F448367

General Info

Members Datasets Scaffolds Average Seq Length
459 199 918 178

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10559624|Ga0207695_105596241
Length 201
Sequence VTSRVKTAAQVLALACVAGLLALLVWSVVHQEHAPGIGATAPAFTLHRLEGPGKVSLASYRGKPVVLNFWASWCEPCKSEAAVLQRDWTTYRNRGVVFLGVDYHDLDSDARRFVSAHALTFPMLEDGSGTVTGRYGISQVPETYVLNRQGRVVAHLRGPITDPGFARSLRISNASRSDWRIAAGEIATSTVVRWLSWSLTA

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
78 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
79 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
82 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
87 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
88 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
89 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
91 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
92 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
96 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
106 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
140 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
195 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 10.68
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 5.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10559624 3300025913 Bacteria 1025
2 Ga0070658_10048704 3300005327 Bacteria 3431
3 Ga0070683_100077033 3300005329 Bacteria 3118
4 Ga0070683_100349211 3300005329 Bacteria 1409
5 Ga0070683_101232145 3300005329 Bacteria 719
6 Ga0070680_100051216 3300005336 Bacteria 3368
7 Ga0070680_100083768 3300005336 Bacteria 2633
8 Ga0070682_100152768 3300005337 Bacteria 1586
9 Ga0068868_100134423 3300005338 Bacteria 2026
10 Ga0068868_100884850 3300005338 Unclassified 811
11 Ga0070660_100008244 3300005339 Bacteria 7283
12 Ga0070687_100360738 3300005343 Bacteria 941
13 Ga0070661_100014019 3300005344 Bacteria 5636
14 Ga0070671_100097752 3300005355 Bacteria 2462
15 Ga0070671_100183073 3300005355 Bacteria 1774
16 Ga0070703_10066499 3300005406 Bacteria 1192
17 Ga0070709_10008850 3300005434 Bacteria 5542
18 Ga0070709_10010287 3300005434 Bacteria 5173
19 Ga0070714_100004653 3300005435 Bacteria 10359
20 Ga0070714_100030993 3300005435 Bacteria 4457
21 Ga0070714_100033375 3300005435 Bacteria 4302
22 Ga0070714_100053762 3300005435 Bacteria 3439
23 Ga0070714_100252025 3300005435 Bacteria 1632
24 Ga0070714_101027067 3300005435 Unclassified 802
25 Ga0070713_100003675 3300005436 Bacteria 10152
26 Ga0070713_100107884 3300005436 Bacteria 2423
27 Ga0070710_10002865 3300005437 Bacteria 8215
28 Ga0070711_100010102 3300005439 Bacteria 5831
29 Ga0070711_100061829 3300005439 Bacteria 2608
30 Ga0070711_100306987 3300005439 Bacteria 1264
31 Ga0070663_100489438 3300005455 Bacteria 1020
32 Ga0070681_10003595 3300005458 Bacteria 14536
33 Ga0070681_10013434 3300005458 Bacteria 8136
34 Ga0070685_10308821 3300005466 Bacteria 1068
35 Ga0070707_100000633 3300005468 Bacteria 35138
36 Ga0070707_100052628 3300005468 Bacteria 3904
37 Ga0070707_100242761 3300005468 Bacteria 1753
38 Ga0070698_100068513 3300005471 Bacteria 3565
39 Ga0070698_100326436 3300005471 Bacteria 1465
40 Ga0070698_100336487 3300005471 Bacteria 1441
41 Ga0070698_100589745 3300005471 Bacteria 1051
42 Ga0070699_100449024 3300005518 Bacteria 1169
43 Ga0070679_100079465 3300005530 Bacteria 3269
44 Ga0070684_100031649 3300005535 Bacteria 4505
45 Ga0070704_100209331 3300005549 Bacteria 1579
46 Ga0068855_100105521 3300005563 Bacteria 3239
47 Ga0070664_100355626 3300005564 Bacteria 1333
48 Ga0070664_100845414 3300005564 Bacteria 857
49 Ga0068856_100033958 3300005614 Bacteria 4995
50 Ga0068856_100087922 3300005614 Bacteria 3090
51 Ga0068856_100200584 3300005614 Bacteria 2009
52 Ga0068864_101845923 3300005618 Bacteria 610
53 Ga0068863_100418566 3300005841 Bacteria 1312
54 Ga0070717_10014842 3300006028 Bacteria 5994
55 Ga0070717_10027009 3300006028 Bacteria 4585
56 Ga0070717_10335870 3300006028 Unclassified 1348
57 Ga0070717_10475523 3300006028 Bacteria 1128
58 Ga0070717_10575789 3300006028 Bacteria 1021
59 Ga0070717_10707277 3300006028 Bacteria 915
60 Ga0070715_10000701 3300006163 Bacteria 8994
61 Ga0070716_100001043 3300006173 Bacteria 12156
62 Ga0070716_100107271 3300006173 Bacteria 1724
63 Ga0070716_100432256 3300006173 Bacteria 955
64 Ga0070712_100328553 3300006175 Bacteria 1245
65 Ga0070712_100359003 3300006175 Bacteria 1194
66 Ga0097621_100282853 3300006237 Bacteria 1460
67 Ga0075433_10285354 3300006852 Bacteria 1462
68 Ga0075434_100009519 3300006871 Bacteria 9066
69 Ga0075435_101020081 3300007076 Bacteria 723
70 Ga0105240_10288175 3300009093 Bacteria 1884
71 Ga0105240_10502732 3300009093 Bacteria 1347
72 Ga0105245_10090770 3300009098 Bacteria 2810
73 Ga0105247_10027858 3300009101 Bacteria 3416
74 Ga0105241_10602163 3300009174 Bacteria 993
