F448392

General Info

Members Datasets Scaffolds Average Seq Length
459 173 459 191

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0532385|Ga0395900_0532385_325_1023
Length 222
Sequence MQISPQRVEAPRRDRNEQIRLVKRIVAALARLYLPWSMLNDRSSILSLLQTRRSAKPRELVGPGPTRDELERILTMAVRVPDHGKLHPWRLVTVAEDQRDALGAIFRQALADEDECAPFAKHEKADEFAHYAGQLIVLISAPIQGHKIPVWEQELSCGAVGMNLLLAATAVGYYSERVRRAFCSPGERIAGFIFIGQPSRELEERPRAALAEVWTEWQPPKP

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
140 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
172 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
173 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.49
Rhizosphere 95.86
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_8406955 2162886012 Bacteria 870
2 JGI24737J22298_10000375 3300001990 Bacteria 15198
3 JGI24737J22298_10043662 3300001990 Bacteria 1372
4 JGI24735J21928_10001012 3300002067 Bacteria 10051
5 JGI24735J21928_10035902 3300002067 Bacteria 1455
6 JGI24738J21930_10000224 3300002075 Bacteria 15326
7 rootH1_10071154 3300003323 Bacteria 1203
8 Ga0070658_10000260 3300005327 Bacteria 46341
9 Ga0070658_10085478 3300005327 Bacteria 2594
10 Ga0070658_10575902 3300005327 Unclassified 975
11 Ga0070658_10779429 3300005327 Bacteria 830
12 Ga0070676_10050722 3300005328 Bacteria 2434
13 Ga0070683_100001828 3300005329 Bacteria 16590
14 Ga0070683_100022444 3300005329 Bacteria 5641
15 Ga0070683_100955949 3300005329 Unclassified 822
16 Ga0070670_100015597 3300005331 Bacteria 6526
17 Ga0070670_100645950 3300005331 Bacteria 949
18 Ga0070666_10004011 3300005335 Bacteria 8937
19 Ga0070666_10006224 3300005335 Bacteria 7341
20 Ga0070666_10301435 3300005335 Bacteria 1141
21 Ga0070680_100008734 3300005336 Bacteria 7769
22 Ga0070680_100038411 3300005336 Bacteria 3872
23 Ga0070680_100044886 3300005336 Bacteria 3592
24 Ga0068868_100012499 3300005338 Bacteria 6207
25 Ga0068868_100012713 3300005338 Bacteria 6157
26 Ga0070660_100003134 3300005339 Bacteria 11362
27 Ga0070660_100004919 3300005339 Bacteria 9241
28 Ga0070660_100007487 3300005339 Bacteria 7611
29 Ga0070660_100013902 3300005339 Bacteria 5790
30 Ga0070660_100025557 3300005339 Bacteria 4390
31 Ga0070660_100063481 3300005339 Bacteria 2872
32 Ga0070660_100481507 3300005339 Bacteria 1031
33 Ga0070689_100061990 3300005340 Bacteria 2909
34 Ga0070691_10146710 3300005341 Bacteria 1206
35 Ga0070661_100000439 3300005344 Bacteria 31883
36 Ga0070661_100034097 3300005344 Bacteria 3691
37 Ga0070661_100133248 3300005344 Bacteria 1868
38 Ga0070661_100220857 3300005344 Bacteria 1453
39 Ga0070661_100275641 3300005344 Bacteria 1304
40 Ga0070661_100335449 3300005344 Bacteria 1183
41 Ga0070669_100325299 3300005353 Bacteria 1242
42 Ga0070675_100339557 3300005354 Bacteria 1330
43 Ga0070671_100011132 3300005355 Bacteria 7225
44 Ga0070671_100027431 3300005355 Bacteria 4689
45 Ga0070671_100073746 3300005355 Bacteria 2851
46 Ga0070671_100309938 3300005355 Bacteria 1344
47 Ga0070671_100458809 3300005355 Bacteria 1094
48 Ga0070671_101193097 3300005355 Unclassified 670
49 Ga0070674_100008921 3300005356 Bacteria 5989
50 Ga0070674_100074545 3300005356 Bacteria 2408
51 Ga0070674_100102064 3300005356 Bacteria 2091
52 Ga0070674_100286955 3300005356 Bacteria 1307
53 Ga0070674_100646998 3300005356 Bacteria 898
54 Ga0070674_101116546 3300005356 Bacteria 697
55 Ga0070673_100039610 3300005364 Bacteria 3608
56 Ga0070673_100125636 3300005364 Bacteria 2146
57 Ga0070688_100100888 3300005365 Bacteria 1903
58 Ga0070659_100000065 3300005366 Bacteria 82919
59 Ga0070659_100018472 3300005366 Bacteria 5262
60 Ga0070659_100031488 3300005366 Bacteria 4108
61 Ga0070659_100168810 3300005366 Bacteria 1791
62 Ga0070659_100184788 3300005366 Bacteria 1711
63 Ga0070667_100026784 3300005367 Bacteria 4797
64 Ga0070667_100347216 3300005367 Bacteria 1343
65 Ga0070714_100027275 3300005435 Bacteria 4728
66 Ga0070714_100467364 3300005435 Bacteria 1200
67 Ga0070713_100194429 3300005436 Bacteria 1829
68 Ga0070694_100053494 3300005444 Bacteria 2732
69 Ga0070663_100006864 3300005455 Bacteria 6890
70 Ga0070663_100019598 3300005455 Bacteria 4463
71 Ga0070663_100026675 3300005455 Bacteria 3915
72 Ga0070663_100126594 3300005455 Bacteria 1936
73 Ga0070678_100006946 3300005456 Bacteria 6679
74 Ga0070678_100068601 3300005456 Bacteria 2644
75 Ga0070662_100000010 3300005457 Bacteria 142717
76 Ga0070662_100008627 3300005457 Bacteria 6650
77 Ga0070662_100016183 3300005457 Bacteria 5004
78 Ga0070662_100132172 3300005457 Bacteria 1925
79 Ga0070681_10049284 3300005458 Bacteria 4207
80 Ga0070681_10082880 3300005458 Bacteria 3161
81 Ga0070681_10136481 3300005458 Bacteria 2384
82 Ga0068867_100042069 3300005459 Bacteria 3340
83 Ga0070679_100038907 3300005530 Bacteria 4729
84 Ga0070679_100039777 3300005530 Bacteria 4675
85 Ga0070679_100103627 3300005530 Bacteria 2831
86 Ga0070679_100293986 3300005530 Bacteria 1576
87 Ga0070684_100017032 3300005535 Bacteria 5956
88 Ga0070684_100057186 3300005535 Bacteria 3405
89 Ga0068853_100000396 3300005539 Bacteria 29782
90 Ga0068853_100079743 3300005539 Bacteria 2863
91 Ga0068853_100115443 3300005539 Bacteria 2389
92 Ga0068853_100284752 3300005539 Bacteria 1524
93 Ga0068853_100419502 3300005539 Bacteria 1255
94 Ga0068853_100523886 3300005539 Bacteria 1121
95 Ga0070672_100260762 3300005543 Bacteria 1462
96 Ga0070672_100322220 3300005543 Bacteria 1314
97 Ga0070672_100325767 3300005543 Bacteria 1306
98 Ga0070686_100180181 3300005544 Bacteria 1501
99 Ga0070665_100004913 3300005548 Bacteria 13867
100 Ga0070665_100181615 3300005548 Bacteria 2105
101 Ga0070665_100196172 3300005548 Bacteria 2020
102 Ga0070665_100330485 3300005548 Bacteria 1529
103 Ga0068855_100002953 3300005563 Bacteria 20778
104 Ga0068855_100004196 3300005563 Bacteria 17582
105 Ga0068855_100278914 3300005563 Bacteria 1856
106 Ga0068855_100280487 3300005563 Bacteria 1850
107 Ga0070664_100000992 3300005564 Bacteria 22212
108 Ga0070664_100126808 3300005564 Bacteria 2240
109 Ga0068857_100276689 3300005577 Bacteria 1543
110 Ga0068857_100279128 3300005577 Bacteria 1536
111 Ga0068857_101044585 3300005577 Bacteria 787
112 Ga0068857_101066487 3300005577 Bacteria 779
113 Ga0068854_100038840 3300005578 Bacteria 3350
114 Ga0068854_100123462 3300005578 Bacteria 1969
115 Ga0068854_100162655 3300005578 Bacteria 1730
116 Ga0068854_100203182 3300005578 Bacteria 1559
117 Ga0068854_100242241 3300005578 Bacteria 1436
118 Ga0068854_100250918 3300005578 Bacteria 1413
119 Ga0068856_100000101 3300005614 Bacteria 82391
