F448375

General Info

Members Datasets Scaffolds Average Seq Length
459 176 918 145

Family's Representative Sequence

Representative Sequence 3300026023|Ga0207677_10144942|Ga0207677_101449422
Length 154
Sequence MILLALAAAAAMQWTGPRTEEYKGPGYFCGGGYAIRLGKGERALILPQGQAPQATRLVLSGGEVNIHTGARPQPGPVVMHYRGGTSVTQQSDDGVAYVVADQTSFALAVTSDAFRGFKRDGWFFSKANFAEGADERVSCLAAAFSAPAAWFCVR

Samples

Sample ID Description Type Environment
1 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
55 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
125 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
126 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
127 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
137 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
138 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
139 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
167 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
168 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
169 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
170 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
171 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
172 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
173 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
174 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
175 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.96
Rhizosphere 96.51
Stem 0
Stem Tuber 0
Unclassified 11.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207677_10144942 3300026023 Bacteria 1824
2 JGI24741J21665_1010994 3300001915 Bacteria 1598
3 JGI24739J22299_10048375 3300001989 Unclassified 1384
4 JGI24735J21928_10007407 3300002067 Bacteria 3581
5 JGI24744J21845_10000072 3300002077 Bacteria 12527
6 JGI24742J22300_10009704 3300002244 Bacteria 1590
7 rootH2_10314456 3300003320 Bacteria 1226
8 rootH1_10184702 3300003323 Bacteria 1901
9 Ga0070658_10019836 3300005327 Bacteria 5386
10 Ga0070658_10273710 3300005327 Bacteria 1436
11 Ga0070658_10938389 3300005327 Bacteria 752
12 Ga0070676_10760563 3300005328 Bacteria 712
13 Ga0070683_100710785 3300005329 Bacteria 962
14 Ga0070683_100713035 3300005329 Bacteria 961
15 Ga0070683_101889884 3300005329 Unclassified 574
16 Ga0070670_100001151 3300005331 Bacteria 20976
17 Ga0070670_100096175 3300005331 Bacteria 2548
18 Ga0068869_100036108 3300005334 Bacteria 3507
19 Ga0070666_10280249 3300005335 Bacteria 1185
20 Ga0070680_100107751 3300005336 Bacteria 2317
21 Ga0070680_100234117 3300005336 Bacteria 1551
22 Ga0070680_100360268 3300005336 Bacteria 1237
23 Ga0070682_100212177 3300005337 Bacteria 1373
24 Ga0070682_100315597 3300005337 Unclassified 1152
25 Ga0070660_100037557 3300005339 Bacteria 3671
26 Ga0070660_100119671 3300005339 Bacteria 2101
27 Ga0070660_100167915 3300005339 Bacteria 1771
28 Ga0070660_100220223 3300005339 Bacteria 1542
29 Ga0070660_100349449 3300005339 Bacteria 1217
30 Ga0070660_100402885 3300005339 Bacteria 1131
31 Ga0070660_100868926 3300005339 Bacteria 760
32 Ga0070661_100022984 3300005344 Bacteria 4466
33 Ga0070661_100240275 3300005344 Bacteria 1394
34 Ga0070661_100291837 3300005344 Bacteria 1267
35 Ga0070661_100435977 3300005344 Bacteria 1041
36 Ga0070661_100447898 3300005344 Bacteria 1027
37 Ga0070675_100148934 3300005354 Bacteria 2005
38 Ga0070675_100509898 3300005354 Bacteria 1085
39 Ga0070675_101544556 3300005354 Bacteria 612
40 Ga0070671_100002313 3300005355 Bacteria 14712
41 Ga0070671_100385665 3300005355 Bacteria 1198
42 Ga0070671_100953136 3300005355 Bacteria 751
43 Ga0070671_101759280 3300005355 Unclassified 550
44 Ga0070674_100017405 3300005356 Bacteria 4521
45 Ga0070674_100040396 3300005356 Bacteria 3156
46 Ga0070673_100259111 3300005364 Bacteria 1519
47 Ga0070659_100010935 3300005366 Bacteria 6698
48 Ga0070659_100039117 3300005366 Bacteria 3701
49 Ga0070659_100215505 3300005366 Bacteria 1583
50 Ga0070659_100301020 3300005366 Bacteria 1337
51 Ga0070659_100449002 3300005366 Bacteria 1093
52 Ga0070714_100360969 3300005435 Archaea 1366
53 Ga0070714_100368214 3300005435 Bacteria 1352
54 Ga0070713_101180835 3300005436 Bacteria 741
55 Ga0070663_100104051 3300005455 Bacteria 2123
56 Ga0070663_100232432 3300005455 Bacteria 1452
57 Ga0070663_100413767 3300005455 Bacteria 1105
58 Ga0070678_100008398 3300005456 Bacteria 6183
59 Ga0070678_100059918 3300005456 Bacteria 2799
60 Ga0070678_100505589 3300005456 Bacteria 1067
61 Ga0070662_100019530 3300005457 Bacteria 4601