75 Ga0105248_10360621 3300009177 Bacteria 1636
76 Ga0105237_10632372 3300009545 Unclassified 1077
77 Ga0105238_10383407 3300009551 Bacteria 1397
78 Ga0105238_10407726 3300009551 Bacteria 1353
79 Ga0157369_10031406 3300013105 Bacteria 5849
80 Ga0157369_10258371 3300013105 Bacteria 1817
81 Ga0157374_10022751 3300013296 Bacteria 5596
82 Ga0157372_10082283 3300013307 Bacteria 3644
83 Ga0157375_10137041 3300013308 Bacteria 2573
84 Ga0182008_10075272 3300014497 Bacteria 1661
85 Ga0182008_10373925 3300014497 Bacteria 760
86 Ga0157379_10749164 3300014968 Bacteria 919
87 Ga0157376_10030962 3300014969 Bacteria 4279
88 Ga0206354_10392503 3300020081 Bacteria 774
89 Ga0206353_12024428 3300020082 Bacteria 1051
90 Ga0207653_10052122 3300025885 Bacteria 1364
91 Ga0207692_10001802 3300025898 Bacteria 8121
92 Ga0207692_10011594 3300025898 Bacteria 3758
93 Ga0207685_10002415 3300025905 Bacteria 4274
94 Ga0207699_10013618 3300025906 Bacteria 4169
95 Ga0207699_10184150 3300025906 Bacteria 1405
96 Ga0207699_10240759 3300025906 Bacteria 1243
97 Ga0207693_10001153 3300025915 Bacteria 23583
98 Ga0207693_10005510 3300025915 Bacteria 10533
99 Ga0207663_10007699 3300025916 Bacteria 5604
100 Ga0207663_10560338 3300025916 Bacteria 894
101 Ga0207657_10003855 3300025919 Bacteria 15925
102 Ga0207652_10047416 3300025921 Bacteria 3670
103 Ga0207646_10001749 3300025922 Bacteria 26367
104 Ga0207646_10040720 3300025922 Bacteria 4178
105 Ga0207646_10342347 3300025922 Bacteria 1351
106 Ga0207646_10814076 3300025922 Bacteria 831
107 Ga0207687_11270920 3300025927 Bacteria 633
108 Ga0207700_10081589 3300025928 Bacteria 2526
109 Ga0207700_10097104 3300025928 Bacteria 2341
110 Ga0207664_10012447 3300025929 Bacteria 6083
111 Ga0207664_10141853 3300025929 Bacteria 2033
112 Ga0207664_10179045 3300025929 Bacteria 1819
113 Ga0207664_10307709 3300025929 Bacteria 1396
114 Ga0207664_10428100 3300025929 Bacteria 1179
115 Ga0207664_10546016 3300025929 Bacteria 1040
116 Ga0207690_10031594 3300025932 Bacteria 3390
117 Ga0207665_10000298 3300025939 Bacteria 34286
118 Ga0207665_10563838 3300025939 Bacteria 886
119 Ga0207711_10306518 3300025941 Bacteria 1465
120 Ga0207661_10279794 3300025944 Bacteria 1491
121 Ga0207661_11280327 3300025944 Bacteria 674
122 Ga0207679_10458691 3300025945 Unclassified 1131
123 Ga0207639_10675300 3300026041 Bacteria 957
124 Ga0207678_10326554 3300026067 Bacteria 1320
125 Ga0207702_10100265 3300026078 Bacteria 2554
126 Ga0207702_10119218 3300026078 Bacteria 2359
127 Ga0207702_10136697 3300026078 Bacteria 2212
128 Ga0207641_10589451 3300026088 Bacteria 1087
129 Ga0207674_10099954 3300026116 Bacteria 2883
130 Ga0265334_10006308 3300028573 Bacteria 5119
131 Ga0265322_10086010 3300028654 Bacteria 893
132 Ga0265336_10004130 3300028666 Bacteria 5530
133 Ga0265336_10042062 3300028666 Bacteria 1395
134 Ga0265338_10002936 3300028800 Bacteria 24729
135 Ga0265338_10004663 3300028800 Bacteria 18409
136 Ga0265338_10005415 3300028800 Bacteria 16665
137 Ga0265338_10008744 3300028800 Bacteria 12242
138 Ga0265338_10011028 3300028800 Bacteria 10493
139 Ga0265338_10077857 3300028800 Bacteria 2800
140 Ga0265338_10083785 3300028800 Bacteria 2665
141 Ga0265338_10844998 3300028800 Bacteria 625
142 Ga0265324_10010089 3300029957 Bacteria 3658
143 Ga0265320_10072803 3300031240 Bacteria 1616
144 Ga0265327_10035186 3300031251 Bacteria 2772
145 Ga0265313_10034948 3300031595 Bacteria 2535
146 Ga0265342_10039995 3300031712 Bacteria 2846
147 Ga0265342_10068449 3300031712 Bacteria 2075
148 Ga0373926_0014617 3300035083 Bacteria 2670
149 Ga0373944_0011024 3300035089 Bacteria 2472
150 Ga0373952_0147447 3300035092 Bacteria 658
151 Ga0373936_0174960 3300035113 Bacteria 940
152 Ga0373945_0006065 3300035116 Bacteria 3886
153 Ga0373957_0045800 3300035120 Bacteria 1659
154 Ga0373960_0018309 3300035121 Bacteria 1825
155 Ga0373943_0000628 3300035170 Bacteria 15270
156 Ga0373946_0048003 3300035171 Bacteria 1775
157 Ga0373942_0172094 3300035207 Unclassified 706
158 Ga0373961_0193943 3300035241 Bacteria 714
159 Ga0373935_0021166 3300035692 Bacteria 3980
160 Ga0373947_0004063 3300035725 Bacteria 8608
161 Ga0373947_0441760 3300035725 Bacteria 881
162 Ga0373947_0505267 3300035725 Bacteria 822
163 Ga0373937_0000447 3300036401 Bacteria 38075
164 Ga0373937_0141234 3300036401 Bacteria 2253
165 Ga0395900_0361709 3300037418 Bacteria 1422
166 Ga0395898_0008130 3300037466 Bacteria 11106
167 Ga0395898_0998194 3300037466 Bacteria 773
168 Ga0395901_0068108 3300038443 Bacteria 3708
169 Ga0395901_0726623 3300038443 Bacteria 988
170 Ga0436360_0831043 3300039438 Bacteria 12975
171 Ga0436363_0881618 3300039450 Bacteria 893
172 Ga0439448_0024394 3300042005 Bacteria 1891
173 Ga0439459_0039731 3300042438 Bacteria 995
174 Ga0466969_0003769 3300044656 Bacteria 8058
