Bacteria 10352
128 Ga0105249_10091187 3300009553 Unclassified 2851
129 Ga0105249_10165294 3300009553 Bacteria 2141
130 Ga0105239_10054350 3300010375 Bacteria 4392
131 Ga0105246_10000814 3300011119 Bacteria 17740
132 Ga0157373_10328071 3300013100 Bacteria 1089
133 Ga0157371_10000076 3300013102 Bacteria 161805
134 Ga0157371_10024765 3300013102 Bacteria 4379
135 Ga0157371_10027253 3300013102 Bacteria 4146
136 Ga0157371_10114440 3300013102 Bacteria 1916
137 Ga0157370_10000018 3300013104 Bacteria 169223
138 Ga0157370_10002676 3300013104 Bacteria 21353
139 Ga0157370_10003635 3300013104 Bacteria 18022
140 Ga0157370_10027451 3300013104 Bacteria 5613
141 Ga0157370_10087407 3300013104 Bacteria 2928
142 Ga0157370_10148523 3300013104 Bacteria 2182
143 Ga0157369_10000402 3300013105 Bacteria 57623
144 Ga0157369_10428397 3300013105 Bacteria 1371
145 Ga0157374_10005026 3300013296 Bacteria 11090
146 Ga0157378_10337755 3300013297 Bacteria 1468
147 Ga0163162_10003657 3300013306 Bacteria 14752
148 Ga0163162_10071423 3300013306 Bacteria 3524
149 Ga0163162_10215940 3300013306 Bacteria 2048
150 Ga0163162_10247442 3300013306 Bacteria 1914
151 Ga0163162_10513402 3300013306 Unclassified 1328
152 Ga0157372_10000026 3300013307 Bacteria 195407
153 Ga0157372_10022874 3300013307 Bacteria 6769
154 Ga0157375_10009316 3300013308 Bacteria 8620
155 Ga0157375_10061567 3300013308 Bacteria 3727
156 Ga0157375_10524728 3300013308 Bacteria 1347
157 Ga0157380_10009573 3300014326 Bacteria 6952
158 Ga0157380_10010884 3300014326 Bacteria 6558
159 Ga0157380_10034887 3300014326 Bacteria 3882
160 Ga0157380_10049215 3300014326 Bacteria 3323
161 Ga0157380_10218972 3300014326 Unclassified 1702
162 Ga0157380_10441563 3300014326 Unclassified 1247
163 Ga0157380_10507380 3300014326 Bacteria 1173
164 Ga0157380_11092965 3300014326 Bacteria 836
165 Ga0182008_10000771 3300014497 Bacteria 22454
166 Ga0157377_10000609 3300014745 Bacteria 14822
167 Ga0157376_10105862 3300014969 Bacteria 2467
168 Ga0157376_10215969 3300014969 Bacteria 1773
169 Ga0182006_1000011 3300015261 Bacteria 408647
170 Ga0182006_1002159 3300015261 Bacteria 10911
171 Ga0182007_10090235 3300015262 Bacteria 1009
172 Ga0182005_1000212 3300015265 Bacteria 38424
173 Ga0163161_10004063 3300017792 Bacteria 10233
174 Ga0163161_10009250 3300017792 Bacteria 6813
175 Ga0163161_10330600 3300017792 Bacteria 1207
176 Ga0163161_10416601 3300017792 Bacteria 1080
177 Ga0209436_100247 3300025208 Bacteria 24873
178 Ga0209436_101783 3300025208 Bacteria 7029
179 Ga0209436_102268 3300025208 Bacteria 5931
180 Ga0209436_103434 3300025208 Bacteria 4218
181 Ga0209258_100041 3300025242 Bacteria 381381
182 Ga0209646_1007104 3300025246 Bacteria 1846
183 Ga0209148_1000375 3300025254 Bacteria 54278
184 Ga0209233_1029796 3300025261 Bacteria 1292
185 Ga0209673_1000014 3300025273 Bacteria 537082
186 Ga0209673_1000018 3300025273 Bacteria 458281
187 Ga0209130_1001851 3300025284 Bacteria 12142
188 Ga0209675_1000032 3300025291 Bacteria 273013
189 Ga0209564_1003450 3300025295 Bacteria 10806
190 Ga0209564_1005955 3300025295 Bacteria 6749
191 Ga0209758_1002678 3300025297 Bacteria 17595
192 Ga0209050_1000750 3300025298 Bacteria 46636
193 Ga0207426_1000002 3300025302 Bacteria 1249660
194 Ga0207426_1000345 3300025302 Bacteria 85840
195 Ga0207426_1000612 3300025302 Bacteria 46054
196 Ga0207426_1005998 3300025302 Bacteria 5379
197 Ga0207426_1006106 3300025302 Bacteria 5307
198 Ga0207426_1009304 3300025302 Unclassified 3899
199 Ga0209257_1000001 3300025304 Bacteria 2274655
200 Ga0209257_1003521 3300025304 Bacteria 13314
201 Ga0207697_10209297 3300025315 Bacteria 859
202 Ga0207655_1000631 3300025728 Bacteria 42239
203 Ga0207680_10001827 3300025903 Bacteria 10030
204 Ga0207647_10097633 3300025904 Bacteria 1747
205 Ga0207705_10304266 3300025909 Bacteria 1223
206 Ga0207654_10002035 3300025911 Bacteria 10374
207 Ga0207707_10124089 3300025912 Bacteria 2258
208 Ga0207707_10337438 3300025912 Bacteria 1300
209 Ga0207671_10002263 3300025914 Bacteria 20830
210 Ga0207657_10055447 3300025919 Bacteria 3423
211 Ga0207649_10134095 3300025920 Bacteria 1686
212 Ga0207652_10005231 3300025921 Bacteria 10545
213 Ga0207681_10208712 3300025923 Bacteria 1504
214 Ga0207650_10066105 3300025925 Bacteria 2711
215 Ga0207650_10075064 3300025925 Bacteria 2550
216 Ga0207650_10576062 3300025925 Bacteria 945
217 Ga0207659_10064095 3300025926 Unclassified 2658
218 Ga0207706_10039831 3300025933 Unclassified 4166
219 Ga0207706_10211089 3300025933 Bacteria 1702
220 Ga0207709_10000003 3300025935 Bacteria 1050072
221 Ga0207709_10000992 3300025935 Bacteria 21129
222 Ga0207670_10021911 3300025936 Unclassified 3950
223 Ga0207670_10242109 3300025936 Bacteria 1390
224 Ga0207691_10053575 3300025940 Unclassified 3683
225 Ga0207691_10202827 3300025940 Bacteria 1725
226 Ga0207689_10002850 3300025942 Bacteria 15955
227 Ga0207689_10005374 3300025942 Bacteria 11465
228 Ga0207661_10004283 3300025944 Bacteria 9994
229 Ga0207661_10201369 3300025944 Bacteria 1750
230 Ga0207651_10015025 3300025960 Bacteria 4487
231 Ga0207651_10338948 3300025960 Bacteria 1262
232 Ga0207651_10431744 3300025960 Bacteria 1127
233 Ga0207712_10009739 3300025961 Bacteria 6090
234 Ga0207712_10133264 3300025961 Bacteria 1897
235 Ga0207712_10138403 3300025961 Unclassified 1865