62 Ga0070662_100063152 3300005457 Bacteria 2708
63 Ga0070662_100154850 3300005457 Bacteria 1788
64 Ga0070662_100428960 3300005457 Bacteria 1095
65 Ga0070681_10119823 3300005458 Bacteria 2567
66 Ga0070681_10228430 3300005458 Bacteria 1775
67 Ga0068867_100020782 3300005459 Bacteria 4680
68 Ga0068867_100286098 3300005459 Bacteria 1353
69 Ga0070679_100100449 3300005530 Bacteria 2879
70 Ga0070679_100284894 3300005530 Bacteria 1604
71 Ga0070679_100354916 3300005530 Bacteria 1414
72 Ga0070684_100016150 3300005535 Bacteria 6099
73 Ga0070684_100081034 3300005535 Bacteria 2872
74 Ga0068853_100355001 3300005539 Unclassified 1364
75 Ga0068853_101101555 3300005539 Bacteria 766
76 Ga0070672_100081779 3300005543 Bacteria 2590
77 Ga0070672_100158358 3300005543 Bacteria 1877
78 Ga0070672_100597927 3300005543 Bacteria 960
79 Ga0070693_100068533 3300005547 Bacteria 2082
80 Ga0068855_100288127 3300005563 Bacteria 1821
81 Ga0068855_100329611 3300005563 Bacteria 1685
82 Ga0068855_100459460 3300005563 Bacteria 1388
83 Ga0068855_100805622 3300005563 Unclassified 998
84 Ga0070664_100005415 3300005564 Bacteria 10246
85 Ga0070664_100061003 3300005564 Bacteria 3213
86 Ga0070664_100237430 3300005564 Bacteria 1635
87 Ga0070664_100280096 3300005564 Bacteria 1504
88 Ga0070664_100401486 3300005564 Unclassified 1253
89 Ga0068857_100122752 3300005577 Bacteria 2340
90 Ga0068857_100854496 3300005577 Unclassified 871
91 Ga0068857_100912766 3300005577 Bacteria 842
92 Ga0068857_101450593 3300005577 Unclassified 668
93 Ga0068854_100019650 3300005578 Bacteria 4556
94 Ga0068854_100530379 3300005578 Unclassified 996
95 Ga0068854_100579167 3300005578 Bacteria 955
96 Ga0068854_100652407 3300005578 Bacteria 904
97 Ga0068852_100082771 3300005616 Bacteria 2852
98 Ga0068852_100154489 3300005616 Bacteria 2136
99 Ga0068852_100594364 3300005616 Bacteria 1110
100 Ga0068864_100153413 3300005618 Bacteria 2089
101 Ga0068861_100178485 3300005719 Bacteria 1766
102 Ga0068851_10061594 3300005834 Bacteria 1924
103 Ga0068851_10217178 3300005834 Bacteria 1073
104 Ga0068858_100547059 3300005842 Bacteria 1121
105 Ga0068860_100168952 3300005843 Bacteria 2112
106 Ga0097621_100118003 3300006237 Bacteria 2249
107 Ga0068871_100227498 3300006358 Bacteria 1618
108 Ga0068865_100025155 3300006881 Bacteria 3913
109 Ga0105240_10593762 3300009093 Bacteria 1220
110 Ga0105240_12072016 3300009093 Unclassified 591
111 Ga0105243_10029912 3300009148 Bacteria 4191
112 Ga0105241_10015362 3300009174 Bacteria 5607
113 Ga0105241_11441353 3300009174 Bacteria 661
114 Ga0105248_10019304 3300009177 Bacteria 7542
115 Ga0105239_11177178 3300010375 Bacteria 883
116 Ga0157316_1004062 3300012510 Bacteria 1089
117 Ga0157327_1008240 3300012512 Bacteria 930
118 Ga0157373_10105303 3300013100 Bacteria 1984
119 Ga0157373_10970474 3300013100 Unclassified 633
120 Ga0157371_10185682 3300013102 Bacteria 1488
121 Ga0157371_10476676 3300013102 Bacteria 919
122 Ga0157370_10101103 3300013104 Bacteria 2700
123 Ga0157370_10648867 3300013104 Unclassified 965
124 Ga0157369_10303312 3300013105 Bacteria 1661
125 Ga0157369_10652705 3300013105 Bacteria 1085
126 Ga0157374_11133969 3300013296 Unclassified 803
127 Ga0157378_10020899 3300013297 Bacteria 5758
128 Ga0157378_10863503 3300013297 Bacteria 934
129 Ga0163162_10176749 3300013306 Bacteria 2260
130 Ga0163162_10693259 3300013306 Unclassified 1140
131 Ga0157372_10155411 3300013307 Bacteria 2642
132 Ga0157372_10256300 3300013307 Bacteria 2031
133 Ga0157372_11757291 3300013307 Unclassified 713
134 Ga0157375_12035697 3300013308 Bacteria 683
135 Ga0163161_10293802 3300017792 Bacteria 1278
136 Ga0206353_11665814 3300020082 Bacteria 583
137 Ga0213874_10419540 3300021377 Unclassified 523
138 Ga0213876_10222572 3300021384 Bacteria 1003
139 Ga0207656_10223845 3300025321 Bacteria 915
140 Ga0207682_10014554 3300025893 Bacteria 3066
141 Ga0207682_10169315 3300025893 Bacteria 993
142 Ga0207642_10071993 3300025899 Bacteria 1648
143 Ga0207688_10012845 3300025901 Bacteria 4553
144 Ga0207688_10025745 3300025901 Bacteria 3233
145 Ga0207680_10198542 3300025903 Bacteria 1366
146 Ga0207647_10011091 3300025904 Bacteria 6332
147 Ga0207645_10096885 3300025907 Bacteria 1901
148 Ga0207645_10143534 3300025907 Bacteria 1556
149 Ga0207705_10019621 3300025909 Bacteria 4834
150 Ga0207705_10053127 3300025909 Bacteria 2918
151 Ga0207705_10389362 3300025909 Unclassified 1077
152 Ga0207705_10926931 3300025909 Bacteria 674
153 Ga0207705_11208417 3300025909 Unclassified 580