175 Ga0466972_0342673 3300044658 Bacteria 699
176 Ga0466965_0030986 3300044683 Bacteria 2607
177 Ga0466966_0028895 3300044684 Bacteria 3610
178 Ga0466966_0036603 3300044684 Bacteria 3168
179 Ga0466966_0155680 3300044684 Bacteria 1392
180 Ga0466961_0004522 3300044693 Bacteria 8722
181 Ga0466961_0041602 3300044693 Bacteria 2946
182 Ga0466961_0059672 3300044693 Bacteria 2425
183 Ga0466963_0000137 3300044694 Bacteria 28326
184 Ga0466963_0000632 3300044694 Bacteria 16887
185 Ga0466963_0000741 3300044694 Bacteria 16079
186 Ga0466963_0002688 3300044694 Bacteria 10010
187 Ga0466963_0009551 3300044694 Bacteria 5843
188 Ga0466963_0017815 3300044694 Bacteria 4432
189 Ga0466963_0018829 3300044694 Bacteria 4323
190 Ga0466963_0146673 3300044694 Bacteria 1637
191 Ga0466963_0163942 3300044694 Unclassified 1548
192 Ga0466963_0207022 3300044694 Bacteria 1372
193 Ga0466963_0207571 3300044694 Bacteria 1370
194 Ga0466963_0635637 3300044694 Unclassified 753
195 Ga0466964_0006725 3300044706 Bacteria 4286
196 Ga0466964_0011482 3300044706 Bacteria 3346
197 Ga0466964_0040882 3300044706 Bacteria 1873
198 Ga0466964_0045261 3300044706 Bacteria 1791
199 Ga0466971_0001552 3300044719 Bacteria 9688
200 Ga0466971_0011501 3300044719 Bacteria 3874
201 Ga0466968_0006450 3300044735 Bacteria 4423
202 Ga0466968_0007172 3300044735 Bacteria 4233
203 Ga0466968_0090288 3300044735 Bacteria 1356
204 Ga0466968_0374111 3300044735 Bacteria 695
205 Ga0466970_0062868 3300044765 Bacteria 1990
206 Ga0466957_0001689 3300044842 Bacteria 11606
207 Ga0466957_0003049 3300044842 Bacteria 9108
208 Ga0466957_0003662 3300044842 Bacteria 8480
209 Ga0466957_0028712 3300044842 Bacteria 3313
210 Ga0466957_0132902 3300044842 Bacteria 1596
211 Ga0466957_0322207 3300044842 Unclassified 1043
212 Ga0466960_0010750 3300044901 Bacteria 3809
213 Ga0466960_0103536 3300044901 Bacteria 1469
214 Ga0466959_0001767 3300045049 Bacteria 13474
215 Ga0466959_0010806 3300045049 Bacteria 6543
216 Ga0466959_0028028 3300045049 Bacteria 4176
217 Ga0466959_0049810 3300045049 Bacteria 3077
218 Ga0466959_0408742 3300045049 Bacteria 922
219 Ga0466958_0002075 3300045836 Bacteria 9910
220 Ga0466958_0004062 3300045836 Bacteria 7677
221 Ga0466958_0005483 3300045836 Bacteria 6838
222 Ga0466958_0007875 3300045836 Bacteria 5888
223 Ga0466958_0010034 3300045836 Bacteria 5292
224 Ga0466958_0057233 3300045836 Bacteria 2369
225 Ga0466958_0201591 3300045836 Bacteria 1266
226 Ga0466967_0000047 3300045976 Bacteria 43648
227 Ga0466967_0000300 3300045976 Bacteria 22193
228 Ga0466967_0002201 3300045976 Bacteria 11993
229 Ga0466967_0003956 3300045976 Bacteria 9857
230 Ga0466967_0010424 3300045976 Bacteria 6973
231 Ga0466967_0016795 3300045976 Bacteria 5785
232 Ga0466967_0019725 3300045976 Bacteria 5428
233 Ga0466967_0020648 3300045976 Bacteria 5330
234 Ga0466967_0054441 3300045976 Bacteria 3521
235 Ga0466967_0057794 3300045976 Bacteria 3426
236 Ga0466967_0089923 3300045976 Bacteria 2788
237 Ga0466967_0090251 3300045976 Bacteria 2783
238 Ga0466967_0137289 3300045976 Bacteria 2274
239 Ga0466967_0174655 3300045976 Bacteria 2023
240 Ga0466967_0311342 3300045976 Bacteria 1517
241 Ga0466967_0346221 3300045976 Bacteria 1438
242 Ga0466967_0624399 3300045976 Bacteria 1064
243 Ga0495592_0000124 3300046454 Bacteria 68396
244 Ga0495592_0002732 3300046454 Bacteria 12499
245 Ga0495592_0068925 3300046454 Unclassified 2580
246 Ga0495592_0118416 3300046454 Unclassified 1866
247 Ga0495603_0066180 3300046455 Bacteria 2128
248 Ga0495603_0320853 3300046455 Bacteria 889
249 Ga0495629_0018947 3300046459 Bacteria 4922
250 Ga0495629_0270777 3300046459 Bacteria 1166
251 Ga0495641_0003398 3300046461 Bacteria 11936
252 Ga0495641_0041073 3300046461 Bacteria 2149
253 Ga0495641_0061125 3300046461 Bacteria 1701
254 Ga0495641_0070324 3300046461 Unclassified 1572
255 Ga0495641_0157653 3300046461 Bacteria 1015
256 Ga0495641_0213381 3300046461 Unclassified 865
257 Ga0495651_0000011 3300046462 Bacteria 147193
258 Ga0495651_0054488 3300046462 Bacteria 3075
259 Ga0495651_0090009 3300046462 Bacteria 2302
260 Ga0495651_0229764 3300046462 Bacteria 1278
261 Ga0495653_0005518 3300046463 Bacteria 10305
262 Ga0495653_0040209 3300046463 Bacteria 3657
263 Ga0495653_0048893 3300046463 Bacteria 3261
264 Ga0495580_0006348 3300046472 Bacteria 9644
265 Ga0495582_0017838 3300046473 Bacteria 3880
266 Ga0495582_0070183 3300046473 Unclassified 1938
267 Ga0495582_0110834 3300046473 Bacteria 1541
268 Ga0495582_0285294 3300046473 Bacteria 948
269 Ga0495639_0000291 3300046475 Bacteria 24492
270 Ga0495664_0142701 3300046477 Bacteria 1452
271 Ga0495664_0214867 3300046477 Unclassified 1164
272 Ga0495585_0036223 3300046492 Bacteria 2785
273 Ga0495594_0158374 3300046499 Bacteria 1286
274 Ga0495596_0110675 3300046500 Bacteria 1066
275 Ga0495608_0009377 3300046511 Bacteria 6843