236 Ga0207668_10010816 3300025972 Bacteria 5528
237 Ga0207668_10457053 3300025972 Bacteria 1091
238 Ga0207640_10102336 3300025981 Unclassified 2012
239 Ga0207658_10157291 3300025986 Bacteria 1859
240 Ga0207658_10205596 3300025986 Bacteria 1647
241 Ga0207658_10232033 3300025986 Bacteria 1558
242 Ga0207703_10018113 3300026035 Bacteria 5501
243 Ga0207703_10176374 3300026035 Bacteria 1883
244 Ga0207678_10007776 3300026067 Bacteria 9469
245 Ga0207678_10008796 3300026067 Bacteria 8883
246 Ga0207708_10041488 3300026075 Unclassified 3508
247 Ga0207708_10333386 3300026075 Bacteria 1241
248 Ga0207702_10006649 3300026078 Bacteria 9941
249 Ga0207641_10000053 3300026088 Bacteria 173468
250 Ga0207641_10605651 3300026088 Bacteria 1073
251 Ga0207676_10008331 3300026095 Bacteria 7369
252 Ga0207676_10051507 3300026095 Bacteria 3214
253 Ga0207676_10064284 3300026095 Bacteria 2917
254 Ga0207674_10014672 3300026116 Bacteria 8639
255 Ga0207674_10016792 3300026116 Bacteria 8002
256 Ga0207674_10307972 3300026116 Bacteria 1533
257 Ga0207675_100001377 3300026118 Bacteria 24367
258 Ga0207698_10285526 3300026142 Bacteria 1529
259 Ga0207698_10345603 3300026142 Bacteria 1403
260 Ga0207428_10483690 3300027907 Bacteria 900
261 Ga0268266_10144440 3300028379 Bacteria 2138
262 Ga0268265_10201250 3300028380 Bacteria 1728
263 Ga0268265_10511125 3300028380 Bacteria 1134
264 Ga0268264_10005526 3300028381 Bacteria 10719
265 Ga0307515_10000251 3300028794 Bacteria 132970
266 Ga0307509_10078971 3300031507 Bacteria 3408
267 Ga0316579_10044910 3300031691 Bacteria 2059
268 Ga0316576_10004488 3300031727 Bacteria 8383
269 Ga0316576_10050699 3300031727 Bacteria 3019
270 Ga0316576_10142755 3300031727 Bacteria 1803
271 Ga0316576_10384026 3300031727 Bacteria 1042
272 Ga0316578_10011255 3300031728 Bacteria 4671
273 Ga0316578_10052609 3300031728 Bacteria 2386
274 Ga0316578_10244157 3300031728 Bacteria 1078
275 Ga0316577_10060415 3300031733 Unclassified 2116
276 Ga0307412_10000012 3300031911 Bacteria 404180
277 Ga0307412_10004726 3300031911 Bacteria 7600
278 Ga0307409_100420606 3300031995 Bacteria 1282
279 Ga0307416_100000010 3300032002 Bacteria 320243
280 Ga0307414_10000076 3300032004 Bacteria 93668
281 Ga0307414_10000959 3300032004 Bacteria 14695
282 Ga0307414_10065830 3300032004 Bacteria 2587
283 Ga0307414_10198538 3300032004 Bacteria 1629
284 Ga0307414_10207304 3300032004 Bacteria 1599
285 Ga0307414_10939424 3300032004 Bacteria 794
286 Ga0316583_10100789 3300032133 Bacteria 1007
287 Ga0316580_10016208 3300032139 Unclassified 2285
288 Ga0316574_0011575 3300035398 Bacteria 5020
289 Ga0316574_0104809 3300035398 Unclassified 1811
290 Ga0316574_0224151 3300035398 Bacteria 1204
291 Ga0373937_0251464 3300036401 Bacteria 1666
292 Ga0316582_0006533 3300036647 Bacteria 6133
293 Ga0316582_0238888 3300036647 Bacteria 1244
294 Ga0316582_0503335 3300036647 Bacteria 835
295 Ga0316584_0124480 3300036712 Bacteria 1926
296 Ga0316584_0174854 3300036712 Bacteria 1591
297 Ga0316584_0286361 3300036712 Bacteria 1196
298 Ga0395899_0000055 3300037312 Bacteria 220579
299 Ga0395899_0000237 3300037312 Bacteria 74249
300 Ga0395900_0519563 3300037418 Bacteria 1139
301 Ga0400483_199042 3300039062 Bacteria 39689
302 Ga0439465_0096837 3300041413 Bacteria 1015
303 Ga0451789_0348491 3300041443 Unclassified 934
304 Ga0451795_0214755 3300041456 Bacteria 2121
305 Ga0451804_0656751 3300041463 Bacteria 1011
306 Ga0451853_3478125 3300041512 Bacteria 1010
307 Ga0439431_0005071 3300041997 Bacteria 2904
308 Ga0451577_0002400 3300042876 Bacteria 22414
309 Ga0451577_0063547 3300042876 Bacteria 3292
310 Ga0451577_0078752 3300042876 Bacteria 2938
311 Ga0451577_0470922 3300042876 Bacteria 1141
312 Ga0451577_0472869 3300042876 Bacteria 1138
313 Ga0466969_0053762 3300044656 Bacteria 1974
314 Ga0466972_0000019 3300044658 Bacteria 198523
315 Ga0466972_0148268 3300044658 Bacteria 1103
316 Ga0453683_0000090 3300044673 Bacteria 137022
317 Ga0453683_0073285 3300044673 Unclassified 2143
318 Ga0453683_0107586 3300044673 Bacteria 1753
319 Ga0453684_0000288 3300044712 Bacteria 216718
320 Ga0453684_0001448 3300044712 Bacteria 67464
321 Ga0453684_0016640 3300044712 Bacteria 11476
322 Ga0453684_0036869 3300044712 Bacteria 6728
323 Ga0453684_0139100 3300044712 Bacteria 2902
324 Ga0453684_0285664 3300044712 Unclassified 1880
325 Ga0453684_0408513 3300044712 Unclassified 1519
326 Ga0466970_0004979 3300044765 Bacteria 6564
327 Ga0466957_0001931 3300044842 Bacteria 11001
328 Ga0466957_0047312 3300044842 Unclassified 2613
329 Ga0466957_0220926 3300044842 Bacteria 1251
330 Ga0466959_0356875 3300045049 Bacteria 996
331 Ga0451576_0003279 3300045051 Bacteria 22469
332 Ga0451576_0009889 3300045051 Bacteria 11017
333 Ga0451576_0172778 3300045051 Unclassified 2256
334 Ga0451576_0784059 3300045051 Bacteria 1001
335 Ga0466958_0095179 3300045836 Bacteria 1846
336 Ga0495627_000003 3300046453 Bacteria 704557
337 Ga0495596_0003542 3300046500 Bacteria 7867
338 Ga0495606_0003826 3300046507 Bacteria 15590
339 Ga0495606_0014063 3300046507 Bacteria 6269
340 Ga0495610_0000001 3300046512 Bacteria 1620061
341 Ga0495610_0004850 3300046512 Bacteria 9786
342 Ga0495654_0000001 3300046530 Bacteria 1513197
343 Ga0495633_0000008 3300046558 Bacteria 301830
344 Ga0495633_0000336 3300046558 Bacteria 52701
345 Ga0495686_0021583 3300047472 Bacteria 4272