154 Ga0207707_10591041 3300025912 Unclassified 940
155 Ga0207707_10651525 3300025912 Bacteria 888
156 Ga0207707_10770296 3300025912 Bacteria 803
157 Ga0207660_10206563 3300025917 Bacteria 1536
158 Ga0207660_10214218 3300025917 Bacteria 1509
159 Ga0207657_10005882 3300025919 Bacteria 12778
160 Ga0207657_10022716 3300025919 Bacteria 5860
161 Ga0207657_10024416 3300025919 Bacteria 5597
162 Ga0207657_10031437 3300025919 Bacteria 4808
163 Ga0207657_10136266 3300025919 Bacteria 2009
164 Ga0207657_10232465 3300025919 Bacteria 1474
165 Ga0207657_10248409 3300025919 Bacteria 1419
166 Ga0207649_10007270 3300025920 Bacteria 6020
167 Ga0207649_10030427 3300025920 Bacteria 3197
168 Ga0207649_10190919 3300025920 Unclassified 1441
169 Ga0207649_10257718 3300025920 Bacteria 1259
170 Ga0207649_10261244 3300025920 Bacteria 1251
171 Ga0207649_10734766 3300025920 Bacteria 767
172 Ga0207649_11133581 3300025920 Unclassified 617
173 Ga0207652_10303374 3300025921 Bacteria 1441
174 Ga0207652_10604426 3300025921 Bacteria 983
175 Ga0207652_11122536 3300025921 Bacteria 687
176 Ga0207652_11141761 3300025921 Archaea 680
177 Ga0207694_10328728 3300025924 Bacteria 1263
178 Ga0207650_10001833 3300025925 Bacteria 15000
179 Ga0207650_10156863 3300025925 Bacteria 1800
180 Ga0207659_10453637 3300025926 Bacteria 1080
181 Ga0207659_11346278 3300025926 Bacteria 613
182 Ga0207700_10257459 3300025928 Bacteria 1493
183 Ga0207664_10238754 3300025929 Bacteria 1582
184 Ga0207664_10299426 3300025929 Archaea 1415
185 Ga0207644_10032343 3300025931 Bacteria 3649
186 Ga0207644_11154716 3300025931 Unclassified 651
187 Ga0207690_10011664 3300025932 Bacteria 5253
188 Ga0207690_10054884 3300025932 Bacteria 2681
189 Ga0207690_10103001 3300025932 Bacteria 2042
190 Ga0207690_10169751 3300025932 Bacteria 1633
191 Ga0207690_10311635 3300025932 Bacteria 1234
192 Ga0207706_10020981 3300025933 Bacteria 5867
193 Ga0207706_10037361 3300025933 Bacteria 4313
194 Ga0207706_10073189 3300025933 Bacteria 3013
195 Ga0207706_10079040 3300025933 Bacteria 2893
196 Ga0207706_10191769 3300025933 Bacteria 1794
197 Ga0207706_10286393 3300025933 Bacteria 1436
198 Ga0207706_10312234 3300025933 Bacteria 1369
199 Ga0207706_10346249 3300025933 Bacteria 1292
200 Ga0207706_10631660 3300025933 Bacteria 918
201 Ga0207706_10706255 3300025933 Unclassified 861
202 Ga0207709_10039866 3300025935 Bacteria 2808
203 Ga0207669_10007586 3300025937 Bacteria 5031
204 Ga0207669_10102218 3300025937 Bacteria 1898
205 Ga0207704_10266040 3300025938 Bacteria 1295
206 Ga0207704_10914407 3300025938 Unclassified 738
207 Ga0207691_10105953 3300025940 Bacteria 2504
208 Ga0207691_10159808 3300025940 Bacteria 1977
209 Ga0207691_10214987 3300025940 Bacteria 1669
210 Ga0207691_10336174 3300025940 Bacteria 1293
211 Ga0207691_10557345 3300025940 Bacteria 971
212 Ga0207711_10013176 3300025941 Bacteria 6868
213 Ga0207689_10844233 3300025942 Bacteria 773
214 Ga0207661_10015725 3300025944 Bacteria 5574
215 Ga0207661_10272515 3300025944 Bacteria 1511
216 Ga0207661_10409154 3300025944 Unclassified 1231
217 Ga0207661_11280806 3300025944 Bacteria 674
218 Ga0207679_10014106 3300025945 Bacteria 5244
219 Ga0207679_10064318 3300025945 Bacteria 2741
220 Ga0207679_10072213 3300025945 Bacteria 2606
221 Ga0207679_10157781 3300025945 Bacteria 1854
222 Ga0207667_10045507 3300025949 Bacteria 4647
223 Ga0207667_10882256 3300025949 Bacteria 887
224 Ga0207651_10024342 3300025960 Bacteria 3743
225 Ga0207651_10125480 3300025960 Bacteria 1955
226 Ga0207640_10018545 3300025981 Bacteria 4091
227 Ga0207640_10030387 3300025981 Bacteria 3326
228 Ga0207640_10218109 3300025981 Bacteria 1458
229 Ga0207640_10830053 3300025981 Bacteria 803
230 Ga0207658_10730081 3300025986 Unclassified 896
231 Ga0207658_11982475 3300025986 Unclassified 530
232 Ga0207677_10015269 3300026023 Bacteria 4511
233 Ga0207677_10368299 3300026023 Bacteria 1209
234 Ga0207703_10498359 3300026035 Bacteria 1143
235 Ga0207639_10112208 3300026041 Bacteria 2224
236 Ga0207639_10241635 3300026041 Bacteria 1570
237 Ga0207639_12091925 3300026041 Unclassified 527
238 Ga0207678_10020592 3300026067 Bacteria 5783
239 Ga0207678_10021227 3300026067 Bacteria 5692
240 Ga0207678_10055827 3300026067 Bacteria 3401
241 Ga0207678_10075802 3300026067 Bacteria 2881
242 Ga0207678_10084546 3300026067 Bacteria 2713
243 Ga0207678_10100934 3300026067 Bacteria 2465
244 Ga0207678_10448215 3300026067 Bacteria 1121
245 Ga0207678_10526264 3300026067 Bacteria 1032