276 Ga0495608_0045032 3300046511 Bacteria 2943
277 Ga0495608_0506111 3300046511 Bacteria 731
278 Ga0495618_0002423 3300046514 Bacteria 11988
279 Ga0495618_0052983 3300046514 Bacteria 2566
280 Ga0495618_0082157 3300046514 Bacteria 2058
281 Ga0495618_0106816 3300046514 Bacteria 1792
282 Ga0495628_0000024 3300046516 Bacteria 130196
283 Ga0495628_0053021 3300046516 Bacteria 3202
284 Ga0495628_0471050 3300046516 Bacteria 910
285 Ga0495630_0000631 3300046517 Bacteria 25489
286 Ga0495630_0040376 3300046517 Bacteria 3487
287 Ga0495630_0515757 3300046517 Bacteria 916
288 Ga0495644_0011502 3300046523 Bacteria 3406
289 Ga0495663_0053894 3300046525 Bacteria 1251
290 Ga0495666_0000270 3300046526 Bacteria 22402
291 Ga0495666_0068897 3300046526 Bacteria 1684
292 Ga0495652_0000050 3300046529 Bacteria 120480
293 Ga0495652_0004378 3300046529 Bacteria 13510
294 Ga0495652_0058144 3300046529 Bacteria 3275
295 Ga0495652_0071415 3300046529 Unclassified 2898
296 Ga0495652_0880650 3300046529 Bacteria 592
297 Ga0495665_0001487 3300046531 Bacteria 12555
298 Ga0495640_0014623 3300046533 Bacteria 5930
299 Ga0495640_0019213 3300046533 Bacteria 5047
300 Ga0495640_0239909 3300046533 Bacteria 1138
301 Ga0495586_0004266 3300046535 Bacteria 7645
302 Ga0495586_0044620 3300046535 Bacteria 2388
303 Ga0495587_0000084 3300046536 Bacteria 72926
304 Ga0495587_0027639 3300046536 Bacteria 3454
305 Ga0495587_0224272 3300046536 Bacteria 1060
306 Ga0495587_0262865 3300046536 Bacteria 969
307 Ga0495645_0000067 3300046543 Bacteria 73037
308 Ga0495645_0035797 3300046543 Bacteria 3619
309 Ga0495645_0090305 3300046543 Bacteria 2189
310 Ga0495645_0577296 3300046543 Bacteria 694
311 Ga0495667_0015940 3300046559 Bacteria 5080
312 Ga0495667_0021882 3300046559 Bacteria 4311
313 Ga0495667_0043339 3300046559 Bacteria 2982
314 Ga0495656_0009318 3300046615 Bacteria 3527
315 Ga0495634_0004560 3300046642 Bacteria 10823
316 Ga0495634_0016205 3300046642 Bacteria 5333
317 Ga0495634_0071949 3300046642 Bacteria 2275
318 Ga0495634_0119578 3300046642 Bacteria 1687
319 Ga0495634_0665678 3300046642 Bacteria 600
320 Ga0495611_0027342 3300046648 Bacteria 2493
321 Ga0495635_0006305 3300046663 Bacteria 8263
322 Ga0495635_0013922 3300046663 Bacteria 5627
323 Ga0495635_0014612 3300046663 Bacteria 5492
324 Ga0495635_0258932 3300046663 Bacteria 1172
325 Ga0495635_0350907 3300046663 Bacteria 984
326 Ga0495657_0003575 3300046675 Bacteria 12645
327 Ga0495657_0019913 3300046675 Bacteria 4834
328 Ga0495657_0038051 3300046675 Bacteria 3312
329 Ga0495657_0066898 3300046675 Bacteria 2360
330 Ga0495657_0170515 3300046675 Bacteria 1340
331 Ga0495657_0330402 3300046675 Unclassified 905
332 Ga0495599_0000009 3300046678 Bacteria 217299
333 Ga0495599_0177871 3300046678 Bacteria 1312
334 Ga0495599_0199096 3300046678 Bacteria 1230
335 Ga0495623_0000219 3300046679 Bacteria 36687
336 Ga0495623_0042995 3300046679 Bacteria 2876
337 Ga0495623_0098426 3300046679 Unclassified 1785
338 Ga0495623_0294555 3300046679 Bacteria 899
339 Ga0495623_0475930 3300046679 Bacteria 662
340 Ga0495646_0024086 3300046680 Bacteria 3833
341 Ga0495646_0185549 3300046680 Bacteria 1139
342 Ga0495647_0000243 3300046681 Bacteria 14906
343 Ga0495647_0046477 3300046681 Bacteria 1672
344 Ga0495658_0000970 3300046683 Bacteria 15222
345 Ga0495658_0019086 3300046683 Bacteria 3575
346 Ga0495658_0108632 3300046683 Bacteria 1665
347 Ga0495613_0022344 3300046689 Bacteria 4714
348 Ga0495613_0059925 3300046689 Bacteria 2788
349 Ga0495613_0634777 3300046689 Unclassified 708
350 Ga0495624_0001273 3300046690 Bacteria 19870
351 Ga0495624_0044964 3300046690 Bacteria 2813
352 Ga0495624_0060502 3300046690 Bacteria 2374
353 Ga0495670_0060695 3300046691 Bacteria 1900
354 Ga0495589_0047622 3300046794 Bacteria 2124
355 Ga0495600_0036851 3300046809 Bacteria 3179
356 Ga0495581_0000258 3300047315 Bacteria 25364
357 Ga0495581_0029612 3300047315 Bacteria 3173
358 Ga0495604_0000334 3300047317 Bacteria 42026
359 Ga0495604_0485290 3300047317 Bacteria 803
360 Ga0495674_0004337 3300047319 Bacteria 13635
361 Ga0495674_0036575 3300047319 Bacteria 4418
362 Ga0495674_0105724 3300047319 Bacteria 2391
363 Ga0495674_0278131 3300047319 Bacteria 1372
364 Ga0495676_0158421 3300047321 Bacteria 1604
365 Ga0495676_0303617 3300047321 Unclassified 1076
366 Ga0495676_0404521 3300047321 Bacteria 905
367 Ga0495680_0001263 3300047322 Bacteria 27605
368 Ga0495680_0002837 3300047322 Bacteria 17416
369 Ga0495680_0018640 3300047322 Bacteria 5882
370 Ga0495680_0159727 3300047322 Bacteria 1637
371 Ga0495680_0405500 3300047322 Bacteria 940
372 Ga0495675_0000972 3300047444 Bacteria 17397
373 Ga0495675_0089444 3300047444 Bacteria 1933
374 Ga0495675_0096899 3300047444 Bacteria 1849
375 Ga0495675_0193179 3300047444 Unclassified 1242