120 Ga0068856_100006671 3300005614 Bacteria 11313
121 Ga0068856_100059824 3300005614 Bacteria 3763
122 Ga0068856_100072385 3300005614 Bacteria 3412
123 Ga0068856_100353060 3300005614 Bacteria 1489
124 Ga0068856_100718141 3300005614 Bacteria 1019
125 Ga0068856_100898644 3300005614 Unclassified 905
126 Ga0068852_100001142 3300005616 Bacteria 17566
127 Ga0068852_100009616 3300005616 Bacteria 7182
128 Ga0068852_100027136 3300005616 Bacteria 4663
129 Ga0068852_100146770 3300005616 Bacteria 2189
130 Ga0068852_100268617 3300005616 Bacteria 1640
131 Ga0068852_100277850 3300005616 Bacteria 1613
132 Ga0068852_100289289 3300005616 Bacteria 1582
133 Ga0068859_100030425 3300005617 Bacteria 5417
134 Ga0068859_100193110 3300005617 Bacteria 2120
135 Ga0068859_101284590 3300005617 Bacteria 806
136 Ga0068864_100001039 3300005618 Bacteria 23285
137 Ga0068864_100028520 3300005618 Bacteria 4719
138 Ga0068864_100040385 3300005618 Bacteria 3992
139 Ga0068864_100323132 3300005618 Bacteria 1450
140 Ga0068866_10084411 3300005718 Bacteria 1714
141 Ga0068851_10011222 3300005834 Bacteria 4197
142 Ga0068851_10066106 3300005834 Bacteria 1862
143 Ga0068851_10133417 3300005834 Bacteria 1345
144 Ga0068863_100022058 3300005841 Bacteria 6081
145 Ga0068858_100031902 3300005842 Bacteria 4895
146 Ga0068858_100329043 3300005842 Bacteria 1461
147 Ga0068860_100010737 3300005843 Bacteria 9043
148 Ga0068860_100182041 3300005843 Bacteria 2031
149 Ga0068862_100553746 3300005844 Bacteria 1098
150 Ga0068862_100555806 3300005844 Bacteria 1096
151 Ga0081539_10033538 3300005985 Bacteria 3123
152 Ga0097621_100017299 3300006237 Bacteria 5472
153 Ga0075431_100375759 3300006847 Bacteria 1426
154 Ga0097620_100030430 3300006931 Bacteria 5417
155 Ga0097620_100193101 3300006931 Bacteria 2120
156 Ga0097620_101284629 3300006931 Bacteria 806
157 Ga0097620_101284630 3300006931 Bacteria 806
158 Ga0105240_10036481 3300009093 Bacteria 6323
159 Ga0105247_10091559 3300009101 Bacteria 1931
160 Ga0105243_10181325 3300009148 Bacteria 1831
161 Ga0105243_10279096 3300009148 Bacteria 1504
162 Ga0105241_10010676 3300009174 Bacteria 6737
163 Ga0105242_10139702 3300009176 Bacteria 2101
164 Ga0105248_10001870 3300009177 Bacteria 23331
165 Ga0105248_10022148 3300009177 Bacteria 7043
166 Ga0105248_10654357 3300009177 Bacteria 1185
167 Ga0105248_11173763 3300009177 Bacteria 868
168 Ga0105237_10053768 3300009545 Bacteria 4038
169 Ga0105238_10006901 3300009551 Bacteria 11340
170 Ga0105238_10015895 3300009551 Bacteria 7615
171 Ga0105238_10035010 3300009551 Bacteria 5107
172 Ga0105249_10490850 3300009553 Bacteria 1272
173 Ga0105239_10130123 3300010375 Bacteria 2799
174 Ga0105246_10060154 3300011119 Bacteria 2638
175 Ga0105246_10110581 3300011119 Bacteria 2018
176 Ga0157373_10037784 3300013100 Bacteria 3460
177 Ga0157373_10706877 3300013100 Bacteria 739
178 Ga0157371_10001218 3300013102 Bacteria 27387
179 Ga0157371_10032159 3300013102 Bacteria 3776
180 Ga0157371_10145018 3300013102 Bacteria 1691
181 Ga0157370_10027882 3300013104 Bacteria 5564
182 Ga0157370_10029043 3300013104 Bacteria 5433
183 Ga0157370_10094415 3300013104 Bacteria 2806
184 Ga0157370_10123523 3300013104 Bacteria 2417
185 Ga0157369_10005567 3300013105 Bacteria 14622
186 Ga0157369_10010979 3300013105 Bacteria 10309
187 Ga0157369_10187606 3300013105 Bacteria 2174
188 Ga0157369_10374625 3300013105 Bacteria 1478
189 Ga0157369_10588919 3300013105 Bacteria 1148
190 Ga0157374_10728240 3300013296 Bacteria 1006
191 Ga0157374_11333688 3300013296 Unclassified 740
192 Ga0157378_10869236 3300013297 Unclassified 931
193 Ga0157372_10003113 3300013307 Bacteria 17884
194 Ga0157372_10093843 3300013307 Bacteria 3416
195 Ga0157372_10508393 3300013307 Bacteria 1405
196 Ga0157375_10153917 3300013308 Bacteria 2437
197 Ga0157375_10312496 3300013308 Bacteria 1736
198 Ga0163163_10000580 3300014325 Bacteria 32211
199 Ga0163163_10066705 3300014325 Bacteria 3575
200 Ga0163163_10473403 3300014325 Bacteria 1313
201 Ga0163163_10654124 3300014325 Bacteria 1114
202 Ga0157377_10518713 3300014745 Bacteria 836
203 Ga0157379_10140038 3300014968 Bacteria 2181
204 Ga0157376_10059707 3300014969 Bacteria 3198
205 Ga0213875_10028218 3300021388 Bacteria 2667
206 Ga0207697_10101259 3300025315 Bacteria 1228
207 Ga0207656_10006676 3300025321 Bacteria 4166
208 Ga0207642_10052178 3300025899 Bacteria 1854
209 Ga0207642_10076829 3300025899 Bacteria 1609
210 Ga0207688_10050221 3300025901 Bacteria 2334
211 Ga0207680_10001072 3300025903 Bacteria 12900
212 Ga0207680_10003153 3300025903 Bacteria 7741
213 Ga0207680_10102725 3300025903 Bacteria 1840
214 Ga0207680_10279842 3300025903 Bacteria 1159
215 Ga0207647_10002885 3300025904 Bacteria 12953
216 Ga0207647_10003379 3300025904 Bacteria 11970
217 Ga0207647_10014514 3300025904 Bacteria 5429
218 Ga0207647_10043790 3300025904 Bacteria 2799
219 Ga0207647_10144318 3300025904 Bacteria 1394
220 Ga0207647_10248870 3300025904 Bacteria 1020
221 Ga0207647_10467224 3300025904 Unclassified 706
222 Ga0207645_10061856 3300025907 Bacteria 2392
223 Ga0207705_10000113 3300025909 Bacteria 90567
224 Ga0207705_10000448 3300025909 Bacteria 35488
225 Ga0207705_10014604 3300025909 Bacteria 5651
226 Ga0207705_10084364 3300025909 Bacteria 2319
227 Ga0207705_10116247 3300025909 Bacteria 1980
228 Ga0207705_10123321 3300025909 Bacteria 1924
229 Ga0207705_10166339 3300025909 Bacteria 1659
230 Ga0207705_10195755 3300025909 Unclassified 1530
231 Ga0207705_10207902 3300025909 Bacteria 1484
232 Ga0207654_10004653 3300025911 Bacteria 6936
233 Ga0207654_10394649 3300025911 Bacteria 961
234 Ga0207707_10062699 3300025912 Bacteria 3235
235 Ga0207707_10110419 3300025912 Bacteria 2403
236 Ga0207695_10106072 3300025913 Bacteria 2796
237 Ga0207671_10120038 3300025914 Bacteria 2009
238 Ga0207660_10028808 3300025917 Bacteria 3802
239 Ga0207660_10104052 3300025917 Bacteria 2125
240 Ga0207657_10000026 3300025919 Bacteria 143118
241 Ga0207657_10000278 3300025919 Bacteria 54678
242 Ga0207657_10004865 3300025919 Bacteria 14135
243 Ga0207657_10014993 3300025919 Bacteria 7528
244 Ga0207657_10035525 3300025919 Bacteria 4468
245 Ga0207657_10041946 3300025919 Bacteria 4041
246 Ga0207657_10045167 3300025919 Bacteria 3869
247 Ga0207657_10066552 3300025919 Bacteria 3067
248 Ga0207657_10143023 3300025919 Bacteria 1953
249 Ga0207657_10356139 3300025919 Bacteria 1154
250 Ga0207649_10001918 3300025920 Bacteria 11872
251 Ga0207649_10029991 3300025920 Bacteria 3216
252 Ga0207649_10156100 3300025920 Bacteria 1577
253 Ga0207649_10179433 3300025920 Bacteria 1481