246 Ga0207641_10979754 3300026088 Bacteria 842
247 Ga0207648_10003806 3300026089 Bacteria 15770
248 Ga0207648_10194621 3300026089 Bacteria 1797
249 Ga0207648_10598554 3300026089 Bacteria 1016
250 Ga0207676_10060996 3300026095 Bacteria 2985
251 Ga0207674_10155534 3300026116 Bacteria 2242
252 Ga0207674_10249825 3300026116 Bacteria 1721
253 Ga0207674_10343715 3300026116 Bacteria 1443
254 Ga0207675_100331504 3300026118 Bacteria 1488
255 Ga0207683_10014454 3300026121 Bacteria 6721
256 Ga0207683_10029045 3300026121 Bacteria 4786
257 Ga0207683_10148858 3300026121 Bacteria 2112
258 Ga0207683_10247735 3300026121 Bacteria 1626
259 Ga0207683_10331019 3300026121 Bacteria 1396
260 Ga0207698_10017222 3300026142 Bacteria 4896
261 Ga0207698_10425283 3300026142 Bacteria 1275
262 Ga0307408_100004305 3300031548 Bacteria 9661
263 Ga0307408_100109807 3300031548 Bacteria 2116
264 Ga0307405_10040352 3300031731 Bacteria 2826
265 Ga0307405_10428016 3300031731 Bacteria 1043
266 Ga0307405_11995915 3300031731 Unclassified 519
267 Ga0307413_10037041 3300031824 Bacteria 2814
268 Ga0307413_10405394 3300031824 Unclassified 1069
269 Ga0307410_10019043 3300031852 Bacteria 4165
270 Ga0307410_10113190 3300031852 Bacteria 1966
271 Ga0307410_11355387 3300031852 Unclassified 623
272 Ga0307406_10052245 3300031901 Bacteria 2598
273 Ga0307406_10378748 3300031901 Bacteria 1115
274 Ga0307406_10541903 3300031901 Unclassified 950
275 Ga0307407_10047610 3300031903 Bacteria 2434
276 Ga0307407_11099073 3300031903 Unclassified 618
277 Ga0307412_10014643 3300031911 Bacteria 4632
278 Ga0307412_10152277 3300031911 Bacteria 1708
279 Ga0307409_100070747 3300031995 Bacteria 2770
280 Ga0307409_100819975 3300031995 Bacteria 939
281 Ga0307409_101635063 3300031995 Bacteria 672
282 Ga0307409_101856797 3300031995 Bacteria 632
283 Ga0307416_100006649 3300032002 Bacteria 7256
284 Ga0307416_100234010 3300032002 Bacteria 1773
285 Ga0307416_100318634 3300032002 Bacteria 1556
286 Ga0307416_103530691 3300032002 Unclassified 523
287 Ga0307414_10080732 3300032004 Bacteria 2379
288 Ga0307414_10499904 3300032004 Bacteria 1075
289 Ga0307414_10768920 3300032004 Unclassified 876
290 Ga0307411_10029095 3300032005 Bacteria 3369
291 Ga0307415_100003750 3300032126 Bacteria 7789
292 Ga0307415_100046185 3300032126 Bacteria 2924
293 Ga0307415_100478467 3300032126 Bacteria 1083
294 Ga0307415_102167804 3300032126 Unclassified 543
295 Ga0373929_0017265 3300035085 Bacteria 1423
296 Ga0373939_0132440 3300035114 Unclassified 891
297 Ga0373960_0043443 3300035121 Bacteria 1309
298 Ga0373946_0122860 3300035171 Bacteria 1187
299 Ga0373935_0918519 3300035692 Unclassified 649
300 Ga0395899_0000224 3300037312 Bacteria 76706
301 Ga0395899_0002312 3300037312 Bacteria 15534
302 Ga0395899_0041299 3300037312 Bacteria 3447
303 Ga0395899_0099287 3300037312 Bacteria 2103
304 Ga0395899_0229156 3300037312 Bacteria 1283
305 Ga0395899_0307298 3300037312 Bacteria 1071
306 Ga0395899_0348865 3300037312 Bacteria 990
307 Ga0395899_0372270 3300037312 Bacteria 951
308 Ga0395899_0655134 3300037312 Unclassified 663
309 Ga0395900_0000294 3300037418 Bacteria 75260
310 Ga0395900_0034570 3300037418 Bacteria 5206
311 Ga0395900_0049599 3300037418 Bacteria 4325
312 Ga0395900_0053235 3300037418 Bacteria 4165
313 Ga0395900_0071718 3300037418 Bacteria 3561
314 Ga0395900_0091661 3300037418 Bacteria 3123
315 Ga0395900_0091991 3300037418 Bacteria 3116
316 Ga0395900_0127991 3300037418 Bacteria 2603
317 Ga0395900_0149837 3300037418 Bacteria 2383
318 Ga0395900_0157117 3300037418 Bacteria 2322
319 Ga0395900_0181297 3300037418 Unclassified 2140
320 Ga0395900_0186551 3300037418 Bacteria 2105
321 Ga0395900_0309860 3300037418 Bacteria 1562
322 Ga0395900_0333837 3300037418 Bacteria 1493
323 Ga0395900_0493688 3300037418 Bacteria 1175
324 Ga0395900_0840662 3300037418 Bacteria 844
325 Ga0395898_0000192 3300037466 Bacteria 156121
326 Ga0395898_0001747 3300037466 Bacteria 28657
327 Ga0395898_0031234 3300037466 Bacteria 5323
328 Ga0395898_0044582 3300037466 Bacteria 4364
329 Ga0395898_0084171 3300037466 Bacteria 3066
330 Ga0395898_0091805 3300037466 Bacteria 2921
331 Ga0395898_0106600 3300037466 Bacteria 2688
332 Ga0395898_0114937 3300037466 Bacteria 2579
333 Ga0395898_0161586 3300037466 Bacteria 2142
334 Ga0395898_0448112 3300037466 Bacteria 1229
335 Ga0395898_0842448 3300037466 Unclassified 856
336 Ga0395905_0000066 3300037471 Bacteria 183121
337 Ga0395905_0000358 3300037471 Bacteria 64883
338 Ga0395905_0001563 3300037471 Bacteria 27336