376 Ga0495675_0594559 3300047444 Bacteria 628
377 Ga0495684_0007604 3300047471 Bacteria 8385
378 Ga0495684_0030087 3300047471 Bacteria 4168
379 Ga0495684_0051951 3300047471 Bacteria 3127
380 Ga0495684_0061022 3300047471 Bacteria 2869
381 Ga0495684_0107303 3300047471 Bacteria 2109
382 Ga0495684_0469450 3300047471 Bacteria 871
383 Ga0495593_0000732 3300047673 Bacteria 19043
384 Ga0495602_0000234 3300048088 Bacteria 51947
385 Ga0495602_0085890 3300048088 Bacteria 2628
386 Ga0495602_0125431 3300048088 Unclassified 2058
387 Ga0495614_0000557 3300048089 Bacteria 15456
388 Ga0496100_0164744 3300048903 Bacteria 1591
389 Ga0496100_0354475 3300048903 Bacteria 1109
390 Ga0496101_0022901 3300048904 Bacteria 4308
391 Ga0496101_0041713 3300048904 Bacteria 3273
392 Ga0496101_0057073 3300048904 Bacteria 2823
393 Ga0496101_0102851 3300048904 Bacteria 2140
394 Ga0496101_0753848 3300048904 Bacteria 768
395 Ga0496102_0206464 3300048905 Bacteria 1852
396 Ga0496102_0251487 3300048905 Bacteria 1666
397 Ga0496102_0717230 3300048905 Bacteria 923
398 Ga0496103_0011428 3300048906 Bacteria 5262
399 Ga0496103_0141983 3300048906 Bacteria 1536
400 Ga0496104_0018025 3300048907 Bacteria 6437
401 Ga0496104_0089334 3300048907 Bacteria 2943
402 Ga0496104_0156900 3300048907 Bacteria 2184
403 Ga0496104_0172353 3300048907 Bacteria 2074
404 Ga0496105_0002794 3300048908 Bacteria 12764
405 Ga0496105_0004249 3300048908 Bacteria 10772
406 Ga0496105_0068741 3300048908 Bacteria 2926
407 Ga0496105_0112668 3300048908 Bacteria 2245
408 Ga0496105_0156572 3300048908 Bacteria 1871
409 Ga0496106_0011451 3300048909 Bacteria 6561
410 Ga0496106_0022799 3300048909 Bacteria 4650
411 Ga0496107_0001150 3300048910 Bacteria 16019
412 Ga0496107_0001783 3300048910 Bacteria 13566
413 Ga0496107_0049541 3300048910 Bacteria 3027
414 Ga0496108_0002204 3300048911 Bacteria 15597
415 Ga0496108_0013097 3300048911 Bacteria 6760
416 Ga0496108_0024322 3300048911 Bacteria 4985
417 Ga0496108_0059428 3300048911 Bacteria 3214
418 Ga0496108_0455061 3300048911 Bacteria 1118
419 Ga0496109_0116607 3300048912 Bacteria 2485
420 Ga0496109_0165154 3300048912 Bacteria 2075
421 Ga0496110_0012547 3300048913 Bacteria 6969
422 Ga0496110_0151330 3300048913 Bacteria 2101
423 Ga0496111_0005755 3300048914 Bacteria 8000
424 Ga0496111_0161576 3300048914 Bacteria 1663
425 Ga0496111_0937263 3300048914 Unclassified 622
426 Ga0496112_0131927 3300048915 Bacteria 2469
427 Ga0496112_0236360 3300048915 Bacteria 1781
428 Ga0496112_0309657 3300048915 Bacteria 1524
429 Ga0496112_0642496 3300048915 Bacteria 991
430 Ga0496113_0041850 3300048916 Bacteria 3383
431 Ga0496113_0333993 3300048916 Bacteria 1215
432 Ga0496113_0546066 3300048916 Bacteria 929
433 Ga0496114_0012709 3300048917 Bacteria 6744
434 Ga0496114_0014142 3300048917 Bacteria 6399
435 Ga0496115_0011946 3300048918 Bacteria 6522
436 Ga0496115_0020286 3300048918 Bacteria 5126
437 nmdc:mga0n895_93477_c1 3300050512 Bacteria 3011
438 nmdc:mga0rr50_1120557_c1 3300050513 Bacteria 669
439 nmdc:mga0a205_277757_c1 3300050515 Bacteria 1551
440 Ga0495601_0002020 3300053077 Bacteria 11388
441 Ga0495601_0006407 3300053077 Bacteria 6882
442 Ga0495601_0019609 3300053077 Bacteria 4125
443 Ga0495601_0075806 3300053077 Unclassified 2153
444 Ga0495612_0014189 3300053078 Bacteria 3206
445 Ga0495612_0027373 3300053078 Bacteria 2292
446 Ga0495612_0067723 3300053078 Bacteria 1485
447 Ga0495655_0016166 3300053083 Bacteria 1602
448 Ga0495595_0003079 3300053084 Bacteria 6595
449 Ga0495595_0005410 3300053084 Bacteria 5172
450 Ga0495595_0024174 3300053084 Bacteria 2682
451 Ga0495595_0043939 3300053084 Bacteria 2051
452 Ga0495595_0056091 3300053084 Bacteria 1835
453 Ga0495619_0001368 3300053085 Bacteria 16040
454 Ga0495619_0001604 3300053085 Bacteria 14872
455 Ga0495619_0031532 3300053085 Bacteria 3434
456 Ga0495619_0082549 3300053085 Bacteria 2166
457 Ga0495619_0189282 3300053085 Bacteria 1424
458 Ga0500566_0004146 3300053094 Bacteria 8645
459 Ga0466962_0012591 3300061719 Bacteria 4069
460 Ga0207695_10559624
461 Ga0070658_10048704
462 Ga0070683_100077033
463 Ga0070683_100349211
464 Ga0070683_101232145
465 Ga0070680_100051216
466 Ga0070680_100083768
467 Ga0070682_100152768
468 Ga0068868_100134423
469 Ga0068868_100884850
470 Ga0070660_100008244
471 Ga0070687_100360738
472 Ga0070661_100014019
473 Ga0070671_100097752
474 Ga0070671_100183073
475 Ga0070703_10066499
476 Ga0070709_10008850
477 Ga0070709_10010287
478 Ga0070714_100004653
479 Ga0070714_100030993
480 Ga0070714_100033375
481 Ga0070714_100053762
482 Ga0070714_100252025
483 Ga0070714_101027067
484 Ga0070713_100003675
485 Ga0070713_100107884
486 Ga0070710_10002865
487 Ga0070711_100010102
488 Ga0070711_100061829
489 Ga0070711_100306987
490 Ga0070663_100489438
491 Ga0070681_10003595
492 Ga0070681_10013434