254 Ga0207649_10205147 3300025920 Bacteria 1395
255 Ga0207649_10240530 3300025920 Bacteria 1299
256 Ga0207649_10624870 3300025920 Bacteria 830
257 Ga0207652_10000465 3300025921 Bacteria 41540
258 Ga0207652_10073377 3300025921 Bacteria 2977
259 Ga0207652_10098868 3300025921 Bacteria 2574
260 Ga0207652_10136662 3300025921 Bacteria 2189
261 Ga0207652_10165254 3300025921 Bacteria 1984
262 Ga0207681_10250930 3300025923 Bacteria 1381
263 Ga0207694_10004638 3300025924 Bacteria 10697
264 Ga0207694_10025286 3300025924 Bacteria 4512
265 Ga0207650_10156298 3300025925 Bacteria 1803
266 Ga0207650_10168490 3300025925 Bacteria 1739
267 Ga0207659_10293386 3300025926 Bacteria 1333
268 Ga0207659_10329862 3300025926 Bacteria 1261
269 Ga0207700_10277387 3300025928 Bacteria 1441
270 Ga0207664_10035017 3300025929 Bacteria 3871
271 Ga0207664_10483469 3300025929 Bacteria 1108
272 Ga0207644_10000141 3300025931 Bacteria 51791
273 Ga0207644_10003740 3300025931 Bacteria 9861
274 Ga0207644_10010361 3300025931 Bacteria 6145
275 Ga0207644_10015650 3300025931 Bacteria 5095
276 Ga0207644_10153729 3300025931 Bacteria 1782
277 Ga0207690_10000036 3300025932 Bacteria 143853
278 Ga0207690_10031500 3300025932 Bacteria 3394
279 Ga0207690_10094847 3300025932 Bacteria 2118
280 Ga0207690_10107923 3300025932 Bacteria 2000
281 Ga0207690_10546134 3300025932 Bacteria 941
282 Ga0207706_10000031 3300025933 Bacteria 143109
283 Ga0207706_10002634 3300025933 Bacteria 17481
284 Ga0207706_10011975 3300025933 Bacteria 7899
285 Ga0207706_10102430 3300025933 Bacteria 2519
286 Ga0207686_10220908 3300025934 Bacteria 1368
287 Ga0207709_10381157 3300025935 Bacteria 1073
288 Ga0207709_10472394 3300025935 Bacteria 973
289 Ga0207669_10073461 3300025937 Bacteria 2158
290 Ga0207669_10095849 3300025937 Bacteria 1946
291 Ga0207669_10818872 3300025937 Bacteria 773
292 Ga0207691_10017617 3300025940 Bacteria 6768
293 Ga0207691_10052652 3300025940 Bacteria 3718
294 Ga0207691_10278180 3300025940 Bacteria 1440
295 Ga0207711_10000446 3300025941 Bacteria 43126
296 Ga0207711_10001681 3300025941 Bacteria 20384
297 Ga0207711_10036153 3300025941 Bacteria 4190
298 Ga0207711_10167183 3300025941 Bacteria 1994
299 Ga0207689_10048946 3300025942 Bacteria 3487
300 Ga0207689_10384176 3300025942 Bacteria 1169
301 Ga0207661_10006059 3300025944 Bacteria 8540
302 Ga0207661_10129633 3300025944 Bacteria 2158
303 Ga0207679_10000093 3300025945 Bacteria 78331
304 Ga0207679_10078640 3300025945 Bacteria 2513
305 Ga0207667_10019103 3300025949 Bacteria 7662
306 Ga0207667_10029924 3300025949 Bacteria 5898
307 Ga0207667_10035974 3300025949 Bacteria 5310
308 Ga0207667_10077408 3300025949 Bacteria 3450
309 Ga0207667_10105343 3300025949 Bacteria 2909
310 Ga0207651_10584603 3300025960 Bacteria 974
311 Ga0207640_10005614 3300025981 Bacteria 6840
312 Ga0207640_10007355 3300025981 Bacteria 6080
313 Ga0207640_10033692 3300025981 Bacteria 3190
314 Ga0207640_10052479 3300025981 Bacteria 2656
315 Ga0207640_10131247 3300025981 Bacteria 1811
316 Ga0207640_10144154 3300025981 Bacteria 1740
317 Ga0207640_10197340 3300025981 Bacteria 1522
318 Ga0207677_10006971 3300026023 Bacteria 6215
319 Ga0207677_10011783 3300026023 Bacteria 4999
320 Ga0207677_10036236 3300026023 Bacteria 3213
321 Ga0207703_10003718 3300026035 Bacteria 12695
322 Ga0207703_10092208 3300026035 Bacteria 2549
323 Ga0207639_10001599 3300026041 Bacteria 15228
324 Ga0207639_10021314 3300026041 Bacteria 4653
325 Ga0207639_10030754 3300026041 Bacteria 3940
326 Ga0207639_10473977 3300026041 Bacteria 1140
327 Ga0207678_10000265 3300026067 Bacteria 47379
328 Ga0207678_10019169 3300026067 Bacteria 6006
329 Ga0207678_10044732 3300026067 Bacteria 3829
330 Ga0207678_10046433 3300026067 Bacteria 3755
331 Ga0207678_10061994 3300026067 Bacteria 3216
332 Ga0207702_10000353 3300026078 Bacteria 52560
333 Ga0207702_10032782 3300026078 Bacteria 4335
334 Ga0207702_10105742 3300026078 Bacteria 2493
335 Ga0207702_10563602 3300026078 Bacteria 1115
336 Ga0207702_11234698 3300026078 Unclassified 741
337 Ga0207641_10030826 3300026088 Bacteria 4444
338 Ga0207641_10205960 3300026088 Bacteria 1816
339 Ga0207641_10212315 3300026088 Bacteria 1790
340 Ga0207648_10027331 3300026089 Bacteria 5066
341 Ga0207648_10029038 3300026089 Bacteria 4904
342 Ga0207648_10178973 3300026089 Bacteria 1876
343 Ga0207676_10008600 3300026095 Bacteria 7253
344 Ga0207676_10016645 3300026095 Bacteria 5326
345 Ga0207676_10163729 3300026095 Bacteria 1930
346 Ga0207674_10016204 3300026116 Bacteria 8163
347 Ga0207674_10052413 3300026116 Bacteria 4161
348 Ga0207674_10658527 3300026116 Bacteria 1011
349 Ga0207683_10005837 3300026121 Bacteria 10555
350 Ga0207683_10089439 3300026121 Bacteria 2741
351 Ga0207698_10003104 3300026142 Bacteria 9965
352 Ga0207698_10007352 3300026142 Bacteria 6904
353 Ga0207698_10035439 3300026142 Bacteria 3650
354 Ga0207698_10062838 3300026142 Bacteria 2902
355 Ga0207698_10128258 3300026142 Bacteria 2162
356 Ga0268266_10027043 3300028379 Bacteria 4881
357 Ga0268266_10190142 3300028379 Bacteria 1874
358 Ga0268266_10193335 3300028379 Bacteria 1859
359 Ga0268265_10293942 3300028380 Bacteria 1459
360 Ga0268264_10001234 3300028381 Bacteria 24544
361 Ga0268264_10356690 3300028381 Bacteria 1393
362 Ga0268264_11267971 3300028381 Unclassified 747
363 Ga0316182_1389001 3300030745 Bacteria 1584
364 Ga0307405_10805552 3300031731 Bacteria 787
365 Ga0307413_10527114 3300031824 Bacteria 954
366 Ga0307410_10025269 3300031852 Bacteria 3724
367 Ga0307410_10412719 3300031852 Bacteria 1093
368 Ga0307406_10240881 3300031901 Bacteria 1357
369 Ga0307406_10470364 3300031901 Bacteria 1013
370 Ga0307409_100090321 3300031995 Bacteria 2507
371 Ga0307416_100142397 3300032002 Bacteria 2182
372 Ga0307414_10248599 3300032004 Bacteria 1477
373 Ga0373949_0049032 3300035090 Bacteria 1059
374 Ga0373960_0015845 3300035121 Bacteria 1930
375 Ga0373931_0013473 3300035691 Bacteria 3982
376 Ga0395899_0003429 3300037312 Bacteria 12571
377 Ga0395899_0029034 3300037312 Bacteria 4161
378 Ga0395899_0044258 3300037312 Bacteria 3318
379 Ga0395899_0053199 3300037312 Bacteria 2999
380 Ga0395899_0192668 3300037312 Bacteria 1426
381 Ga0395900_0005818 3300037418 Bacteria 12880
382 Ga0395900_0007745 3300037418 Bacteria 11080
383 Ga0395900_0017045 3300037418 Bacteria 7416
384 Ga0395900_0025891 3300037418 Bacteria 6005
385 Ga0395900_0062621 3300037418 Bacteria 3824
386 Ga0395900_0098976 3300037418 Bacteria 2996
387 Ga0395900_0135921 3300037418 Bacteria 2518
388 Ga0395900_0292412 3300037418 Bacteria 1617