346 Ga0496102_0323767 3300048905 Bacteria 1452
347 Ga0496110_0243462 3300048913 Bacteria 1637
348 Ga0496113_0056979 3300048916 Bacteria 2935
349 Ga0496115_0029082 3300048918 Bacteria 4337
350 Ga0496116_0000012 3300048919 Bacteria 611365
351 Ga0496117_0000050 3300048920 Bacteria 292727
352 Ga0496118_0000044 3300048921 Bacteria 283524
353 Ga0496119_0000002 3300048922 Bacteria 738385
354 Ga0496121_0000030 3300048924 Bacteria 412079
355 Ga0496122_0000386 3300048925 Bacteria 93777
356 Ga0496122_0000848 3300048925 Bacteria 57604
357 Ga0496122_0001778 3300048925 Bacteria 33029
358 Ga0496122_0002418 3300048925 Bacteria 26574
359 Ga0496122_0005490 3300048925 Bacteria 15086
360 Ga0496122_0014713 3300048925 Bacteria 7543
361 Ga0496123_0002309 3300048926 Bacteria 23946
362 Ga0496123_0005061 3300048926 Bacteria 13470
363 Ga0496123_0012696 3300048926 Bacteria 7149
364 Ga0496123_0014350 3300048926 Bacteria 6573
365 Ga0496123_0117264 3300048926 Bacteria 1506
366 Ga0496124_0005726 3300048927 Bacteria 13841
367 Ga0496125_0001693 3300048928 Bacteria 30807
368 Ga0496125_0002510 3300048928 Bacteria 23726
369 Ga0496125_0004193 3300048928 Bacteria 16796
370 Ga0496126_0001648 3300048929 Bacteria 33659
371 Ga0496126_0012879 3300048929 Bacteria 8544
372 Ga0496126_0226724 3300048929 Bacteria 1567
373 Ga0501037_0166917 3300049573 Bacteria 1567
374 Ga0501047_0222108 3300049581 Bacteria 1745
375 Ga0501257_023627 3300049686 Bacteria 1458
376 Ga0501219_000172 3300049703 Bacteria 12066
377 Ga0501225_0002003 3300049705 Bacteria 6345
378 Ga0501241_000013 3300049758 Bacteria 104728
379 Ga0501241_001293 3300049758 Bacteria 5190
380 Ga0501044_0002693 3300049823 Bacteria 20197
381 Ga0501044_0558733 3300049823 Bacteria 1041
382 Ga0501284_00003 3300050005 Bacteria 212116
383 nmdc:mga0k408_18689_c1 3300050493 Bacteria 3871
384 nmdc:mga08y16_217785_c1 3300050511 Unclassified 1977
385 nmdc:mga08y16_6927_c1 3300050511 Bacteria 11884
386 Ga0500578_0001405 3300053086 Bacteria 24240
387 Ga0500644_0000160 3300053088 Bacteria 42538
388 Ga0500646_0016005 3300053090 Bacteria 1956
389 Ga0500583_0000410 3300053092 Bacteria 13609
390 Ga0500583_0007739 3300053092 Unclassified 3804
391 Ga0500651_0115320 3300053093 Bacteria 1636
392 Ga0500641_0000179 3300053096 Bacteria 23878
393 Ga0500569_004454 3300053109 Bacteria 2945
394 Ga0500658_0019555 3300053134 Bacteria 2549
395 Ga0500658_0052394 3300053134 Bacteria 1671
396 Ga0500559_0017379 3300053136 Bacteria 3037
397 Ga0500577_0014448 3300053142 Bacteria 2441
398 Ga0500588_0036920 3300053146 Bacteria 1448
399 Ga0500589_000820 3300053147 Bacteria 8121
400 Ga0500590_036194 3300053148 Bacteria 2553
401 Ga0500616_0059102 3300053153 Bacteria 1992
402 Ga0500622_0000220 3300053156 Bacteria 60029
403 Ga0500622_0012421 3300053156 Bacteria 4612
404 Ga0500633_0000109 3300053160 Bacteria 11238
405 Ga0500636_0043278 3300053177 Bacteria 2659
406 Ga0500661_004940 3300055283 Bacteria 2498

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005614 Ga0068856_100005760 Ga0068856_10000576010 204
2 3300044658 Ga0466972_0148268 Ga0466972_0148268_326_1018 217
3 3300048925 Ga0496122_0014713 Ga0496122_0014713_5235_5924 218
4 3300048926 Ga0496123_0117264 Ga0496123_0117264_737_1426 218
5 3300032004 Ga0307414_10065830 Ga0307414_100658303 219
6 3300032002 Ga0307416_100000010 Ga0307416_100000010301 220
7 3300032004 Ga0307414_10198538 Ga0307414_101985382 220
8 iso_pu_bacteria 2919692658 2919694778 222
9 3300005290 Ga0065712_10079637 Ga0065712_100796372 223
10 3300005340 Ga0070689_100032970 Ga0070689_1000329703 223
11 3300005365 Ga0070688_100034971 Ga0070688_1000349715 223
12 3300005366 Ga0070659_100809061 Ga0070659_1008090611 223
13 3300005457 Ga0070662_100041790 Ga0070662_1000417903 223
14 3300005459 Ga0068867_100080482 Ga0068867_1000804823 223
15 3300005543 Ga0070672_100011839 Ga0070672_1000118396 223
16 3300025926 Ga0207659_10064095 Ga0207659_100640952 223
17 3300025940 Ga0207691_10053575 Ga0207691_100535753 223
18 iso_pu_bacteria 2818991442 2819573460 223
19 iso_pu_bacteria 2821136567 2821136870 223
20 iso_pu_bacteria 2884634485 2884636472 223
21 iso_pu_bacteria 2904467357 2904468385 223
22 iso_pu_bacteria 2929239360 2929241091 223
23 iso_pu_bacteria 2977232053 2977236352 223
24 iso_pu_bacteria 2884791551 2884795233 224
25 iso_pu_bacteria 2902048731 2902050846 224
26 iso_pu_bacteria 2984572630 2984575818 224
27 iso_pu_bacteria 2984606641 2984609273 224
28 iso_pu_bacteria 2993480792 2993484146 224
29 3300044712 Ga0453684_0016640 Ga0453684_0016640_7192_7875 225
30 iso_pu_bacteria 2582581278 2585144882 225
31 iso_pu_bacteria 2585428045 2587678492 225
32 iso_pu_bacteria 2585428060 2587748017 225
33 iso_pu_bacteria 2585428115 2587943013 225
34 iso_pu_bacteria 2585428182 2588208485 225
35 iso_pu_bacteria 2585428183 2588213016 225
36 iso_pu_bacteria 2585428184 2588219608 225
37 iso_pu_bacteria 2585428185 2588224081 225
38 iso_pu_bacteria 2588253712 2588446293 225
39 iso_pu_bacteria 2588254255 2590600470 225
40 iso_pu_bacteria 2588254257 2590611671 225
41 iso_pu_bacteria 2728369107 2729201653 225
42 iso_pu_bacteria 2738541273 2738699050 225
43 iso_pu_bacteria 2738541278 2738728942 225
44 iso_pu_bacteria 2738543014 2739254766 225
45 iso_pu_bacteria 2739367651 2739589261 225
46 iso_pu_bacteria 2739367656 2739614939 225