493 Ga0070685_10308821
494 Ga0070707_100000633
495 Ga0070707_100052628
496 Ga0070707_100242761
497 Ga0070698_100068513
498 Ga0070698_100326436
499 Ga0070698_100336487
500 Ga0070698_100589745
501 Ga0070699_100449024
502 Ga0070679_100079465
503 Ga0070684_100031649
504 Ga0070704_100209331
505 Ga0068855_100105521
506 Ga0070664_100355626
507 Ga0070664_100845414
508 Ga0068856_100033958
509 Ga0068856_100087922
510 Ga0068856_100200584
511 Ga0068864_101845923
512 Ga0068863_100418566
513 Ga0070717_10014842
514 Ga0070717_10027009
515 Ga0070717_10335870
516 Ga0070717_10475523
517 Ga0070717_10575789
518 Ga0070717_10707277
519 Ga0070715_10000701
520 Ga0070716_100001043
521 Ga0070716_100107271
522 Ga0070716_100432256
523 Ga0070712_100328553
524 Ga0070712_100359003
525 Ga0097621_100282853
526 Ga0075433_10285354
527 Ga0075434_100009519
528 Ga0075435_101020081
529 Ga0105240_10288175
530 Ga0105240_10502732
531 Ga0105245_10090770
532 Ga0105247_10027858
533 Ga0105241_10602163
534 Ga0105248_10360621
535 Ga0105237_10632372
536 Ga0105238_10383407
537 Ga0105238_10407726
538 Ga0157369_10031406
539 Ga0157369_10258371
540 Ga0157374_10022751
541 Ga0157372_10082283
542 Ga0157375_10137041
543 Ga0182008_10075272
544 Ga0182008_10373925
545 Ga0157379_10749164
546 Ga0157376_10030962
547 Ga0206354_10392503
548 Ga0206353_12024428
549 Ga0207653_10052122
550 Ga0207692_10001802
551 Ga0207692_10011594
552 Ga0207685_10002415
553 Ga0207699_10013618
554 Ga0207699_10184150
555 Ga0207699_10240759
556 Ga0207693_10001153
557 Ga0207693_10005510
558 Ga0207663_10007699
559 Ga0207663_10560338
560 Ga0207657_10003855
561 Ga0207652_10047416
562 Ga0207646_10001749
563 Ga0207646_10040720
564 Ga0207646_10342347
565 Ga0207646_10814076
566 Ga0207687_11270920
567 Ga0207700_10081589
568 Ga0207700_10097104
569 Ga0207664_10012447
570 Ga0207664_10141853
571 Ga0207664_10179045
572 Ga0207664_10307709
573 Ga0207664_10428100
574 Ga0207664_10546016
575 Ga0207690_10031594
576 Ga0207665_10000298
577 Ga0207665_10563838
578 Ga0207711_10306518
579 Ga0207661_10279794
580 Ga0207661_11280327
581 Ga0207679_10458691
582 Ga0207639_10675300
583 Ga0207678_10326554
584 Ga0207702_10100265
585 Ga0207702_10119218
586 Ga0207702_10136697
587 Ga0207641_10589451
588 Ga0207674_10099954
589 Ga0265334_10006308
590 Ga0265322_10086010
591 Ga0265336_10004130
592 Ga0265336_10042062
593 Ga0265338_10002936
594 Ga0265338_10004663
595 Ga0265338_10005415
596 Ga0265338_10008744
597 Ga0265338_10011028
598 Ga0265338_10077857
599 Ga0265338_10083785
600 Ga0265338_10844998
601 Ga0265324_10010089
602 Ga0265320_10072803
603 Ga0265327_10035186
604 Ga0265313_10034948
605 Ga0265342_10039995
606 Ga0265342_10068449
607 Ga0373926_0014617
608 Ga0373944_0011024
609 Ga0373952_0147447
610 Ga0373936_0174960
611 Ga0373945_0006065
612 Ga0373957_0045800
613 Ga0373960_0018309
614 Ga0373943_0000628
615 Ga0373946_0048003
616 Ga0373942_0172094
617 Ga0373961_0193943
618 Ga0373935_0021166
619 Ga0373947_0004063
620 Ga0373947_0441760
621 Ga0373947_0505267
622 Ga0373937_0000447
623 Ga0373937_0141234
624 Ga0395900_0361709
625 Ga0395898_0008130
626 Ga0395898_0998194
627 Ga0395901_0068108
628 Ga0395901_0726623
629 Ga0436360_0831043
630 Ga0436363_0881618
631 Ga0439448_0024394
632 Ga0439459_0039731
633 Ga0466969_0003769
634 Ga0466972_0342673
635 Ga0466965_0030986
636 Ga0466966_0028895
637 Ga0466966_0036603
638 Ga0466966_0155680
639 Ga0466961_0004522
640 Ga0466961_0041602
641 Ga0466961_0059672
642 Ga0466963_0000137
643 Ga0466963_0000632
644 Ga0466963_0000741
645 Ga0466963_0002688
646 Ga0466963_0009551
647 Ga0466963_0017815
648 Ga0466963_0018829
649 Ga0466963_0146673
650 Ga0466963_0163942
651 Ga0466963_0207022
652 Ga0466963_0207571
653 Ga0466963_0635637
654 Ga0466964_0006725
655 Ga0466964_0011482
656 Ga0466964_0040882
657 Ga0466964_0045261
658 Ga0466971_0001552
659 Ga0466971_0011501
660 Ga0466968_0006450
661 Ga0466968_0007172
662 Ga0466968_0090288
663 Ga0466968_0374111
664 Ga0466970_0062868
665 Ga0466957_0001689
666 Ga0466957_0003049
667 Ga0466957_0003662
668 Ga0466957_0028712
669 Ga0466957_0132902
670 Ga0466957_0322207
671 Ga0466960_0010750
672 Ga0466960_0103536
673 Ga0466959_0001767
674 Ga0466959_0010806
675 Ga0466959_0028028
676 Ga0466959_0049810
677 Ga0466959_0408742
678 Ga0466958_0002075
679 Ga0466958_0004062
680 Ga0466958_0005483
681 Ga0466958_0007875
682 Ga0466958_0010034
683 Ga0466958_0057233
684 Ga0466958_0201591
685 Ga0466967_0000047
686 Ga0466967_0000300
687 Ga0466967_0002201
688 Ga0466967_0003956
689 Ga0466967_0010424
690 Ga0466967_0016795
691 Ga0466967_0019725
692 Ga0466967_0020648
693 Ga0466967_0054441
694 Ga0466967_0057794
695 Ga0466967_0089923
696 Ga0466967_0090251
697 Ga0466967_0137289
698 Ga0466967_0174655
699 Ga0466967_0311342
700 Ga0466967_0346221
701 Ga0466967_0624399
702 Ga0495592_0000124