389 Ga0395900_0424443 3300037418 Bacteria 1290
390 Ga0395900_0532385 3300037418 Bacteria 1121
391 Ga0395898_0016676 3300037466 Bacteria 7508
392 Ga0395898_0022279 3300037466 Bacteria 6416
393 Ga0395898_0352118 3300037466 Unclassified 1404
394 Ga0395898_0528216 3300037466 Bacteria 1121
395 Ga0395898_1318009 3300037466 Bacteria 651
396 Ga0395905_0002782 3300037471 Bacteria 19152
397 Ga0395905_0004759 3300037471 Bacteria 14028
398 Ga0395905_0011289 3300037471 Bacteria 8635
399 Ga0395905_0028490 3300037471 Bacteria 5265
400 Ga0395905_0030537 3300037471 Bacteria 5076
401 Ga0395905_0035057 3300037471 Bacteria 4711
402 Ga0395905_0038639 3300037471 Bacteria 4478
403 Ga0395905_0082452 3300037471 Bacteria 3013
404 Ga0395905_0118998 3300037471 Bacteria 2483
405 Ga0395905_0210187 3300037471 Bacteria 1823
406 Ga0395905_0239519 3300037471 Bacteria 1695
407 Ga0395905_0363705 3300037471 Bacteria 1339
408 Ga0395905_0705880 3300037471 Bacteria 911
409 Ga0395905_0736094 3300037471 Bacteria 888
410 Ga0436364_0131873 3300037853 Bacteria 5530
411 Ga0395901_0000872 3300038443 Bacteria 33280
412 Ga0395901_0012625 3300038443 Bacteria 8571
413 Ga0395901_0045214 3300038443 Bacteria 4568
414 Ga0395901_0049545 3300038443 Bacteria 4365
415 Ga0395901_0098609 3300038443 Bacteria 3064
416 Ga0395901_0193264 3300038443 Bacteria 2134
417 Ga0395901_0202507 3300038443 Bacteria 2080
418 Ga0395901_0351289 3300038443 Bacteria 1521
419 Ga0395901_0373559 3300038443 Bacteria 1468
420 Ga0395901_0395372 3300038443 Bacteria 1421
421 Ga0395901_0409927 3300038443 Bacteria 1391
422 Ga0395901_0608224 3300038443 Bacteria 1101
423 Ga0466969_0158592 3300044656 Bacteria 1040
424 Ga0466966_0150365 3300044684 Bacteria 1420
425 Ga0466963_0034233 3300044694 Bacteria 3305
426 Ga0466963_0070444 3300044694 Bacteria 2352
427 Ga0466963_0304839 3300044694 Bacteria 1120
428 Ga0466964_0252646 3300044706 Bacteria 870
429 Ga0466971_0243516 3300044719 Bacteria 856
430 Ga0466957_0268716 3300044842 Bacteria 1138
431 Ga0466957_0289501 3300044842 Bacteria 1098
432 Ga0466960_0450508 3300044901 Unclassified 748
433 Ga0466959_0081692 3300045049 Bacteria 2329
434 Ga0466967_0275017 3300045976 Bacteria 1615
435 Ga0466967_0404797 3300045976 Bacteria 1328
436 Ga0466967_0470735 3300045976 Bacteria 1230
437 Ga0466967_0525314 3300045976 Bacteria 1163
438 Ga0495643_0201314 3300046522 Unclassified 956
439 Ga0495670_0216045 3300046691 Bacteria 1018
440 Ga0495687_073335 3300047443 Bacteria 1365
441 Ga0496100_0734702 3300048903 Unclassified 771
442 Ga0496101_0047882 3300048904 Bacteria 3070
443 Ga0496101_0131747 3300048904 Bacteria 1899
444 Ga0496105_0324302 3300048908 Bacteria 1234
445 Ga0496106_0078613 3300048909 Bacteria 2532
446 Ga0496107_0201351 3300048910 Bacteria 1480
447 Ga0496108_0046713 3300048911 Bacteria 3618
448 Ga0496108_0136044 3300048911 Bacteria 2114
449 Ga0496109_0040514 3300048912 Bacteria 4219
450 Ga0496109_0078365 3300048912 Bacteria 3042
451 Ga0496109_0211340 3300048912 Bacteria 1824
452 Ga0496110_0063420 3300048913 Bacteria 3265
453 Ga0496111_0431350 3300048914 Bacteria 973
454 Ga0496112_0003520 3300048915 Bacteria 12985
455 Ga0496112_0110238 3300048915 Bacteria 2722
456 Ga0496113_0010917 3300048916 Bacteria 6029
457 Ga0501235_016351 3300049669 Bacteria 1639
458 Ga0501249_058344 3300049679 Bacteria 892
459 Ga0501221_027962 3300049704 Bacteria 1157

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10869236 Ga0157378_108692362 166
2 3300037471 Ga0395905_0705880 Ga0395905_0705880_22_609 177
3 3300005435 Ga0070714_100027275 Ga0070714_1000272752 181
4 3300005614 Ga0068856_100072385 Ga0068856_1000723853 181
5 3300025929 Ga0207664_10035017 Ga0207664_100350173 181
6 3300003323 rootH1_10071154 rootH1_100711542 182
7 3300005328 Ga0070676_10050722 Ga0070676_100507222 182
8 3300005335 Ga0070666_10006224 Ga0070666_100062245 182
9 3300005338 Ga0068868_100012713 Ga0068868_1000127134 182
10 3300005355 Ga0070671_100073746 Ga0070671_1000737464 182
11 3300005356 Ga0070674_100008921 Ga0070674_1000089214 182
12 3300005365 Ga0070688_100100888 Ga0070688_1001008883 182
13 3300005577 Ga0068857_101066487 Ga0068857_1010664871 182
14 3300005843 Ga0068860_100182041 Ga0068860_1001820411 182
15 3300025903 Ga0207680_10003153 Ga0207680_100031536 182
16 3300025904 Ga0207647_10003379 Ga0207647_100033795 182
17 3300026023 Ga0207677_10006971 Ga0207677_100069712 182
18 3300028381 Ga0268264_11267971 Ga0268264_112679712 182
19 3300045976 Ga0466967_0470735 Ga0466967_0470735_291_905 182
20 3300005329 Ga0070683_100955949 Ga0070683_1009559491 183
21 3300005344 Ga0070661_100034097 Ga0070661_1000340974 183
22 3300005435 Ga0070714_100467364 Ga0070714_1004673642 183
23 3300005455 Ga0070663_100019598 Ga0070663_1000195983 183
24 3300005578 Ga0068854_100038840 Ga0068854_1000388403 183
25 3300005614 Ga0068856_100059824 Ga0068856_1000598244 183
26 3300005616 Ga0068852_100268617 Ga0068852_1002686171 183
27 3300025909 Ga0207705_10195755 Ga0207705_101957552 183
28 3300025909 Ga0207705_10207902 Ga0207705_102079023 183
29 3300025920 Ga0207649_10624870 Ga0207649_106248701 183
30 3300025929 Ga0207664_10483469 Ga0207664_104834692 183
31 3300025981 Ga0207640_10007355 Ga0207640_100073555 183
32 3300026078 Ga0207702_10105742 Ga0207702_101057423 183
33 3300026089 Ga0207648_10178973 Ga0207648_101789732 183
34 3300037418 Ga0395900_0532385 Ga0395900_0532385_325_1023 183
35 3300037466 Ga0395898_0528216 Ga0395898_0528216_325_1023 183
36 3300037471 Ga0395905_0363705 Ga0395905_0363705_325_1023 183
37 3300038443 Ga0395901_0098609 Ga0395901_0098609_1411_1998 183
38 3300038443 Ga0395901_0351289 Ga0395901_0351289_646_1344 183
39 3300044719 Ga0466971_0243516 Ga0466971_0243516_243_830 183
40 3300045976 Ga0466967_0275017 Ga0466967_0275017_337_915 183
41 3300001990 JGI24737J22298_10043662 JGI24737J22298_100436621 184
42 3300005327 Ga0070658_10779429 Ga0070658_107794291 184
43 3300005338 Ga0068868_100012499 Ga0068868_1000124992 184
44 3300005340 Ga0070689_100061990 Ga0070689_1000619903 184
45 3300005353 Ga0070669_100325299 Ga0070669_1003252991 184
46 3300005366 Ga0070659_100031488 Ga0070659_1000314882 184
47 3300005444 Ga0070694_100053494 Ga0070694_1000534942 184
48 3300005530 Ga0070679_100293986 Ga0070679_1002939861 184
49 3300005539 Ga0068853_100523886 Ga0068853_1005238862 184
50 3300005543 Ga0070672_100325767 Ga0070672_1003257673 184
51 3300005548 Ga0070665_100181615 Ga0070665_1001816152 184
52 3300005548 Ga0070665_100196172 Ga0070665_1001961722 184