47 iso_pu_bacteria 2739367663 2739647013 225
48 iso_pu_bacteria 2739367874 2740057474 225
49 iso_pu_bacteria 2751185877 2753672832 225
50 iso_pu_bacteria 2765235839 2765572394 225
51 iso_pu_bacteria 2816332188 2816872671 225
52 iso_pu_bacteria 2818991442 2819576058 225
53 iso_pu_bacteria 2818991460 2819679468 225
54 iso_pu_bacteria 2821136567 2821138598 225
55 iso_pu_bacteria 2842083920 2842084071 225
56 iso_pu_bacteria 2849281842 2849283237 225
57 iso_pu_bacteria 2871720351 2871721796 225
58 iso_pu_bacteria 2883068021 2883072566 225
59 iso_pu_bacteria 2889290771 2889291971 225
60 iso_pu_bacteria 2904467357 2904469391 225
61 iso_pu_bacteria 2905999023 2906000921 225
62 iso_pu_bacteria 2919399522 2919402770 225
63 iso_pu_bacteria 2929177148 2929180260 225
64 iso_pu_bacteria 2945977869 2945982661 225
65 iso_pu_bacteria 2946013367 2946017947 225
66 iso_pu_bacteria 2977243572 2977246089 225
67 3300013104 Ga0157370_10087407 Ga0157370_100874072 226
68 3300032004 Ga0307414_10000076 Ga0307414_1000007668 226
69 3300042876 Ga0451577_0002400 Ga0451577_0002400_5573_6253 226
70 3300044658 Ga0466972_0000019 Ga0466972_0000019_43275_43961 226
71 3300044712 Ga0453684_0036869 Ga0453684_0036869_1625_2305 226
72 3300044765 Ga0466970_0004979 Ga0466970_0004979_363_1049 226
73 3300045051 Ga0451576_0003279 Ga0451576_0003279_8870_9550 226
74 2162886012 MBSR1b_contig_255801 MBSR1b_0931.00005300 227
75 3300002459 JGI24751J29686_10004269 JGI24751J29686_100042693 227
76 3300003320 rootH2_10034389 rootH2_100343893 227
77 3300003322 rootL2_10028348 rootL2_100283484 227
78 3300003322 rootL2_10205087 rootL2_102050873 227
79 3300003322 rootL2_10301189 rootL2_103011891 227
80 3300003761 Ga0055535_1001332 Ga0055535_10013323 227
81 3300003794 Ga0055531_10000045 Ga0055531_1000004562 227
82 3300004803 Ga0058862_11127928 Ga0058862_111279281 227
83 3300005262 Ga0065165_1006134 Ga0065165_10061345 227
84 3300005327 Ga0070658_10236187 Ga0070658_102361872 227
85 3300005328 Ga0070676_10512916 Ga0070676_105129161 227
86 3300005329 Ga0070683_100431415 Ga0070683_1004314151 227
87 3300005330 Ga0070690_100107708 Ga0070690_1001077083 227
88 3300005331 Ga0070670_100042351 Ga0070670_1000423513 227
89 3300005331 Ga0070670_100194666 Ga0070670_1001946661 227
90 3300005331 Ga0070670_100440402 Ga0070670_1004404022 227
91 3300005335 Ga0070666_10000343 Ga0070666_1000034312 227
92 3300005335 Ga0070666_10035489 Ga0070666_100354895 227
93 3300005336 Ga0070680_100014310 Ga0070680_1000143106 227
94 3300005338 Ga0068868_100496314 Ga0068868_1004963141 227
95 3300005343 Ga0070687_100181345 Ga0070687_1001813452 227
96 3300005343 Ga0070687_100494711 Ga0070687_1004947111 227
97 3300005353 Ga0070669_100016630 Ga0070669_1000166303 227
98 3300005353 Ga0070669_100090022 Ga0070669_1000900222 227
99 3300005354 Ga0070675_100008578 Ga0070675_1000085786 227
100 3300005356 Ga0070674_100044220 Ga0070674_1000442202 227
101 3300005367 Ga0070667_100240220 Ga0070667_1002402202 227
102 3300005367 Ga0070667_100302331 Ga0070667_1003023312 227
103 3300005367 Ga0070667_100808406 Ga0070667_1008084061 227
104 3300005441 Ga0070700_100320716 Ga0070700_1003207162 227
105 3300005455 Ga0070663_100006861 Ga0070663_1000068611 227
106 3300005456 Ga0070678_100304157 Ga0070678_1003041572 227
107 3300005457 Ga0070662_100390096 Ga0070662_1003900962 227
108 3300005458 Ga0070681_10140783 Ga0070681_101407832 227
109 3300005530 Ga0070679_100005495 Ga0070679_1000054954 227
110 3300005535 Ga0070684_100405373 Ga0070684_1004053731 227
111 3300005543 Ga0070672_100051714 Ga0070672_1000517143 227
112 3300005548 Ga0070665_100047170 Ga0070665_1000471702 227
113 3300005548 Ga0070665_100914400 Ga0070665_1009144002 227
114 3300005564 Ga0070664_100066719 Ga0070664_1000667192 227
115 3300005577 Ga0068857_100024355 Ga0068857_1000243552 227
116 3300005577 Ga0068857_100253793 Ga0068857_1002537932 227
117 3300005577 Ga0068857_100840556 Ga0068857_1008405561 227
118 3300005614 Ga0068856_100000015 Ga0068856_10000001583 227
119 3300005616 Ga0068852_100066682 Ga0068852_1000666823 227
120 3300005616 Ga0068852_100754948 Ga0068852_1007549481 227
121 3300005617 Ga0068859_100000066 Ga0068859_10000006681 227
122 3300005617 Ga0068859_100023773 Ga0068859_1000237735 227
123 3300005617 Ga0068859_100094773 Ga0068859_1000947733 227
124 3300005618 Ga0068864_100123820 Ga0068864_1001238202 227
125 3300005618 Ga0068864_100467907 Ga0068864_1004679072 227
126 3300005719 Ga0068861_100007965 Ga0068861_1000079654 227
127 3300005841 Ga0068863_100009096 Ga0068863_1000090962 227
128 3300005842 Ga0068858_100020536 Ga0068858_1000205364 227
129 3300005842 Ga0068858_100480012 Ga0068858_1004800122 227
130 3300005843 Ga0068860_100002424 Ga0068860_1000024245 227
131 3300005844 Ga0068862_100210840 Ga0068862_1002108402 227
132 3300006163 Ga0070715_10135950 Ga0070715_101359502 227
133 3300006237 Ga0097621_100458542 Ga0097621_1004585422 227
134 3300006358 Ga0068871_100073180 Ga0068871_1000731802 227
135 3300006881 Ga0068865_100354717 Ga0068865_1003547172 227
136 3300006931 Ga0097620_100000066 Ga0097620_10000006681 227
137 3300006931 Ga0097620_100023771 Ga0097620_1000237712 227
138 3300006931 Ga0097620_100094776 Ga0097620_1000947762 227
139 3300009094 Ga0111539_10002347 Ga0111539_100023473 227
140 3300009094 Ga0111539_10004999 Ga0111539_1000499912 227