339 Ga0395905_0001605 3300037471 Bacteria 26873
340 Ga0395905_0001888 3300037471 Bacteria 24158
341 Ga0395905_0010861 3300037471 Bacteria 8821
342 Ga0395905_0014226 3300037471 Bacteria 7602
343 Ga0395905_0016299 3300037471 Bacteria 7061
344 Ga0395905_0017957 3300037471 Bacteria 6717
345 Ga0395905_0019110 3300037471 Bacteria 6499
346 Ga0395905_0035466 3300037471 Bacteria 4684
347 Ga0395905_0052508 3300037471 Bacteria 3816
348 Ga0395905_0087646 3300037471 Bacteria 2918
349 Ga0395905_0105903 3300037471 Bacteria 2641
350 Ga0395905_0144972 3300037471 Bacteria 2234
351 Ga0395905_0172707 3300037471 Bacteria 2030
352 Ga0395905_0287038 3300037471 Unclassified 1532
353 Ga0395905_0308799 3300037471 Bacteria 1470
354 Ga0395905_0322570 3300037471 Bacteria 1434
355 Ga0395905_0352441 3300037471 Bacteria 1364
356 Ga0395905_0499953 3300037471 Unclassified 1116
357 Ga0395905_0560639 3300037471 Bacteria 1044
358 Ga0395905_0683547 3300037471 Bacteria 928
359 Ga0395905_0946590 3300037471 Bacteria 764
360 Ga0395905_1052494 3300037471 Bacteria 717
361 Ga0395905_1649610 3300037471 Unclassified 546
362 Ga0395901_0001222 3300038443 Bacteria 27379
363 Ga0395901_0002015 3300038443 Bacteria 20901
364 Ga0395901_0006861 3300038443 Bacteria 11503
365 Ga0395901_0008904 3300038443 Bacteria 10165
366 Ga0395901_0009785 3300038443 Bacteria 9723
367 Ga0395901_0019035 3300038443 Bacteria 7019
368 Ga0395901_0034419 3300038443 Bacteria 5231
369 Ga0395901_0054242 3300038443 Bacteria 4165
370 Ga0395901_0065314 3300038443 Bacteria 3788
371 Ga0395901_0117277 3300038443 Bacteria 2797
372 Ga0395901_0136677 3300038443 Bacteria 2576
373 Ga0395901_0157489 3300038443 Bacteria 2385
374 Ga0395901_0371565 3300038443 Bacteria 1473
375 Ga0395901_0376757 3300038443 Bacteria 1461
376 Ga0395901_0381883 3300038443 Bacteria 1450
377 Ga0395901_0444080 3300038443 Bacteria 1327
378 Ga0395901_0681590 3300038443 Bacteria 1027
379 Ga0395901_1015609 3300038443 Bacteria 804
380 Ga0436365_0119805 3300039437 Bacteria 1414
381 Ga0436365_0186214 3300039437 Bacteria 531
382 Ga0436363_1379348 3300039450 Unclassified 534
383 Ga0436362_0400023 3300039453 Bacteria 808
384 Ga0439448_0003867 3300042005 Bacteria 4193
385 Ga0439455_0064269 3300042012 Bacteria 977
386 Ga0439458_0000074 3300042157 Bacteria 18402
387 Ga0439458_0000965 3300042157 Bacteria 7382
388 Ga0466969_0023175 3300044656 Bacteria 3200
389 Ga0466969_0041979 3300044656 Bacteria 2286
390 Ga0466969_0145818 3300044656 Bacteria 1092
391 Ga0466969_0183057 3300044656 Bacteria 959
392 Ga0466972_0340973 3300044658 Unclassified 701
393 Ga0466965_0029267 3300044683 Bacteria 2680
394 Ga0466966_0012243 3300044684 Bacteria 5682
395 Ga0466966_0052907 3300044684 Bacteria 2577
396 Ga0466966_0210760 3300044684 Bacteria 1174
397 Ga0466966_0294569 3300044684 Bacteria 975
398 Ga0466966_0580944 3300044684 Bacteria 674
399 Ga0466961_0037771 3300044693 Bacteria 3098
400 Ga0466961_0045902 3300044693 Bacteria 2795
401 Ga0466961_0175787 3300044693 Bacteria 1330
402 Ga0466963_0011975 3300044694 Bacteria 5297
403 Ga0466963_0111388 3300044694 Bacteria 1879
404 Ga0466963_0131528 3300044694 Unclassified 1729
405 Ga0466963_0159129 3300044694 Bacteria 1571
406 Ga0466963_0272436 3300044694 Bacteria 1189
407 Ga0466963_0346205 3300044694 Bacteria 1046
408 Ga0466964_0002516 3300044706 Bacteria 6519
409 Ga0466971_0013632 3300044719 Bacteria 3572
410 Ga0466971_0127383 3300044719 Bacteria 1180
411 Ga0466968_0120512 3300044735 Bacteria 1186
412 Ga0466970_0028517 3300044765 Bacteria 2934
413 Ga0466957_0105456 3300044842 Bacteria 1781
414 Ga0466957_0162823 3300044842 Bacteria 1449
415 Ga0466957_0789395 3300044842 Unclassified 674
416 Ga0466959_0029901 3300045049 Bacteria 4034
417 Ga0466959_0092761 3300045049 Bacteria 2167
418 Ga0466959_0133953 3300045049 Bacteria 1755
419 Ga0466959_0193493 3300045049 Bacteria 1418
420 Ga0466959_0260870 3300045049 Bacteria 1193
421 Ga0466958_0013696 3300045836 Bacteria 4621
422 Ga0466958_0018974 3300045836 Bacteria 3998
423 Ga0466958_0091163 3300045836 Bacteria 1886
424 Ga0466958_0336422 3300045836 Bacteria 971
425 Ga0466958_0427228 3300045836 Bacteria 857
426 Ga0466958_0906038 3300045836 Unclassified 575
427 Ga0466967_0067318 3300045976 Bacteria 3194
428 Ga0466967_0075718 3300045976 Bacteria 3025
429 Ga0466967_0106401 3300045976 Bacteria 2571
430 Ga0466967_0130887 3300045976 Bacteria 2329
431 Ga0466967_0161694 3300045976 Bacteria 2102
432 Ga0466967_0651381 3300045976 Bacteria 1041