53 3300005563 Ga0068855_100280487 Ga0068855_1002804872 184
54 3300005577 Ga0068857_100276689 Ga0068857_1002766892 184
55 3300005578 Ga0068854_100250918 Ga0068854_1002509182 184
56 3300005617 Ga0068859_100193110 Ga0068859_1001931103 184
57 3300005617 Ga0068859_101284590 Ga0068859_1012845901 184
58 3300005842 Ga0068858_100031902 Ga0068858_1000319022 184
59 3300005843 Ga0068860_100010737 Ga0068860_1000107373 184
60 3300005844 Ga0068862_100555806 Ga0068862_1005558062 184
61 3300006237 Ga0097621_100017299 Ga0097621_1000172994 184
62 3300006847 Ga0075431_100375759 Ga0075431_1003757592 184
63 3300006931 Ga0097620_100193101 Ga0097620_1001931013 184
64 3300006931 Ga0097620_101284629 Ga0097620_1012846291 184
65 3300009101 Ga0105247_10091559 Ga0105247_100915592 184
66 3300009148 Ga0105243_10279096 Ga0105243_102790963 184
67 3300009177 Ga0105248_10022148 Ga0105248_100221482 184
68 3300009553 Ga0105249_10490850 Ga0105249_104908503 184
69 3300011119 Ga0105246_10060154 Ga0105246_100601542 184
70 3300014745 Ga0157377_10518713 Ga0157377_105187131 184
71 3300014968 Ga0157379_10140038 Ga0157379_101400383 184
72 3300025899 Ga0207642_10052178 Ga0207642_100521782 184
73 3300025904 Ga0207647_10144318 Ga0207647_101443181 184
74 3300025909 Ga0207705_10166339 Ga0207705_101663391 184
75 3300025919 Ga0207657_10014993 Ga0207657_100149938 184
76 3300025921 Ga0207652_10165254 Ga0207652_101652543 184
77 3300025926 Ga0207659_10329862 Ga0207659_103298622 184
78 3300025932 Ga0207690_10031500 Ga0207690_100315003 184
79 3300025933 Ga0207706_10102430 Ga0207706_101024302 184
80 3300025940 Ga0207691_10017617 Ga0207691_100176173 184
81 3300025941 Ga0207711_10036153 Ga0207711_100361537 184
82 3300025942 Ga0207689_10048946 Ga0207689_100489462 184
83 3300025949 Ga0207667_10019103 Ga0207667_100191035 184
84 3300025981 Ga0207640_10197340 Ga0207640_101973402 184
85 3300026023 Ga0207677_10011783 Ga0207677_100117832 184
86 3300026035 Ga0207703_10003718 Ga0207703_100037187 184
87 3300026041 Ga0207639_10473977 Ga0207639_104739772 184
88 3300026067 Ga0207678_10044732 Ga0207678_100447322 184
89 3300026116 Ga0207674_10052413 Ga0207674_100524133 184
90 3300028379 Ga0268266_10190142 Ga0268266_101901422 184
91 3300028381 Ga0268264_10001234 Ga0268264_100012345 184
92 3300037418 Ga0395900_0007745 Ga0395900_0007745_2697_3293 184
93 3300037471 Ga0395905_0002782 Ga0395905_0002782_7198_7794 184
94 3300037471 Ga0395905_0210187 Ga0395905_0210187_469_1056 184
95 3300044694 Ga0466963_0070444 Ga0466963_0070444_460_1047 184
96 3300044706 Ga0466964_0252646 Ga0466964_0252646_261_848 184
97 3300044842 Ga0466957_0268716 Ga0466957_0268716_29_616 184
98 3300044901 Ga0466960_0450508 Ga0466960_0450508_77_664 184
99 3300045049 Ga0466959_0081692 Ga0466959_0081692_65_652 184
100 3300045976 Ga0466967_0404797 Ga0466967_0404797_370_957 184
101 3300002067 JGI24735J21928_10001012 JGI24735J21928_100010123 185
102 3300005327 Ga0070658_10085478 Ga0070658_100854783 185
103 3300005327 Ga0070658_10575902 Ga0070658_105759022 185
104 3300005329 Ga0070683_100022444 Ga0070683_1000224442 185
105 3300005335 Ga0070666_10301435 Ga0070666_103014352 185
106 3300005336 Ga0070680_100008734 Ga0070680_1000087349 185
107 3300005336 Ga0070680_100044886 Ga0070680_1000448865 185
108 3300005339 Ga0070660_100007487 Ga0070660_1000074874 185
109 3300005339 Ga0070660_100013902 Ga0070660_1000139022 185
110 3300005339 Ga0070660_100481507 Ga0070660_1004815071 185
111 3300005344 Ga0070661_100275641 Ga0070661_1002756412 185
112 3300005344 Ga0070661_100335449 Ga0070661_1003354492 185
113 3300005355 Ga0070671_100011132 Ga0070671_1000111325 185
114 3300005355 Ga0070671_100458809 Ga0070671_1004588092 185
115 3300005355 Ga0070671_101193097 Ga0070671_1011930971 185
116 3300005356 Ga0070674_100286955 Ga0070674_1002869552 185
117 3300005356 Ga0070674_100646998 Ga0070674_1006469982 185
118 3300005356 Ga0070674_101116546 Ga0070674_1011165461 185
119 3300005364 Ga0070673_100039610 Ga0070673_1000396105 185
120 3300005364 Ga0070673_100125636 Ga0070673_1001256363 185
121 3300005366 Ga0070659_100018472 Ga0070659_1000184722 185
122 3300005436 Ga0070713_100194429 Ga0070713_1001944292 185
123 3300005455 Ga0070663_100026675 Ga0070663_1000266755 185
124 3300005456 Ga0070678_100006946 Ga0070678_1000069464 185
125 3300005457 Ga0070662_100008627 Ga0070662_1000086274 185
126 3300005457 Ga0070662_100132172 Ga0070662_1001321722 185
127 3300005458 Ga0070681_10049284 Ga0070681_100492842 185
128 3300005458 Ga0070681_10082880 Ga0070681_100828802 185
129 3300005530 Ga0070679_100038907 Ga0070679_1000389072 185
130 3300005535 Ga0070684_100057186 Ga0070684_1000571864 185
131 3300005539 Ga0068853_100079743 Ga0068853_1000797432 185
132 3300005539 Ga0068853_100115443 Ga0068853_1001154432 185
133 3300005543 Ga0070672_100322220 Ga0070672_1003222201 185
134 3300005563 Ga0068855_100004196 Ga0068855_10000419613 185
135 3300005563 Ga0068855_100278914 Ga0068855_1002789143 185
136 3300005577 Ga0068857_100279128 Ga0068857_1002791281 185
137 3300005577 Ga0068857_101044585 Ga0068857_1010445851 185
138 3300005578 Ga0068854_100162655 Ga0068854_1001626552 185
139 3300005578 Ga0068854_100242241 Ga0068854_1002422413 185
140 3300005614 Ga0068856_100353060 Ga0068856_1003530602 185
141 3300005616 Ga0068852_100009616 Ga0068852_1000096165 185
142 3300005616 Ga0068852_100027136 Ga0068852_1000271362 185
143 3300005616 Ga0068852_100146770 Ga0068852_1001467702 185
144 3300005618 Ga0068864_100001039 Ga0068864_10000103917 185
145 3300005834 Ga0068851_10066106 Ga0068851_100661062 185
146 3300005834 Ga0068851_10133417 Ga0068851_101334172 185
147 3300005841 Ga0068863_100022058 Ga0068863_1000220582 185
148 3300005844 Ga0068862_100553746 Ga0068862_1005537462 185
149 3300009093 Ga0105240_10036481 Ga0105240_100364814 185
150 3300009177 Ga0105248_10001870 Ga0105248_1000187014 185
151 3300009177 Ga0105248_10654357 Ga0105248_106543571 185
152 3300009177 Ga0105248_11173763 Ga0105248_111737631 185
153 3300009551 Ga0105238_10006901 Ga0105238_100069015 185
154 3300009551 Ga0105238_10015895 Ga0105238_1001589510 185
155 3300010375 Ga0105239_10130123 Ga0105239_101301233 185
156 3300013102 Ga0157371_10032159 Ga0157371_100321593 185
157 3300013102 Ga0157371_10145018 Ga0157371_101450182 185
158 3300013104 Ga0157370_10027882 Ga0157370_100278822 185
159 3300013104 Ga0157370_10094415 Ga0157370_100944152 185
160 3300013105 Ga0157369_10005567 Ga0157369_1000556714 185
161 3300013296 Ga0157374_10728240 Ga0157374_107282402 185
162 3300013307 Ga0157372_10003113 Ga0157372_1000311315 185