141 3300009094 Ga0111539_10225314 Ga0111539_102253142 227
142 3300009098 Ga0105245_10293301 Ga0105245_102933012 227
143 3300009101 Ga0105247_10005082 Ga0105247_100050825 227
144 3300009148 Ga0105243_10474490 Ga0105243_104744901 227
145 3300009174 Ga0105241_10001905 Ga0105241_100019055 227
146 3300009177 Ga0105248_10444086 Ga0105248_104440862 227
147 3300009553 Ga0105249_10006240 Ga0105249_100062405 227
148 3300009553 Ga0105249_10091187 Ga0105249_100911872 227
149 3300009553 Ga0105249_10165294 Ga0105249_101652942 227
150 3300010375 Ga0105239_10054350 Ga0105239_100543502 227
151 3300011119 Ga0105246_10000814 Ga0105246_100008141 227
152 3300013100 Ga0157373_10328071 Ga0157373_103280711 227
153 3300013102 Ga0157371_10024765 Ga0157371_100247652 227
154 3300013102 Ga0157371_10027253 Ga0157371_100272532 227
155 3300013104 Ga0157370_10000018 Ga0157370_100000182 227
156 3300013104 Ga0157370_10027451 Ga0157370_100274514 227
157 3300013105 Ga0157369_10000402 Ga0157369_1000040257 227
158 3300013105 Ga0157369_10428397 Ga0157369_104283972 227
159 3300013296 Ga0157374_10005026 Ga0157374_100050269 227
160 3300013297 Ga0157378_10337755 Ga0157378_103377552 227
161 3300013306 Ga0163162_10003657 Ga0163162_1000365713 227
162 3300013306 Ga0163162_10071423 Ga0163162_100714233 227
163 3300013306 Ga0163162_10215940 Ga0163162_102159403 227
164 3300013306 Ga0163162_10247442 Ga0163162_102474422 227
165 3300013306 Ga0163162_10513402 Ga0163162_105134022 227
166 3300013307 Ga0157372_10000026 Ga0157372_1000002680 227
167 3300013307 Ga0157372_10022874 Ga0157372_100228742 227
168 3300013308 Ga0157375_10009316 Ga0157375_100093167 227
169 3300013308 Ga0157375_10061567 Ga0157375_100615674 227
170 3300013308 Ga0157375_10524728 Ga0157375_105247282 227
171 3300014326 Ga0157380_10009573 Ga0157380_100095735 227
172 3300014326 Ga0157380_10010884 Ga0157380_100108843 227
173 3300014326 Ga0157380_10034887 Ga0157380_100348872 227
174 3300014326 Ga0157380_10049215 Ga0157380_100492153 227
175 3300014326 Ga0157380_10441563 Ga0157380_104415632 227
176 3300014326 Ga0157380_10507380 Ga0157380_105073802 227
177 3300014326 Ga0157380_11092965 Ga0157380_110929652 227
178 3300014745 Ga0157377_10000609 Ga0157377_100006093 227
179 3300014969 Ga0157376_10105862 Ga0157376_101058622 227
180 3300017792 Ga0163161_10004063 Ga0163161_100040635 227
181 3300017792 Ga0163161_10330600 Ga0163161_103306002 227
182 3300017792 Ga0163161_10416601 Ga0163161_104166012 227
183 3300025208 Ga0209436_103434 Ga0209436_1034344 227
184 3300025242 Ga0209258_100041 Ga0209258_100041296 227
185 3300025254 Ga0209148_1000375 Ga0209148_100037534 227
186 3300025302 Ga0207426_1005998 Ga0207426_10059985 227
187 3300025304 Ga0209257_1000001 Ga0209257_10000011550 227
188 3300025315 Ga0207697_10209297 Ga0207697_102092971 227
189 3300025903 Ga0207680_10001827 Ga0207680_100018272 227
190 3300025904 Ga0207647_10097633 Ga0207647_100976331 227
191 3300025909 Ga0207705_10304266 Ga0207705_103042662 227
192 3300025911 Ga0207654_10002035 Ga0207654_100020358 227
193 3300025912 Ga0207707_10124089 Ga0207707_101240892 227
194 3300025914 Ga0207671_10002263 Ga0207671_1000226313 227
195 3300025920 Ga0207649_10134095 Ga0207649_101340952 227
196 3300025921 Ga0207652_10005231 Ga0207652_100052314 227
197 3300025923 Ga0207681_10208712 Ga0207681_102087122 227
198 3300025925 Ga0207650_10066105 Ga0207650_100661052 227
199 3300025925 Ga0207650_10075064 Ga0207650_100750643 227
200 3300025925 Ga0207650_10576062 Ga0207650_105760621 227
201 3300025933 Ga0207706_10039831 Ga0207706_100398314 227
202 3300025933 Ga0207706_10211089 Ga0207706_102110892 227
203 3300025936 Ga0207670_10021911 Ga0207670_100219113 227
204 3300025936 Ga0207670_10242109 Ga0207670_102421092 227
205 3300025940 Ga0207691_10202827 Ga0207691_102028272 227
206 3300025942 Ga0207689_10002850 Ga0207689_100028507 227
207 3300025942 Ga0207689_10005374 Ga0207689_100053746 227
208 3300025944 Ga0207661_10201369 Ga0207661_102013692 227
209 3300025960 Ga0207651_10015025 Ga0207651_100150253 227
210 3300025960 Ga0207651_10338948 Ga0207651_103389481 227
211 3300025960 Ga0207651_10431744 Ga0207651_104317442 227
212 3300025961 Ga0207712_10009739 Ga0207712_100097393 227
213 3300025961 Ga0207712_10133264 Ga0207712_101332643 227
214 3300025961 Ga0207712_10138403 Ga0207712_101384032 227
215 3300025972 Ga0207668_10010816 Ga0207668_100108165 227
216 3300025981 Ga0207640_10102336 Ga0207640_101023363 227
217 3300025986 Ga0207658_10157291 Ga0207658_101572912 227
218 3300025986 Ga0207658_10205596 Ga0207658_102055962 227
219 3300025986 Ga0207658_10232033 Ga0207658_102320332 227
220 3300026035 Ga0207703_10018113 Ga0207703_100181133 227
221 3300026035 Ga0207703_10176374 Ga0207703_101763743 227
222 3300026067 Ga0207678_10007776 Ga0207678_100077763 227
223 3300026067 Ga0207678_10008796 Ga0207678_100087968 227
224 3300026075 Ga0207708_10041488 Ga0207708_100414883 227
225 3300026075 Ga0207708_10333386 Ga0207708_103333862 227
226 3300026078 Ga0207702_10006649 Ga0207702_100066498 227
227 3300026088 Ga0207641_10000053 Ga0207641_10000053143 227
228 3300026088 Ga0207641_10605651 Ga0207641_106056512 227
229 3300026095 Ga0207676_10008331 Ga0207676_100083312 227
230 3300026095 Ga0207676_10051507 Ga0207676_100515072 227
231 3300026095 Ga0207676_10064284 Ga0207676_100642842 227