433 Ga0495621_0168551 3300046539 Bacteria 869
434 Ga0495669_0004679 3300046684 Bacteria 5673
435 Ga0495677_0008645 3300047445 Bacteria 3780
436 Ga0495677_0045855 3300047445 Bacteria 1604
437 Ga0496100_0873522 3300048903 Bacteria 706
438 Ga0496102_0268933 3300048905 Bacteria 1607
439 Ga0496102_0326808 3300048905 Bacteria 1445
440 Ga0496103_0081370 3300048906 Bacteria 2037
441 Ga0496107_0104659 3300048910 Bacteria 2077
442 Ga0496109_0349760 3300048912 Bacteria 1396
443 Ga0496111_0159427 3300048914 Bacteria 1675
444 Ga0496112_0006215 3300048915 Bacteria 10459
445 Ga0496113_0211677 3300048916 Bacteria 1543
446 Ga0501067_0114075 3300049583 Bacteria 1503
447 Ga0501235_166059 3300049669 Unclassified 580
448 Ga0501239_003742 3300049672 Bacteria 1462
449 Ga0501240_027834 3300049673 Bacteria 890
450 Ga0501247_025067 3300049677 Bacteria 791
451 Ga0501257_045381 3300049686 Bacteria 1087
452 Ga0501221_020225 3300049704 Bacteria 1299
453 Ga0501234_027466 3300049707 Bacteria 915
454 Ga0501262_006708 3300049759 Bacteria 1382
455 Ga0501272_019748 3300049769 Bacteria 804
456 Ga0501273_001868 3300049770 Bacteria 2075
457 Ga0466962_0079482 3300061719 Bacteria 1568
458 Ga0466962_0134194 3300061719 Bacteria 1197
459 Ga0466962_0590415 3300061719 Unclassified 566
460 Ga0207677_10144942
461 JGI24741J21665_1010994
462 JGI24739J22299_10048375
463 JGI24735J21928_10007407
464 JGI24744J21845_10000072
465 JGI24742J22300_10009704
466 rootH2_10314456
467 rootH1_10184702
468 Ga0070658_10019836
469 Ga0070658_10273710
470 Ga0070658_10938389
471 Ga0070676_10760563
472 Ga0070683_100710785
473 Ga0070683_100713035
474 Ga0070683_101889884
475 Ga0070670_100001151
476 Ga0070670_100096175
477 Ga0068869_100036108
478 Ga0070666_10280249
479 Ga0070680_100107751
480 Ga0070680_100234117
481 Ga0070680_100360268
482 Ga0070682_100212177
483 Ga0070682_100315597
484 Ga0070660_100037557
485 Ga0070660_100119671
486 Ga0070660_100167915
487 Ga0070660_100220223
488 Ga0070660_100349449
489 Ga0070660_100402885
490 Ga0070660_100868926
491 Ga0070661_100022984
492 Ga0070661_100240275
493 Ga0070661_100291837
494 Ga0070661_100435977
495 Ga0070661_100447898
496 Ga0070675_100148934
497 Ga0070675_100509898
498 Ga0070675_101544556
499 Ga0070671_100002313
500 Ga0070671_100385665
501 Ga0070671_100953136
502 Ga0070671_101759280
503 Ga0070674_100017405
504 Ga0070674_100040396
505 Ga0070673_100259111
506 Ga0070659_100010935
507 Ga0070659_100039117
508 Ga0070659_100215505
509 Ga0070659_100301020
510 Ga0070659_100449002
511 Ga0070714_100360969
512 Ga0070714_100368214
513 Ga0070713_101180835
514 Ga0070663_100104051
515 Ga0070663_100232432
516 Ga0070663_100413767
517 Ga0070678_100008398
518 Ga0070678_100059918
519 Ga0070678_100505589
520 Ga0070662_100019530
521 Ga0070662_100063152
522 Ga0070662_100154850
523 Ga0070662_100428960
524 Ga0070681_10119823
525 Ga0070681_10228430
526 Ga0068867_100020782
527 Ga0068867_100286098
528 Ga0070679_100100449
529 Ga0070679_100284894
530 Ga0070679_100354916
531 Ga0070684_100016150
532 Ga0070684_100081034
533 Ga0068853_100355001
534 Ga0068853_101101555
535 Ga0070672_100081779
536 Ga0070672_100158358
537 Ga0070672_100597927
538 Ga0070693_100068533
539 Ga0068855_100288127
540 Ga0068855_100329611
541 Ga0068855_100459460
542 Ga0068855_100805622
543 Ga0070664_100005415
544 Ga0070664_100061003
545 Ga0070664_100237430
546 Ga0070664_100280096
547 Ga0070664_100401486
548 Ga0068857_100122752
549 Ga0068857_100854496
550 Ga0068857_100912766
551 Ga0068857_101450593
552 Ga0068854_100019650
553 Ga0068854_100530379
554 Ga0068854_100579167
555 Ga0068854_100652407
556 Ga0068852_100082771
557 Ga0068852_100154489
558 Ga0068852_100594364
559 Ga0068864_100153413
560 Ga0068861_100178485
561 Ga0068851_10061594
562 Ga0068851_10217178
563 Ga0068858_100547059
564 Ga0068860_100168952
565 Ga0097621_100118003
566 Ga0068871_100227498
567 Ga0068865_100025155
568 Ga0105240_10593762
569 Ga0105240_12072016
570 Ga0105243_10029912
571 Ga0105241_10015362
572 Ga0105241_11441353
573 Ga0105248_10019304
574 Ga0105239_11177178
575 Ga0157316_1004062
576 Ga0157327_1008240
577 Ga0157373_10105303
578 Ga0157373_10970474
579 Ga0157371_10185682
580 Ga0157371_10476676
581 Ga0157370_10101103
582 Ga0157370_10648867
583 Ga0157369_10303312
584 Ga0157369_10652705
585 Ga0157374_11133969
586 Ga0157378_10020899
587 Ga0157378_10863503
588 Ga0163162_10176749
589 Ga0163162_10693259
590 Ga0157372_10155411
591 Ga0157372_10256300
592 Ga0157372_11757291
593 Ga0157375_12035697