163 3300013308 Ga0157375_10312496 Ga0157375_103124962 185
164 3300014325 Ga0163163_10473403 Ga0163163_104734032 185
165 3300014325 Ga0163163_10654124 Ga0163163_106541242 185
166 3300025903 Ga0207680_10102725 Ga0207680_101027252 185
167 3300025903 Ga0207680_10279842 Ga0207680_102798422 185
168 3300025904 Ga0207647_10002885 Ga0207647_1000288510 185
169 3300025904 Ga0207647_10014514 Ga0207647_100145148 185
170 3300025904 Ga0207647_10467224 Ga0207647_104672241 185
171 3300025909 Ga0207705_10000448 Ga0207705_100004483 185
172 3300025909 Ga0207705_10014604 Ga0207705_100146043 185
173 3300025909 Ga0207705_10116247 Ga0207705_101162473 185
174 3300025912 Ga0207707_10062699 Ga0207707_100626992 185
175 3300025912 Ga0207707_10110419 Ga0207707_101104193 185
176 3300025913 Ga0207695_10106072 Ga0207695_101060722 185
177 3300025914 Ga0207671_10120038 Ga0207671_101200382 185
178 3300025917 Ga0207660_10028808 Ga0207660_100288084 185
179 3300025917 Ga0207660_10104052 Ga0207660_101040522 185
180 3300025919 Ga0207657_10000278 Ga0207657_1000027819 185
181 3300025919 Ga0207657_10045167 Ga0207657_100451676 185
182 3300025919 Ga0207657_10356139 Ga0207657_103561392 185
183 3300025920 Ga0207649_10205147 Ga0207649_102051472 185
184 3300025920 Ga0207649_10240530 Ga0207649_102405302 185
185 3300025921 Ga0207652_10000465 Ga0207652_1000046531 185
186 3300025921 Ga0207652_10098868 Ga0207652_100988683 185
187 3300025923 Ga0207681_10250930 Ga0207681_102509302 185
188 3300025924 Ga0207694_10004638 Ga0207694_1000463812 185
189 3300025925 Ga0207650_10168490 Ga0207650_101684903 185
190 3300025928 Ga0207700_10277387 Ga0207700_102773873 185
191 3300025931 Ga0207644_10000141 Ga0207644_1000014128 185
192 3300025931 Ga0207644_10003740 Ga0207644_100037404 185
193 3300025931 Ga0207644_10015650 Ga0207644_100156505 185
194 3300025932 Ga0207690_10107923 Ga0207690_101079233 185
195 3300025933 Ga0207706_10011975 Ga0207706_100119756 185
196 3300025937 Ga0207669_10095849 Ga0207669_100958492 185
197 3300025937 Ga0207669_10818872 Ga0207669_108188721 185
198 3300025940 Ga0207691_10052652 Ga0207691_100526526 185
199 3300025941 Ga0207711_10001681 Ga0207711_100016819 185
200 3300025941 Ga0207711_10167183 Ga0207711_101671832 185
201 3300025944 Ga0207661_10129633 Ga0207661_101296333 185
202 3300025949 Ga0207667_10029924 Ga0207667_100299244 185
203 3300025949 Ga0207667_10077408 Ga0207667_100774082 185
204 3300025981 Ga0207640_10052479 Ga0207640_100524792 185
205 3300025981 Ga0207640_10131247 Ga0207640_101312472 185
206 3300025981 Ga0207640_10144154 Ga0207640_101441542 185
207 3300026041 Ga0207639_10001599 Ga0207639_100015995 185
208 3300026067 Ga0207678_10000265 Ga0207678_1000026510 185
209 3300026078 Ga0207702_10032782 Ga0207702_100327824 185
210 3300026078 Ga0207702_10563602 Ga0207702_105636022 185
211 3300026088 Ga0207641_10030826 Ga0207641_100308262 185
212 3300026088 Ga0207641_10205960 Ga0207641_102059602 185
213 3300026095 Ga0207676_10008600 Ga0207676_100086003 185
214 3300026116 Ga0207674_10016204 Ga0207674_100162043 185
215 3300026116 Ga0207674_10658527 Ga0207674_106585272 185
216 3300026121 Ga0207683_10005837 Ga0207683_100058378 185
217 3300026142 Ga0207698_10007352 Ga0207698_100073525 185
218 3300026142 Ga0207698_10035439 Ga0207698_100354393 185
219 3300030745 Ga0316182_1389001 Ga0316182_13890012 185
220 3300031824 Ga0307413_10527114 Ga0307413_105271141 185
221 3300037312 Ga0395899_0003429 Ga0395899_0003429_6417_7004 185
222 3300037312 Ga0395899_0044258 Ga0395899_0044258_957_1544 185
223 3300037312 Ga0395899_0053199 Ga0395899_0053199_2227_2814 185
224 3300037418 Ga0395900_0005818 Ga0395900_0005818_2406_2993 185
225 3300037418 Ga0395900_0017045 Ga0395900_0017045_5552_6187 185
226 3300037418 Ga0395900_0025891 Ga0395900_0025891_3460_4047 185
227 3300037418 Ga0395900_0292412 Ga0395900_0292412_547_1134 185
228 3300037466 Ga0395898_0016676 Ga0395898_0016676_1354_1941 185
229 3300037466 Ga0395898_0022279 Ga0395898_0022279_678_1265 185
230 3300037466 Ga0395898_0352118 Ga0395898_0352118_285_872 185
231 3300037471 Ga0395905_0004759 Ga0395905_0004759_10867_11502 185
232 3300037471 Ga0395905_0028490 Ga0395905_0028490_3377_3964 185
233 3300037471 Ga0395905_0030537 Ga0395905_0030537_2173_2760 185
234 3300037471 Ga0395905_0035057 Ga0395905_0035057_684_1271 185
235 3300037471 Ga0395905_0082452 Ga0395905_0082452_2082_2717 185
236 3300037471 Ga0395905_0239519 Ga0395905_0239519_203_790 185
237 3300037471 Ga0395905_0736094 Ga0395905_0736094_24_611 185
238 3300038443 Ga0395901_0000872 Ga0395901_0000872_2406_2993 185
239 3300038443 Ga0395901_0012625 Ga0395901_0012625_7833_8420 185
240 3300038443 Ga0395901_0193264 Ga0395901_0193264_119_706 185
241 3300038443 Ga0395901_0202507 Ga0395901_0202507_215_802 185
242 3300038443 Ga0395901_0373559 Ga0395901_0373559_308_895 185
243 3300038443 Ga0395901_0409927 Ga0395901_0409927_276_911 185
244 3300038443 Ga0395901_0608224 Ga0395901_0608224_257_892 185
245 3300044656 Ga0466969_0158592 Ga0466969_0158592_323_916 185
246 3300044684 Ga0466966_0150365 Ga0466966_0150365_659_1252 185
247 3300045976 Ga0466967_0525314 Ga0466967_0525314_343_930 185
248 3300046522 Ga0495643_0201314 Ga0495643_0201314_115_780 185
249 3300046691 Ga0495670_0216045 Ga0495670_0216045_333_920 185
250 3300047443 Ga0495687_073335 Ga0495687_073335_444_1109 185
251 3300048904 Ga0496101_0131747 Ga0496101_0131747_507_1094 185
252 3300048908 Ga0496105_0324302 Ga0496105_0324302_325_912 185
253 3300048910 Ga0496107_0201351 Ga0496107_0201351_540_1127 185
254 3300048911 Ga0496108_0046713 Ga0496108_0046713_265_852 185
255 3300048911 Ga0496108_0136044 Ga0496108_0136044_475_1062 185
256 3300048912 Ga0496109_0040514 Ga0496109_0040514_1509_2096 185
257 3300048912 Ga0496109_0078365 Ga0496109_0078365_1922_2509 185
258 3300048913 Ga0496110_0063420 Ga0496110_0063420_1424_2011 185
259 3300048914 Ga0496111_0431350 Ga0496111_0431350_59_646 185
260 3300048915 Ga0496112_0003520 Ga0496112_0003520_1506_2093 185
261 3300048915 Ga0496112_0110238 Ga0496112_0110238_1304_1891 185
262 3300048916 Ga0496113_0010917 Ga0496113_0010917_1014_1601 185
263 2162886012 MBSR1b_contig_8406955 MBSR1b_0441.00004260 186
264 3300001990 JGI24737J22298_10000375 JGI24737J22298_100003753 186
265 3300002067 JGI24735J21928_10035902 JGI24735J21928_100359022 186
266 3300002075 JGI24738J21930_10000224 JGI24738J21930_100002248 186
267 3300005327 Ga0070658_10000260 Ga0070658_1000026035 186
268 3300005329 Ga0070683_100001828 Ga0070683_1000018286 186