232 3300026116 Ga0207674_10014672 Ga0207674_100146727 227
233 3300026116 Ga0207674_10016792 Ga0207674_100167922 227
234 3300026116 Ga0207674_10307972 Ga0207674_103079721 227
235 3300026118 Ga0207675_100001377 Ga0207675_1000013774 227
236 3300026142 Ga0207698_10285526 Ga0207698_102855262 227
237 3300026142 Ga0207698_10345603 Ga0207698_103456032 227
238 3300027907 Ga0207428_10483690 Ga0207428_104836901 227
239 3300028379 Ga0268266_10144440 Ga0268266_101444402 227
240 3300028380 Ga0268265_10201250 Ga0268265_102012502 227
241 3300028380 Ga0268265_10511125 Ga0268265_105111252 227
242 3300028381 Ga0268264_10005526 Ga0268264_100055267 227
243 3300028794 Ga0307515_10000251 Ga0307515_1000025157 227
244 3300031995 Ga0307409_100420606 Ga0307409_1004206061 227
245 3300036401 Ga0373937_0251464 Ga0373937_0251464_726_1409 227
246 3300037312 Ga0395899_0000055 Ga0395899_0000055_147802_148494 227
247 3300037418 Ga0395900_0519563 Ga0395900_0519563_246_938 227
248 3300041443 Ga0451789_0348491 Ga0451789_0348491_214_909 227
249 3300044656 Ga0466969_0053762 Ga0466969_0053762_1133_1825 227
250 3300044673 Ga0453683_0107586 Ga0453683_0107586_493_1179 227
251 3300044712 Ga0453684_0139100 Ga0453684_0139100_1289_1975 227
252 3300045051 Ga0451576_0784059 Ga0451576_0784059_266_952 227
253 3300045836 Ga0466958_0095179 Ga0466958_0095179_444_1136 227
254 3300046507 Ga0495606_0003826 Ga0495606_0003826_12086_12769 227
255 3300046558 Ga0495633_0000336 Ga0495633_0000336_20414_21112 227
256 3300048913 Ga0496110_0243462 Ga0496110_0243462_623_1306 227
257 3300048918 Ga0496115_0029082 Ga0496115_0029082_67_756 227
258 3300048924 Ga0496121_0000030 Ga0496121_0000030_77273_77971 227
259 3300048928 Ga0496125_0001693 Ga0496125_0001693_16802_17491 227
260 3300048929 Ga0496126_0012879 Ga0496126_0012879_5308_6006 227
261 3300049758 Ga0501241_001293 Ga0501241_001293_104_802 227
262 3300050511 nmdc:mga08y16_217785_c1 nmdc:mga08y16_217785_c1_339_1028 227
263 3300050511 nmdc:mga08y16_6927_c1 nmdc:mga08y16_6927_c1_5543_6226 227
264 3300053088 Ga0500644_0000160 Ga0500644_0000160_2691_3395 227
265 3300053090 Ga0500646_0016005 Ga0500646_0016005_976_1680 227
266 3300053092 Ga0500583_0007739 Ga0500583_0007739_2642_3346 227
267 3300053093 Ga0500651_0115320 Ga0500651_0115320_579_1277 227
268 3300053096 Ga0500641_0000179 Ga0500641_0000179_4260_4949 227
269 3300053109 Ga0500569_004454 Ga0500569_004454_397_1101 227
270 3300053134 Ga0500658_0052394 Ga0500658_0052394_388_1092 227
271 3300053136 Ga0500559_0017379 Ga0500559_0017379_2008_2712 227
272 3300053142 Ga0500577_0014448 Ga0500577_0014448_1122_1826 227
273 3300053148 Ga0500590_036194 Ga0500590_036194_494_1198 227
274 3300053153 Ga0500616_0059102 Ga0500616_0059102_397_1101 227
275 3300053156 Ga0500622_0000220 Ga0500622_0000220_31444_32142 227
276 3300053160 Ga0500633_0000109 Ga0500633_0000109_3320_4024 227
277 3300053177 Ga0500636_0043278 Ga0500636_0043278_1301_2005 227
278 3300055283 Ga0500661_004940 Ga0500661_004940_523_1221 227
279 3300003322 rootL2_10019594 rootL2_100195946 228
280 3300003323 rootH1_10045658 rootH1_1004565810 228
281 3300003323 rootH1_10289241 rootH1_102892411 228
282 3300005329 Ga0070683_100004076 Ga0070683_1000040765 228
283 3300014326 Ga0157380_10218972 Ga0157380_102189721 228
284 3300014969 Ga0157376_10215969 Ga0157376_102159691 228
285 3300025944 Ga0207661_10004283 Ga0207661_100042834 228
286 3300031727 Ga0316576_10142755 Ga0316576_101427552 228
287 3300032004 Ga0307414_10207304 Ga0307414_102073042 228
288 3300036712 Ga0316584_0124480 Ga0316584_0124480_917_1618 228
289 3300042876 Ga0451577_0078752 Ga0451577_0078752_163_855 228
290 3300042876 Ga0451577_0470922 Ga0451577_0470922_364_1050 228
291 3300045049 Ga0466959_0356875 Ga0466959_0356875_154_846 228
292 iso_pu_bacteria 2765235839 2765572161 228
293 iso_pu_bacteria 2833640130 2833643707 228
294 2162886007 SwRhRL2b_contig_845328 SwRhRL2b_0745.00004070 229
295 3300001989 JGI24739J22299_10024009 JGI24739J22299_100240094 229
296 3300001989 JGI24739J22299_10049144 JGI24739J22299_100491442 229
297 3300002739 JGI25158J39367_1008936 JGI25158J39367_10089362 229
298 3300003215 JGI25153J46596_10028311 JGI25153J46596_100283112 229
299 3300003215 JGI25153J46596_10037166 JGI25153J46596_100371661 229
300 3300003316 rootH1_10043452 rootH1_1004345213 229
301 3300003316 rootH1_10139959 rootH1_101399592 229
302 3300003320 rootH2_10069197 rootH2_100691977 229
303 3300003320 rootH2_10116291 rootH2_101162912 229
304 3300003320 rootH2_10141884 rootH2_101418842 229
305 3300003320 rootH2_10291360 rootH2_102913604 229
306 3300003322 rootL2_10266067 rootL2_102660672 229
307 3300003323 rootH1_10046734 rootH1_100467343 229
308 3300003323 rootH1_10054390 rootH1_100543902 229
309 3300003323 rootH1_10092032 rootH1_100920325 229
310 3300003323 rootH1_10297169 rootH1_102971691 229
311 3300003354 JGI25160J50197_1000735 JGI25160J50197_10007359 229
312 3300003354 JGI25160J50197_1002721 JGI25160J50197_10027219 229
313 3300003354 JGI25160J50197_1038322 JGI25160J50197_10383222 229
314 3300003771 Ga0055526_1015408 Ga0055526_10154082 229
315 3300003771 Ga0055526_1016070 Ga0055526_10160702 229
316 3300003790 Ga0055528_1001241 Ga0055528_100124112 229
317 3300003791 Ga0055530_10001539 Ga0055530_100015399 229
318 3300004625 Ga0055543_1004533 Ga0055543_10045336 229