703 Ga0495592_0002732
704 Ga0495592_0068925
705 Ga0495592_0118416
706 Ga0495603_0066180
707 Ga0495603_0320853
708 Ga0495629_0018947
709 Ga0495629_0270777
710 Ga0495641_0003398
711 Ga0495641_0041073
712 Ga0495641_0061125
713 Ga0495641_0070324
714 Ga0495641_0157653
715 Ga0495641_0213381
716 Ga0495651_0000011
717 Ga0495651_0054488
718 Ga0495651_0090009
719 Ga0495651_0229764
720 Ga0495653_0005518
721 Ga0495653_0040209
722 Ga0495653_0048893
723 Ga0495580_0006348
724 Ga0495582_0017838
725 Ga0495582_0070183
726 Ga0495582_0110834
727 Ga0495582_0285294
728 Ga0495639_0000291
729 Ga0495664_0142701
730 Ga0495664_0214867
731 Ga0495585_0036223
732 Ga0495594_0158374
733 Ga0495596_0110675
734 Ga0495608_0009377
735 Ga0495608_0045032
736 Ga0495608_0506111
737 Ga0495618_0002423
738 Ga0495618_0052983
739 Ga0495618_0082157
740 Ga0495618_0106816
741 Ga0495628_0000024
742 Ga0495628_0053021
743 Ga0495628_0471050
744 Ga0495630_0000631
745 Ga0495630_0040376
746 Ga0495630_0515757
747 Ga0495644_0011502
748 Ga0495663_0053894
749 Ga0495666_0000270
750 Ga0495666_0068897
751 Ga0495652_0000050
752 Ga0495652_0004378
753 Ga0495652_0058144
754 Ga0495652_0071415
755 Ga0495652_0880650
756 Ga0495665_0001487
757 Ga0495640_0014623
758 Ga0495640_0019213
759 Ga0495640_0239909
760 Ga0495586_0004266
761 Ga0495586_0044620
762 Ga0495587_0000084
763 Ga0495587_0027639
764 Ga0495587_0224272
765 Ga0495587_0262865
766 Ga0495645_0000067
767 Ga0495645_0035797
768 Ga0495645_0090305
769 Ga0495645_0577296
770 Ga0495667_0015940
771 Ga0495667_0021882
772 Ga0495667_0043339
773 Ga0495656_0009318
774 Ga0495634_0004560
775 Ga0495634_0016205
776 Ga0495634_0071949
777 Ga0495634_0119578
778 Ga0495634_0665678
779 Ga0495611_0027342
780 Ga0495635_0006305
781 Ga0495635_0013922
782 Ga0495635_0014612
783 Ga0495635_0258932
784 Ga0495635_0350907
785 Ga0495657_0003575
786 Ga0495657_0019913
787 Ga0495657_0038051
788 Ga0495657_0066898
789 Ga0495657_0170515
790 Ga0495657_0330402
791 Ga0495599_0000009
792 Ga0495599_0177871
793 Ga0495599_0199096
794 Ga0495623_0000219
795 Ga0495623_0042995
796 Ga0495623_0098426
797 Ga0495623_0294555
798 Ga0495623_0475930
799 Ga0495646_0024086
800 Ga0495646_0185549
801 Ga0495647_0000243
802 Ga0495647_0046477
803 Ga0495658_0000970
804 Ga0495658_0019086
805 Ga0495658_0108632
806 Ga0495613_0022344
807 Ga0495613_0059925
808 Ga0495613_0634777
809 Ga0495624_0001273
810 Ga0495624_0044964
811 Ga0495624_0060502
812 Ga0495670_0060695
813 Ga0495589_0047622
814 Ga0495600_0036851
815 Ga0495581_0000258
816 Ga0495581_0029612
817 Ga0495604_0000334
818 Ga0495604_0485290
819 Ga0495674_0004337
820 Ga0495674_0036575
821 Ga0495674_0105724
822 Ga0495674_0278131
823 Ga0495676_0158421
824 Ga0495676_0303617
825 Ga0495676_0404521
826 Ga0495680_0001263
827 Ga0495680_0002837
828 Ga0495680_0018640
829 Ga0495680_0159727
830 Ga0495680_0405500
831 Ga0495675_0000972
832 Ga0495675_0089444
833 Ga0495675_0096899
834 Ga0495675_0193179
835 Ga0495675_0594559
836 Ga0495684_0007604
837 Ga0495684_0030087
838 Ga0495684_0051951
839 Ga0495684_0061022
840 Ga0495684_0107303
841 Ga0495684_0469450
842 Ga0495593_0000732
843 Ga0495602_0000234
844 Ga0495602_0085890
845 Ga0495602_0125431
846 Ga0495614_0000557
847 Ga0496100_0164744
848 Ga0496100_0354475
849 Ga0496101_0022901
850 Ga0496101_0041713
851 Ga0496101_0057073
852 Ga0496101_0102851
853 Ga0496101_0753848
854 Ga0496102_0206464
855 Ga0496102_0251487
856 Ga0496102_0717230
857 Ga0496103_0011428
858 Ga0496103_0141983
859 Ga0496104_0018025
860 Ga0496104_0089334
861 Ga0496104_0156900
862 Ga0496104_0172353
863 Ga0496105_0002794
864 Ga0496105_0004249
865 Ga0496105_0068741
866 Ga0496105_0112668
867 Ga0496105_0156572
868 Ga0496106_0011451
869 Ga0496106_0022799
870 Ga0496107_0001150
871 Ga0496107_0001783
872 Ga0496107_0049541
873 Ga0496108_0002204
874 Ga0496108_0013097
875 Ga0496108_0024322
876 Ga0496108_0059428
877 Ga0496108_0455061
878 Ga0496109_0116607
879 Ga0496109_0165154
880 Ga0496110_0012547
881 Ga0496110_0151330
882 Ga0496111_0005755
883 Ga0496111_0161576
884 Ga0496111_0937263
885 Ga0496112_0131927
886 Ga0496112_0236360
887 Ga0496112_0309657
888 Ga0496112_0642496
889 Ga0496113_0041850
890 Ga0496113_0333993
891 Ga0496113_0546066
892 Ga0496114_0012709
893 Ga0496114_0014142
894 Ga0496115_0011946
895 Ga0496115_0020286
896 nmdc:mga0n895_93477_c1
897 nmdc:mga0rr50_1120557_c1
898 nmdc:mga0a205_277757_c1
899 Ga0495601_0002020
900 Ga0495601_0006407
901 Ga0495601_0019609
902 Ga0495601_0075806
903 Ga0495612_0014189
904 Ga0495612_0027373
905 Ga0495612_0067723
906 Ga0495655_0016166
907 Ga0495595_0003079
908 Ga0495595_0005410
909 Ga0495595_0024174
910 Ga0495595_0043939
911 Ga0495595_0056091
912 Ga0495619_0001368
913 Ga0495619_0001604
914 Ga0495619_0031532
915 Ga0495619_0082549
916 Ga0495619_0189282
917 Ga0500566_0004146
918 Ga0466962_0012591