269 3300005331 Ga0070670_100015597 Ga0070670_1000155974 186
270 3300005331 Ga0070670_100645950 Ga0070670_1006459502 186
271 3300005335 Ga0070666_10004011 Ga0070666_100040117 186
272 3300005336 Ga0070680_100038411 Ga0070680_1000384116 186
273 3300005339 Ga0070660_100003134 Ga0070660_1000031349 186
274 3300005339 Ga0070660_100004919 Ga0070660_10000491910 186
275 3300005339 Ga0070660_100025557 Ga0070660_1000255572 186
276 3300005339 Ga0070660_100063481 Ga0070660_1000634812 186
277 3300005341 Ga0070691_10146710 Ga0070691_101467102 186
278 3300005344 Ga0070661_100000439 Ga0070661_10000043935 186
279 3300005344 Ga0070661_100133248 Ga0070661_1001332483 186
280 3300005344 Ga0070661_100220857 Ga0070661_1002208572 186
281 3300005354 Ga0070675_100339557 Ga0070675_1003395572 186
282 3300005355 Ga0070671_100027431 Ga0070671_1000274313 186
283 3300005355 Ga0070671_100309938 Ga0070671_1003099382 186
284 3300005356 Ga0070674_100074545 Ga0070674_1000745452 186
285 3300005356 Ga0070674_100102064 Ga0070674_1001020643 186
286 3300005366 Ga0070659_100000065 Ga0070659_10000006559 186
287 3300005366 Ga0070659_100168810 Ga0070659_1001688102 186
288 3300005366 Ga0070659_100184788 Ga0070659_1001847881 186
289 3300005367 Ga0070667_100026784 Ga0070667_1000267843 186
290 3300005367 Ga0070667_100347216 Ga0070667_1003472162 186
291 3300005455 Ga0070663_100006864 Ga0070663_1000068645 186
292 3300005455 Ga0070663_100126594 Ga0070663_1001265942 186
293 3300005456 Ga0070678_100068601 Ga0070678_1000686013 186
294 3300005457 Ga0070662_100000010 Ga0070662_100000010102 186
295 3300005457 Ga0070662_100016183 Ga0070662_1000161832 186
296 3300005458 Ga0070681_10136481 Ga0070681_101364812 186
297 3300005459 Ga0068867_100042069 Ga0068867_1000420693 186
298 3300005530 Ga0070679_100039777 Ga0070679_1000397771 186
299 3300005530 Ga0070679_100103627 Ga0070679_1001036273 186
300 3300005535 Ga0070684_100017032 Ga0070684_1000170326 186
301 3300005539 Ga0068853_100000396 Ga0068853_10000039636 186
302 3300005539 Ga0068853_100284752 Ga0068853_1002847523 186
303 3300005539 Ga0068853_100419502 Ga0068853_1004195022 186
304 3300005543 Ga0070672_100260762 Ga0070672_1002607622 186
305 3300005544 Ga0070686_100180181 Ga0070686_1001801812 186
306 3300005548 Ga0070665_100004913 Ga0070665_1000049131 186
307 3300005548 Ga0070665_100330485 Ga0070665_1003304852 186
308 3300005563 Ga0068855_100002953 Ga0068855_1000029532 186
309 3300005564 Ga0070664_100000992 Ga0070664_10000099219 186
310 3300005564 Ga0070664_100126808 Ga0070664_1001268082 186
311 3300005578 Ga0068854_100123462 Ga0068854_1001234621 186
312 3300005578 Ga0068854_100203182 Ga0068854_1002031822 186
313 3300005614 Ga0068856_100000101 Ga0068856_10000010135 186
314 3300005614 Ga0068856_100006671 Ga0068856_1000066716 186
315 3300005614 Ga0068856_100718141 Ga0068856_1007181412 186
316 3300005614 Ga0068856_100898644 Ga0068856_1008986442 186
317 3300005616 Ga0068852_100001142 Ga0068852_1000011429 186
318 3300005616 Ga0068852_100277850 Ga0068852_1002778503 186
319 3300005616 Ga0068852_100289289 Ga0068852_1002892892 186
320 3300005617 Ga0068859_100030425 Ga0068859_1000304258 186
321 3300005618 Ga0068864_100028520 Ga0068864_1000285207 186
322 3300005618 Ga0068864_100040385 Ga0068864_1000403852 186
323 3300005618 Ga0068864_100323132 Ga0068864_1003231323 186
324 3300005718 Ga0068866_10084411 Ga0068866_100844112 186
325 3300005834 Ga0068851_10011222 Ga0068851_100112223 186
326 3300005842 Ga0068858_100329043 Ga0068858_1003290432 186
327 3300005985 Ga0081539_10033538 Ga0081539_100335383 186
328 3300006931 Ga0097620_100030430 Ga0097620_1000304302 186
329 3300006931 Ga0097620_101284630 Ga0097620_1012846301 186
330 3300009148 Ga0105243_10181325 Ga0105243_101813252 186
331 3300009174 Ga0105241_10010676 Ga0105241_100106768 186
332 3300009176 Ga0105242_10139702 Ga0105242_101397022 186
333 3300009545 Ga0105237_10053768 Ga0105237_100537683 186
334 3300009551 Ga0105238_10035010 Ga0105238_100350104 186
335 3300011119 Ga0105246_10110581 Ga0105246_101105812 186
336 3300013100 Ga0157373_10037784 Ga0157373_100377842 186
337 3300013100 Ga0157373_10706877 Ga0157373_107068771 186
338 3300013102 Ga0157371_10001218 Ga0157371_1000121819 186
339 3300013104 Ga0157370_10029043 Ga0157370_100290433 186
340 3300013104 Ga0157370_10123523 Ga0157370_101235233 186
341 3300013105 Ga0157369_10010979 Ga0157369_100109796 186
342 3300013105 Ga0157369_10187606 Ga0157369_101876062 186
343 3300013105 Ga0157369_10374625 Ga0157369_103746252 186
344 3300013105 Ga0157369_10588919 Ga0157369_105889192 186
345 3300013296 Ga0157374_11333688 Ga0157374_113336881 186
346 3300013307 Ga0157372_10093843 Ga0157372_100938432 186
347 3300013307 Ga0157372_10508393 Ga0157372_105083934 186
348 3300013308 Ga0157375_10153917 Ga0157375_101539172 186
349 3300014325 Ga0163163_10000580 Ga0163163_1000058035 186
350 3300014325 Ga0163163_10066705 Ga0163163_100667053 186
351 3300014969 Ga0157376_10059707 Ga0157376_100597075 186
352 3300021388 Ga0213875_10028218 Ga0213875_100282183 186
353 3300025315 Ga0207697_10101259 Ga0207697_101012592 186
354 3300025321 Ga0207656_10006676 Ga0207656_100066763 186
355 3300025899 Ga0207642_10076829 Ga0207642_100768293 186
356 3300025901 Ga0207688_10050221 Ga0207688_100502212 186
357 3300025903 Ga0207680_10001072 Ga0207680_100010725 186
358 3300025904 Ga0207647_10043790 Ga0207647_100437902 186
359 3300025904 Ga0207647_10248870 Ga0207647_102488702 186
360 3300025907 Ga0207645_10061856 Ga0207645_100618563 186
361 3300025909 Ga0207705_10000113 Ga0207705_1000011349 186
362 3300025909 Ga0207705_10084364 Ga0207705_100843643 186
363 3300025909 Ga0207705_10123321 Ga0207705_101233213 186
364 3300025911 Ga0207654_10004653 Ga0207654_100046532 186
365 3300025911 Ga0207654_10394649 Ga0207654_103946491 186
366 3300025919 Ga0207657_10000026 Ga0207657_1000002635 186
367 3300025919 Ga0207657_10004865 Ga0207657_100048652 186
368 3300025919 Ga0207657_10035525 Ga0207657_100355254 186
369 3300025919 Ga0207657_10041946 Ga0207657_100419462 186
370 3300025919 Ga0207657_10066552 Ga0207657_100665522 186
371 3300025919 Ga0207657_10143023 Ga0207657_101430232 186
372 3300025920 Ga0207649_10001918 Ga0207649_100019189 186
373 3300025920 Ga0207649_10029991 Ga0207649_100299912 186
374 3300025920 Ga0207649_10156100 Ga0207649_101561001 186
375 3300025920 Ga0207649_10179433 Ga0207649_101794331 186
376 3300025921 Ga0207652_10073377 Ga0207652_100733772 186
377 3300025921 Ga0207652_10136662 Ga0207652_101366622 186
378 3300025924 Ga0207694_10025286 Ga0207694_100252862 186