319 3300005262 Ga0065165_1000525 Ga0065165_100052527 229
320 3300005262 Ga0065165_1001928 Ga0065165_10019283 229
321 3300005262 Ga0065165_1003790 Ga0065165_10037904 229
322 3300005288 Ga0065714_10016178 Ga0065714_100161783 229
323 3300005288 Ga0065714_10074157 Ga0065714_100741575 229
324 3300005289 Ga0065704_10089094 Ga0065704_100890944 229
325 3300005337 Ga0070682_100000206 Ga0070682_10000020629 229
326 3300005339 Ga0070660_100044793 Ga0070660_1000447932 229
327 3300005344 Ga0070661_100229499 Ga0070661_1002294992 229
328 3300005458 Ga0070681_10714040 Ga0070681_107140401 229
329 3300005471 Ga0070698_100183728 Ga0070698_1001837282 229
330 3300006195 Ga0075366_10051389 Ga0075366_100513892 229
331 3300009036 Ga0105244_10000114 Ga0105244_1000011421 229
332 3300009148 Ga0105243_10000002 Ga0105243_10000002154 229
333 3300009148 Ga0105243_10001230 Ga0105243_1000123019 229
334 3300013102 Ga0157371_10000076 Ga0157371_1000007612 229
335 3300013102 Ga0157371_10114440 Ga0157371_101144403 229
336 3300013104 Ga0157370_10002676 Ga0157370_100026765 229
337 3300013104 Ga0157370_10003635 Ga0157370_1000363512 229
338 3300013104 Ga0157370_10148523 Ga0157370_101485233 229
339 3300014497 Ga0182008_10000771 Ga0182008_1000077115 229
340 3300015261 Ga0182006_1000011 Ga0182006_1000011136 229
341 3300015261 Ga0182006_1002159 Ga0182006_10021596 229
342 3300015262 Ga0182007_10090235 Ga0182007_100902352 229
343 3300015265 Ga0182005_1000212 Ga0182005_100021212 229
344 3300017792 Ga0163161_10009250 Ga0163161_100092505 229
345 3300025208 Ga0209436_100247 Ga0209436_10024725 229
346 3300025208 Ga0209436_101783 Ga0209436_1017833 229
347 3300025208 Ga0209436_102268 Ga0209436_1022684 229
348 3300025246 Ga0209646_1007104 Ga0209646_10071043 229
349 3300025261 Ga0209233_1029796 Ga0209233_10297962 229
350 3300025273 Ga0209673_1000014 Ga0209673_1000014295 229
351 3300025273 Ga0209673_1000018 Ga0209673_1000018243 229
352 3300025284 Ga0209130_1001851 Ga0209130_10018513 229
353 3300025291 Ga0209675_1000032 Ga0209675_1000032245 229
354 3300025295 Ga0209564_1003450 Ga0209564_100345013 229
355 3300025295 Ga0209564_1005955 Ga0209564_10059559 229
356 3300025297 Ga0209758_1002678 Ga0209758_10026784 229
357 3300025298 Ga0209050_1000750 Ga0209050_100075029 229
358 3300025302 Ga0207426_1000002 Ga0207426_100000255 229
359 3300025302 Ga0207426_1000345 Ga0207426_100034542 229
360 3300025302 Ga0207426_1000612 Ga0207426_100061211 229
361 3300025302 Ga0207426_1006106 Ga0207426_10061062 229
362 3300025302 Ga0207426_1009304 Ga0207426_10093044 229
363 3300025304 Ga0209257_1003521 Ga0209257_100352112 229
364 3300025728 Ga0207655_1000631 Ga0207655_100063123 229
365 3300025912 Ga0207707_10337438 Ga0207707_103374382 229
366 3300025919 Ga0207657_10055447 Ga0207657_100554472 229
367 3300025935 Ga0207709_10000003 Ga0207709_10000003154 229
368 3300025935 Ga0207709_10000992 Ga0207709_100009923 229
369 3300025972 Ga0207668_10457053 Ga0207668_104570531 229
370 3300031507 Ga0307509_10078971 Ga0307509_100789713 229
371 3300031691 Ga0316579_10044910 Ga0316579_100449102 229
372 3300031727 Ga0316576_10004488 Ga0316576_100044882 229
373 3300031727 Ga0316576_10050699 Ga0316576_100506992 229
374 3300031727 Ga0316576_10384026 Ga0316576_103840262 229
375 3300031728 Ga0316578_10011255 Ga0316578_100112554 229
376 3300031728 Ga0316578_10052609 Ga0316578_100526093 229
377 3300031728 Ga0316578_10244157 Ga0316578_102441572 229
378 3300031733 Ga0316577_10060415 Ga0316577_100604152 229
379 3300031911 Ga0307412_10000012 Ga0307412_10000012321 229
380 3300031911 Ga0307412_10004726 Ga0307412_100047262 229
381 3300032004 Ga0307414_10000959 Ga0307414_100009596 229
382 3300032004 Ga0307414_10939424 Ga0307414_109394241 229
383 3300032133 Ga0316583_10100789 Ga0316583_101007892 229
384 3300032139 Ga0316580_10016208 Ga0316580_100162083 229
385 3300035398 Ga0316574_0011575 Ga0316574_0011575_3180_3881 229
386 3300035398 Ga0316574_0104809 Ga0316574_0104809_688_1389 229
387 3300035398 Ga0316574_0224151 Ga0316574_0224151_80_781 229
388 3300036647 Ga0316582_0006533 Ga0316582_0006533_2702_3403 229
389 3300036647 Ga0316582_0238888 Ga0316582_0238888_262_960 229
390 3300036647 Ga0316582_0503335 Ga0316582_0503335_100_801 229
391 3300036712 Ga0316584_0174854 Ga0316584_0174854_770_1471 229
392 3300036712 Ga0316584_0286361 Ga0316584_0286361_438_1139 229
393 3300037312 Ga0395899_0000237 Ga0395899_0000237_27345_28136 229
394 3300039062 Ga0400483_199042 Ga0400483_199042_11980_12678 229
395 3300041413 Ga0439465_0096837 Ga0439465_0096837_56_823 229
396 3300041456 Ga0451795_0214755 Ga0451795_0214755_449_1141 229
397 3300041463 Ga0451804_0656751 Ga0451804_0656751_35_727 229
398 3300041512 Ga0451853_3478125 Ga0451853_3478125_66_815 229
399 3300041997 Ga0439431_0005071 Ga0439431_0005071_2064_2831 229
400 3300042876 Ga0451577_0063547 Ga0451577_0063547_297_986 229
401 3300042876 Ga0451577_0472869 Ga0451577_0472869_416_1105 229
402 3300044673 Ga0453683_0000090 Ga0453683_0000090_118341_119030 229
403 3300044673 Ga0453683_0073285 Ga0453683_0073285_1388_2077 229
404 3300044712 Ga0453684_0000288 Ga0453684_0000288_211248_211937 229
405 3300044712 Ga0453684_0001448 Ga0453684_0001448_45335_46024 229
406 3300044712 Ga0453684_0285664 Ga0453684_0285664_234_923 229
407 3300044712 Ga0453684_0408513 Ga0453684_0408513_651_1340 229