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

37

155

0.96

PF13905

Thioredoxin_8

Thioredoxin-like

62

152

0.95

PF08534

Redoxin

Redoxin

37

169

0.92

PF00085

Thioredoxin

Thioredoxin

55

133

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h1a-assembly1.cif.gz_A resa c74a variant 0.9422 39 176
3gl3-assembly1.cif.gz_A crystal structure of a putative thiol:disulfide interchange protein dsbe from chlorobium tepidum 0.9402 34 178
4nmu-assembly2.cif.gz_B crystal structure of thiol-disulfide oxidoreductase from bacillus str. 'ames ancestor' 0.937 36 178
3gl3-assembly1.cif.gz_A crystal structure of a putative thiol:disulfide interchange protein dsbe from chlorobium tepidum 0.9339 34 178
3ios-assembly1.cif.gz_A structure of mtb dsbf in its mixed oxidized and reduced forms 0.9294 44 176
ID Description Score Start End Superfamily
3iosA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9294 44 176 3.40.30.10
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9293 38 173 3.40.30.10
3gl3B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9098 36 177 3.40.30.10
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9035 38 173 3.40.30.10
af_Q655X0_59_172_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8881 62 176 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1F9MSF8-F1-model_v4 Cytochrome C biogenesis protein 0.9712 31 158 GO:0016209
GO:0016491
AF-A0A1G0FVZ1-F1-model_v4 Thioredoxin domain-containing protein 0.9671 39 176 GO:0015036
GO:0017004
GO:0030313
AF-A0A2W5YZX2-F1-model_v4 Thioredoxin domain-containing protein 0.9671 33 178 GO:0016209
GO:0016491
AF-A0A3B8Z219-F1-model_v4 Thioredoxin domain-containing protein 0.9645 32 158 GO:0016209
GO:0016491
AF-A0A831TN47-F1-model_v4 TlpA family protein disulfide reductase 0.9636 32 177 GO:0016209
GO:0016491

Map