379 3300025925 Ga0207650_10156298 Ga0207650_101562982 186
380 3300025926 Ga0207659_10293386 Ga0207659_102933862 186
381 3300025931 Ga0207644_10010361 Ga0207644_100103615 186
382 3300025931 Ga0207644_10153729 Ga0207644_101537291 186
383 3300025932 Ga0207690_10000036 Ga0207690_1000003619 186
384 3300025932 Ga0207690_10094847 Ga0207690_100948472 186
385 3300025932 Ga0207690_10546134 Ga0207690_105461342 186
386 3300025933 Ga0207706_10000031 Ga0207706_10000031100 186
387 3300025933 Ga0207706_10002634 Ga0207706_100026349 186
388 3300025934 Ga0207686_10220908 Ga0207686_102209082 186
389 3300025935 Ga0207709_10381157 Ga0207709_103811571 186
390 3300025935 Ga0207709_10472394 Ga0207709_104723941 186
391 3300025937 Ga0207669_10073461 Ga0207669_100734612 186
392 3300025940 Ga0207691_10278180 Ga0207691_102781802 186
393 3300025941 Ga0207711_10000446 Ga0207711_100004463 186
394 3300025942 Ga0207689_10384176 Ga0207689_103841763 186
395 3300025944 Ga0207661_10006059 Ga0207661_100060596 186
396 3300025945 Ga0207679_10000093 Ga0207679_1000009319 186
397 3300025945 Ga0207679_10078640 Ga0207679_100786403 186
398 3300025949 Ga0207667_10035974 Ga0207667_100359743 186
399 3300025949 Ga0207667_10105343 Ga0207667_101053433 186
400 3300025960 Ga0207651_10584603 Ga0207651_105846031 186
401 3300025981 Ga0207640_10005614 Ga0207640_100056142 186
402 3300025981 Ga0207640_10033692 Ga0207640_100336922 186
403 3300026023 Ga0207677_10036236 Ga0207677_100362365 186
404 3300026035 Ga0207703_10092208 Ga0207703_100922084 186
405 3300026041 Ga0207639_10021314 Ga0207639_100213143 186
406 3300026041 Ga0207639_10030754 Ga0207639_100307545 186
407 3300026067 Ga0207678_10019169 Ga0207678_100191695 186
408 3300026067 Ga0207678_10046433 Ga0207678_100464333 186
409 3300026067 Ga0207678_10061994 Ga0207678_100619945 186
410 3300026078 Ga0207702_10000353 Ga0207702_1000035322 186
411 3300026078 Ga0207702_11234698 Ga0207702_112346981 186
412 3300026088 Ga0207641_10212315 Ga0207641_102123152 186
413 3300026089 Ga0207648_10027331 Ga0207648_100273312 186
414 3300026089 Ga0207648_10029038 Ga0207648_100290382 186
415 3300026095 Ga0207676_10016645 Ga0207676_100166457 186
416 3300026095 Ga0207676_10163729 Ga0207676_101637292 186
417 3300026121 Ga0207683_10089439 Ga0207683_100894392 186
418 3300026142 Ga0207698_10003104 Ga0207698_100031048 186
419 3300026142 Ga0207698_10062838 Ga0207698_100628382 186
420 3300026142 Ga0207698_10128258 Ga0207698_101282582 186
421 3300028379 Ga0268266_10027043 Ga0268266_100270432 186
422 3300028379 Ga0268266_10193335 Ga0268266_101933352 186
423 3300028380 Ga0268265_10293942 Ga0268265_102939422 186
424 3300028381 Ga0268264_10356690 Ga0268264_103566902 186
425 3300031731 Ga0307405_10805552 Ga0307405_108055521 186
426 3300031852 Ga0307410_10025269 Ga0307410_100252693 186
427 3300031852 Ga0307410_10412719 Ga0307410_104127192 186
428 3300031901 Ga0307406_10240881 Ga0307406_102408812 186
429 3300031901 Ga0307406_10470364 Ga0307406_104703641 186
430 3300031995 Ga0307409_100090321 Ga0307409_1000903214 186
431 3300032002 Ga0307416_100142397 Ga0307416_1001423973 186
432 3300032004 Ga0307414_10248599 Ga0307414_102485991 186
433 3300035090 Ga0373949_0049032 Ga0373949_0049032_326_913 186
434 3300035121 Ga0373960_0015845 Ga0373960_0015845_1313_1900 186
435 3300035691 Ga0373931_0013473 Ga0373931_0013473_2948_3535 186
436 3300037312 Ga0395899_0029034 Ga0395899_0029034_1196_1783 186
437 3300037312 Ga0395899_0192668 Ga0395899_0192668_49_636 186
438 3300037418 Ga0395900_0062621 Ga0395900_0062621_1527_2123 186
439 3300037418 Ga0395900_0098976 Ga0395900_0098976_432_1028 186
440 3300037418 Ga0395900_0135921 Ga0395900_0135921_755_1342 186
441 3300037418 Ga0395900_0424443 Ga0395900_0424443_660_1247 186
442 3300037466 Ga0395898_1318009 Ga0395898_1318009_34_621 186
443 3300037471 Ga0395905_0011289 Ga0395905_0011289_748_1344 186
444 3300037471 Ga0395905_0038639 Ga0395905_0038639_3070_3738 186
445 3300037471 Ga0395905_0118998 Ga0395905_0118998_1236_1823 186
446 3300037853 Ga0436364_0131873 Ga0436364_0131873_4308_4925 186
447 3300038443 Ga0395901_0045214 Ga0395901_0045214_1072_1659 186
448 3300038443 Ga0395901_0049545 Ga0395901_0049545_1376_1972 186
449 3300038443 Ga0395901_0395372 Ga0395901_0395372_51_638 186
450 3300044694 Ga0466963_0034233 Ga0466963_0034233_1579_2166 186
451 3300044694 Ga0466963_0304839 Ga0466963_0304839_449_1036 186
452 3300044842 Ga0466957_0289501 Ga0466957_0289501_129_713 186
453 3300048903 Ga0496100_0734702 Ga0496100_0734702_121_720 186
454 3300048904 Ga0496101_0047882 Ga0496101_0047882_1135_1734 186
455 3300048909 Ga0496106_0078613 Ga0496106_0078613_1762_2361 186
456 3300048912 Ga0496109_0211340 Ga0496109_0211340_1213_1812 186
457 3300049669 Ga0501235_016351 Ga0501235_016351_734_1351 186
458 3300049679 Ga0501249_058344 Ga0501249_058344_86_673 186
459 3300049704 Ga0501221_027962 Ga0501221_027962_183_800 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

49

196

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dil-assembly2.cif.gz_C crystal structure of putative nitroreductase from salmonella enterica 0.8678 6 164
3k6h-assembly1.cif.gz_B crystal structure of a nitroreductase family protein from agrobacterium tumefaciens str. c58 0.852 4 186
8dil-assembly1.cif.gz_A crystal structure of putative nitroreductase from salmonella enterica 0.8414 6 183
7tmf-assembly1.cif.gz_A crystal structure of nad(p)h nitroreductase from klebsiella pneumoniae (short b-axis) 0.8413 5 165
8dil-assembly1.cif.gz_A crystal structure of putative nitroreductase from salmonella enterica 0.837 6 183
ID Description Score Start End Superfamily
3k6hB01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8895 7 165 3.40.109.10
3k6hB01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8497 7 165 3.40.109.10
af_Q9H9J2_55_186_1.10.1520.10 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.8002 60 91 1.10.1520.10
2i7hE00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.7691 3 182 3.40.109.10
af_Q2G001_1_177_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.7687 6 175 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A2H0HTM1-F1-model_v4 Nitroreductase 0.9321 23 163 GO:0016491
AF-A0A530Y0L6-F1-model_v4 Nitroreductase 0.9229 23 129 GO:0016491
AF-A0A530Y0L6-F1-model_v4 Nitroreductase 0.907 23 129 GO:0016491
AF-A0A0K6HKC2-F1-model_v4 deleted 0.9069 9 141
AF-A0A848QMQ9-F1-model_v4 deleted 0.9055 7 163

Feature Viewer

pLDDT pTM Quality
78.97 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map