408 3300044842 Ga0466957_0001931 Ga0466957_0001931_6923_7732 229
409 3300044842 Ga0466957_0047312 Ga0466957_0047312_1188_1886 229
410 3300044842 Ga0466957_0220926 Ga0466957_0220926_94_810 229
411 3300045051 Ga0451576_0009889 Ga0451576_0009889_7732_8421 229
412 3300045051 Ga0451576_0172778 Ga0451576_0172778_1261_1950 229
413 3300046453 Ga0495627_000003 Ga0495627_000003_477354_478043 229
414 3300046500 Ga0495596_0003542 Ga0495596_0003542_6806_7495 229
415 3300046507 Ga0495606_0014063 Ga0495606_0014063_1951_2661 229
416 3300046512 Ga0495610_0000001 Ga0495610_0000001_1336314_1337003 229
417 3300046512 Ga0495610_0004850 Ga0495610_0004850_1233_1928 229
418 3300046530 Ga0495654_0000001 Ga0495654_0000001_638371_639060 229
419 3300046558 Ga0495633_0000008 Ga0495633_0000008_73391_74080 229
420 3300047472 Ga0495686_0021583 Ga0495686_0021583_1842_2531 229
421 3300048905 Ga0496102_0323767 Ga0496102_0323767_722_1411 229
422 3300048916 Ga0496113_0056979 Ga0496113_0056979_815_1504 229
423 3300048919 Ga0496116_0000012 Ga0496116_0000012_66695_67384 229
424 3300048920 Ga0496117_0000050 Ga0496117_0000050_53053_53742 229
425 3300048921 Ga0496118_0000044 Ga0496118_0000044_239013_239702 229
426 3300048922 Ga0496119_0000002 Ga0496119_0000002_241191_241880 229
427 3300048925 Ga0496122_0000386 Ga0496122_0000386_74602_75291 229
428 3300048925 Ga0496122_0000848 Ga0496122_0000848_21168_21857 229
429 3300048925 Ga0496122_0001778 Ga0496122_0001778_21551_22252 229
430 3300048925 Ga0496122_0002418 Ga0496122_0002418_18854_19543 229
431 3300048925 Ga0496122_0005490 Ga0496122_0005490_12384_13073 229
432 3300048926 Ga0496123_0002309 Ga0496123_0002309_16236_16925 229
433 3300048926 Ga0496123_0005061 Ga0496123_0005061_513_1202 229
434 3300048926 Ga0496123_0012696 Ga0496123_0012696_1317_2006 229
435 3300048926 Ga0496123_0014350 Ga0496123_0014350_2788_3489 229
436 3300048927 Ga0496124_0005726 Ga0496124_0005726_11335_12024 229
437 3300048928 Ga0496125_0002510 Ga0496125_0002510_17588_18277 229
438 3300048928 Ga0496125_0004193 Ga0496125_0004193_2828_3517 229
439 3300048929 Ga0496126_0001648 Ga0496126_0001648_9028_9717 229
440 3300048929 Ga0496126_0226724 Ga0496126_0226724_263_952 229
441 3300049573 Ga0501037_0166917 Ga0501037_0166917_377_1069 229
442 3300049581 Ga0501047_0222108 Ga0501047_0222108_452_1144 229
443 3300049686 Ga0501257_023627 Ga0501257_023627_191_883 229
444 3300049703 Ga0501219_000172 Ga0501219_000172_10583_11275 229
445 3300049705 Ga0501225_0002003 Ga0501225_0002003_1745_2437 229
446 3300049758 Ga0501241_000013 Ga0501241_000013_37526_38242 229
447 3300049823 Ga0501044_0002693 Ga0501044_0002693_5299_5991 229
448 3300049823 Ga0501044_0558733 Ga0501044_0558733_333_1025 229
449 3300050005 Ga0501284_00003 Ga0501284_00003_187267_187959 229
450 3300050493 nmdc:mga0k408_18689_c1 nmdc:mga0k408_18689_c1_1778_2470 229
451 3300053086 Ga0500578_0001405 Ga0500578_0001405_16149_16841 229
452 3300053092 Ga0500583_0000410 Ga0500583_0000410_5800_6492 229
453 3300053134 Ga0500658_0019555 Ga0500658_0019555_809_1501 229
454 3300053146 Ga0500588_0036920 Ga0500588_0036920_93_785 229
455 3300053147 Ga0500589_000820 Ga0500589_000820_581_1273 229
456 3300053156 Ga0500622_0012421 Ga0500622_0012421_3299_3991 229
457 iso_pu_bacteria 2821136567 2821138618 229
458 iso_pu_bacteria 2904467357 2904469411 229
459 iso_pu_bacteria 2910245624 2910249278 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

44

227

0.74

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

47

224

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pke-assembly1.cif.gz_A crystal structure of haloacid delahogenase-like family hydrolase (np_639141.1) from xanthomonas campestris at 1.81 a resolution 0.9649 4 221
3ddh-assembly1.cif.gz_B the structure of a putative haloacid dehalogenase-like family hydrolase from bacteroides thetaiotaomicron vpi-5482 0.9525 1 228
3ddh-assembly1.cif.gz_A the structure of a putative haloacid dehalogenase-like family hydrolase from bacteroides thetaiotaomicron vpi-5482 0.947 4 228
3ddh-assembly1.cif.gz_B the structure of a putative haloacid dehalogenase-like family hydrolase from bacteroides thetaiotaomicron vpi-5482 0.9401 1 228
2pke-assembly1.cif.gz_B crystal structure of haloacid delahogenase-like family hydrolase (np_639141.1) from xanthomonas campestris at 1.81 a resolution 0.9048 2 228
ID Description Score Start End Superfamily
3ddhB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9581 20 99 1.10.150.240
3ddhB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9464 20 99 1.10.150.240
3ddhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9339 2 228 3.40.50.1000
3ddhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9142 2 228 3.40.50.1000
af_Q9W4J7_113_224_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8806 104 197 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A7Y4VKY2-F1-model_v4 HAD hydrolase-like protein 0.9937 1 172 GO:0016787
AF-A0A1F8QQK0-F1-model_v4 Haloacid dehalogenase 0.9903 5 190 GO:0016791
AF-A0A3D5IYQ8-F1-model_v4 HAD family hydrolase 0.9901 1 229 GO:0016791
AF-A0A7Y3HRJ6-F1-model_v4 HAD hydrolase-like protein 0.9895 3 200 GO:0016787
AF-A0A4Q5VVR3-F1-model_v4 deleted 0.9891 4 228

Feature Viewer

pLDDT pTM Quality
93.14 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map