594 Ga0163161_10293802
595 Ga0206353_11665814
596 Ga0213874_10419540
597 Ga0213876_10222572
598 Ga0207656_10223845
599 Ga0207682_10014554
600 Ga0207682_10169315
601 Ga0207642_10071993
602 Ga0207688_10012845
603 Ga0207688_10025745
604 Ga0207680_10198542
605 Ga0207647_10011091
606 Ga0207645_10096885
607 Ga0207645_10143534
608 Ga0207705_10019621
609 Ga0207705_10053127
610 Ga0207705_10389362
611 Ga0207705_10926931
612 Ga0207705_11208417
613 Ga0207707_10591041
614 Ga0207707_10651525
615 Ga0207707_10770296
616 Ga0207660_10206563
617 Ga0207660_10214218
618 Ga0207657_10005882
619 Ga0207657_10022716
620 Ga0207657_10024416
621 Ga0207657_10031437
622 Ga0207657_10136266
623 Ga0207657_10232465
624 Ga0207657_10248409
625 Ga0207649_10007270
626 Ga0207649_10030427
627 Ga0207649_10190919
628 Ga0207649_10257718
629 Ga0207649_10261244
630 Ga0207649_10734766
631 Ga0207649_11133581
632 Ga0207652_10303374
633 Ga0207652_10604426
634 Ga0207652_11122536
635 Ga0207652_11141761
636 Ga0207694_10328728
637 Ga0207650_10001833
638 Ga0207650_10156863
639 Ga0207659_10453637
640 Ga0207659_11346278
641 Ga0207700_10257459
642 Ga0207664_10238754
643 Ga0207664_10299426
644 Ga0207644_10032343
645 Ga0207644_11154716
646 Ga0207690_10011664
647 Ga0207690_10054884
648 Ga0207690_10103001
649 Ga0207690_10169751
650 Ga0207690_10311635
651 Ga0207706_10020981
652 Ga0207706_10037361
653 Ga0207706_10073189
654 Ga0207706_10079040
655 Ga0207706_10191769
656 Ga0207706_10286393
657 Ga0207706_10312234
658 Ga0207706_10346249
659 Ga0207706_10631660
660 Ga0207706_10706255
661 Ga0207709_10039866
662 Ga0207669_10007586
663 Ga0207669_10102218
664 Ga0207704_10266040
665 Ga0207704_10914407
666 Ga0207691_10105953
667 Ga0207691_10159808
668 Ga0207691_10214987
669 Ga0207691_10336174
670 Ga0207691_10557345
671 Ga0207711_10013176
672 Ga0207689_10844233
673 Ga0207661_10015725
674 Ga0207661_10272515
675 Ga0207661_10409154
676 Ga0207661_11280806
677 Ga0207679_10014106
678 Ga0207679_10064318
679 Ga0207679_10072213
680 Ga0207679_10157781
681 Ga0207667_10045507
682 Ga0207667_10882256
683 Ga0207651_10024342
684 Ga0207651_10125480
685 Ga0207640_10018545
686 Ga0207640_10030387
687 Ga0207640_10218109
688 Ga0207640_10830053
689 Ga0207658_10730081
690 Ga0207658_11982475
691 Ga0207677_10015269
692 Ga0207677_10368299
693 Ga0207703_10498359
694 Ga0207639_10112208
695 Ga0207639_10241635
696 Ga0207639_12091925
697 Ga0207678_10020592
698 Ga0207678_10021227
699 Ga0207678_10055827
700 Ga0207678_10075802
701 Ga0207678_10084546
702 Ga0207678_10100934
703 Ga0207678_10448215
704 Ga0207678_10526264
705 Ga0207641_10979754
706 Ga0207648_10003806
707 Ga0207648_10194621
708 Ga0207648_10598554
709 Ga0207676_10060996
710 Ga0207674_10155534
711 Ga0207674_10249825
712 Ga0207674_10343715
713 Ga0207675_100331504
714 Ga0207683_10014454
715 Ga0207683_10029045
716 Ga0207683_10148858
717 Ga0207683_10247735
718 Ga0207683_10331019
719 Ga0207698_10017222
720 Ga0207698_10425283
721 Ga0307408_100004305
722 Ga0307408_100109807
723 Ga0307405_10040352
724 Ga0307405_10428016
725 Ga0307405_11995915
726 Ga0307413_10037041
727 Ga0307413_10405394
728 Ga0307410_10019043
729 Ga0307410_10113190
730 Ga0307410_11355387
731 Ga0307406_10052245
732 Ga0307406_10378748
733 Ga0307406_10541903
734 Ga0307407_10047610
735 Ga0307407_11099073
736 Ga0307412_10014643
737 Ga0307412_10152277
738 Ga0307409_100070747
739 Ga0307409_100819975
740 Ga0307409_101635063
741 Ga0307409_101856797
742 Ga0307416_100006649
743 Ga0307416_100234010
744 Ga0307416_100318634
745 Ga0307416_103530691
746 Ga0307414_10080732
747 Ga0307414_10499904
748 Ga0307414_10768920
749 Ga0307411_10029095
750 Ga0307415_100003750
751 Ga0307415_100046185
752 Ga0307415_100478467
753 Ga0307415_102167804
754 Ga0373929_0017265
755 Ga0373939_0132440
756 Ga0373960_0043443
757 Ga0373946_0122860
758 Ga0373935_0918519
759 Ga0395899_0000224
760 Ga0395899_0002312
761 Ga0395899_0041299
762 Ga0395899_0099287
763 Ga0395899_0229156
764 Ga0395899_0307298
765 Ga0395899_0348865
766 Ga0395899_0372270
767 Ga0395899_0655134
768 Ga0395900_0000294
769 Ga0395900_0034570
770 Ga0395900_0049599
771 Ga0395900_0053235
772 Ga0395900_0071718
773 Ga0395900_0091661
774 Ga0395900_0091991
775 Ga0395900_0127991
776 Ga0395900_0149837
777 Ga0395900_0157117
778 Ga0395900_0181297
779 Ga0395900_0186551
780 Ga0395900_0309860
781 Ga0395900_0333837
782 Ga0395900_0493688
783 Ga0395900_0840662
784 Ga0395898_0000192
785 Ga0395898_0001747
786 Ga0395898_0031234
787 Ga0395898_0044582
788 Ga0395898_0084171
789 Ga0395898_0091805
790 Ga0395898_0106600
791 Ga0395898_0114937
792 Ga0395898_0161586
793 Ga0395898_0448112
794 Ga0395898_0842448
795 Ga0395905_0000066
796 Ga0395905_0000358
797 Ga0395905_0001563
798 Ga0395905_0001605
799 Ga0395905_0001888
800 Ga0395905_0010861
801 Ga0395905_0014226
802 Ga0395905_0016299
803 Ga0395905_0017957
804 Ga0395905_0019110
805 Ga0395905_0035466
806 Ga0395905_0052508
807 Ga0395905_0087646
808 Ga0395905_0105903
809 Ga0395905_0144972
810 Ga0395905_0172707
811 Ga0395905_0287038
812 Ga0395905_0308799
813 Ga0395905_0322570
814 Ga0395905_0352441
815 Ga0395905_0499953
816 Ga0395905_0560639
817 Ga0395905_0683547
818 Ga0395905_0946590
819 Ga0395905_1052494
820 Ga0395905_1649610
821 Ga0395901_0001222
822 Ga0395901_0002015
823 Ga0395901_0006861
824 Ga0395901_0008904
825 Ga0395901_0009785
826 Ga0395901_0019035
827 Ga0395901_0034419
828 Ga0395901_0054242
829 Ga0395901_0065314
830 Ga0395901_0117277
831 Ga0395901_0136677
832 Ga0395901_0157489
833 Ga0395901_0371565
834 Ga0395901_0376757
835 Ga0395901_0381883
836 Ga0395901_0444080
837 Ga0395901_0681590
838 Ga0395901_1015609
839 Ga0436365_0119805
840 Ga0436365_0186214
841 Ga0436363_1379348
842 Ga0436362_0400023
843 Ga0439448_0003867
844 Ga0439455_0064269
845 Ga0439458_0000074
846 Ga0439458_0000965
847 Ga0466969_0023175
848 Ga0466969_0041979
849 Ga0466969_0145818
850 Ga0466969_0183057
851 Ga0466972_0340973
852 Ga0466965_0029267
853 Ga0466966_0012243
854 Ga0466966_0052907
855 Ga0466966_0210760
856 Ga0466966_0294569
857 Ga0466966_0580944
858 Ga0466961_0037771
859 Ga0466961_0045902
860 Ga0466961_0175787
861 Ga0466963_0011975
862 Ga0466963_0111388
863 Ga0466963_0131528
864 Ga0466963_0159129
865 Ga0466963_0272436
866 Ga0466963_0346205
867 Ga0466964_0002516
868 Ga0466971_0013632
869 Ga0466971_0127383
870 Ga0466968_0120512
871 Ga0466970_0028517
872 Ga0466957_0105456
873 Ga0466957_0162823
874 Ga0466957_0789395
875 Ga0466959_0029901
876 Ga0466959_0092761
877 Ga0466959_0133953
878 Ga0466959_0193493
879 Ga0466959_0260870
880 Ga0466958_0013696
881 Ga0466958_0018974
882 Ga0466958_0091163
883 Ga0466958_0336422
884 Ga0466958_0427228
885 Ga0466958_0906038
886 Ga0466967_0067318
887 Ga0466967_0075718
888 Ga0466967_0106401
889 Ga0466967_0130887
890 Ga0466967_0161694
891 Ga0466967_0651381
892 Ga0495621_0168551
893 Ga0495669_0004679
894 Ga0495677_0008645
895 Ga0495677_0045855
896 Ga0496100_0873522
897 Ga0496102_0268933
898 Ga0496102_0326808
899 Ga0496103_0081370
900 Ga0496107_0104659
901 Ga0496109_0349760
902 Ga0496111_0159427
903 Ga0496112_0006215
904 Ga0496113_0211677
905 Ga0501067_0114075
906 Ga0501235_166059
907 Ga0501239_003742
908 Ga0501240_027834
909 Ga0501247_025067
910 Ga0501257_045381
911 Ga0501221_020225
912 Ga0501234_027466
913 Ga0501262_006708
914 Ga0501272_019748
915 Ga0501273_001868
916 Ga0466962_0079482
917 Ga0466962_0134194
918 Ga0466962_0590415

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nbq-assembly1.cif.gz_A structure of the polynucleotide phosphorylase (cbu_0852) from coxiella burnetii 0.495 17 82
8a0k-assembly2.cif.gz_B crystal structure of the kinetoplastid kinetochore protein trypanosoma brucei kkt3 divergent polo-box domain 0.4818 25 66
3c2w-assembly1.cif.gz_E crystal structure of the photosensory core domain of p. aeruginosa bacteriophytochrome pabphp in the pfr state 0.4702 84 121
1rj2-assembly1.cif.gz_A crystal structure of the dh/ph fragment of dbs without bound gtpase 0.469 55 115
4luq-assembly2.cif.gz_D crystal structure of virulence effector tse3 in complex with neutralizer tsi3 0.396 25 131
ID Description Score Start End Superfamily
2fjlA00 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6845 83 115 2.30.29.30
af_Q6AUP1_86_505_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.5265 83 112 3.40.50.150
af_A0A1D6M1N2_58_455_3.40.50.12710 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.5235 83 111 3.40.50.12710
af_Q6ZK86_73_232_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.5181 33 130 3.40.1000.10
af_O60733_1_93_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.4917 64 124 3.30.1460.10
ID Description Score Start End GO Terms
AF-A0A7T2GLF6-F1-model_v4 DUF4412 domain-containing protein 0.8233 13 145
AF-A0A7T2GLF6-F1-model_v4 DUF4412 domain-containing protein 0.7423 13 145
AF-A0A1Y2QIP9-F1-model_v4 Uncharacterized protein 0.6916 12 141
AF-A0A2Z5UA41-F1-model_v4 Neogenin-like protein 1 0.6876 21 132
AF-A0A4Y6W2L1-F1-model_v4 deleted 0.6768 19 129

Map