F448367
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 459 | 199 | 918 | 178 |
Family's Representative Sequence
| Representative Sequence | 3300025913|Ga0207695_10559624|Ga0207695_105596241 |
| Length | 201 |
| Sequence | VTSRVKTAAQVLALACVAGLLALLVWSVVHQEHAPGIGATAPAFTLHRLEGPGKVSLASYRGKPVVLNFWASWCEPCKSEAAVLQRDWTTYRNRGVVFLGVDYHDLDSDARRFVSAHALTFPMLEDGSGTVTGRYGISQVPETYVLNRQGRVVAHLRGPITDPGFARSLRISNASRSDWRIAAGEIATSTVVRWLSWSLTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 30 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 31 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 37 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 38 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 51 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 54 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 55 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 78 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 79 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 80 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 81 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 82 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 83 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 84 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 85 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 86 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 87 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 88 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 89 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 90 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 91 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 92 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 93 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 94 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 95 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 96 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 97 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 98 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 99 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 100 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 101 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 102 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 103 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 104 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 105 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 106 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 107 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 108 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 109 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 110 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 111 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 112 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 113 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 114 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 115 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 116 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 117 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 118 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 119 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 120 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 121 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 122 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 177 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 178 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 179 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 180 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 181 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 182 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 185 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 186 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 187 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 188 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 189 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 190 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 199 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.56 |
| Metatranscriptomes | 0.44 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.22 |
| Nodule | 0 |
| Rhizoplane | 10.68 |
| Rhizosphere | 88.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207695_10559624 | 3300025913 | Bacteria | 1025 |
| 2 | Ga0070658_10048704 | 3300005327 | Bacteria | 3431 |
| 3 | Ga0070683_100077033 | 3300005329 | Bacteria | 3118 |
| 4 | Ga0070683_100349211 | 3300005329 | Bacteria | 1409 |
| 5 | Ga0070683_101232145 | 3300005329 | Bacteria | 719 |
| 6 | Ga0070680_100051216 | 3300005336 | Bacteria | 3368 |
| 7 | Ga0070680_100083768 | 3300005336 | Bacteria | 2633 |
| 8 | Ga0070682_100152768 | 3300005337 | Bacteria | 1586 |
| 9 | Ga0068868_100134423 | 3300005338 | Bacteria | 2026 |
| 10 | Ga0068868_100884850 | 3300005338 | Unclassified | 811 |
| 11 | Ga0070660_100008244 | 3300005339 | Bacteria | 7283 |
| 12 | Ga0070687_100360738 | 3300005343 | Bacteria | 941 |
| 13 | Ga0070661_100014019 | 3300005344 | Bacteria | 5636 |
| 14 | Ga0070671_100097752 | 3300005355 | Bacteria | 2462 |
| 15 | Ga0070671_100183073 | 3300005355 | Bacteria | 1774 |
| 16 | Ga0070703_10066499 | 3300005406 | Bacteria | 1192 |
| 17 | Ga0070709_10008850 | 3300005434 | Bacteria | 5542 |
| 18 | Ga0070709_10010287 | 3300005434 | Bacteria | 5173 |
| 19 | Ga0070714_100004653 | 3300005435 | Bacteria | 10359 |
| 20 | Ga0070714_100030993 | 3300005435 | Bacteria | 4457 |
| 21 | Ga0070714_100033375 | 3300005435 | Bacteria | 4302 |
| 22 | Ga0070714_100053762 | 3300005435 | Bacteria | 3439 |
| 23 | Ga0070714_100252025 | 3300005435 | Bacteria | 1632 |
| 24 | Ga0070714_101027067 | 3300005435 | Unclassified | 802 |
| 25 | Ga0070713_100003675 | 3300005436 | Bacteria | 10152 |
| 26 | Ga0070713_100107884 | 3300005436 | Bacteria | 2423 |
| 27 | Ga0070710_10002865 | 3300005437 | Bacteria | 8215 |
| 28 | Ga0070711_100010102 | 3300005439 | Bacteria | 5831 |
| 29 | Ga0070711_100061829 | 3300005439 | Bacteria | 2608 |
| 30 | Ga0070711_100306987 | 3300005439 | Bacteria | 1264 |
| 31 | Ga0070663_100489438 | 3300005455 | Bacteria | 1020 |
| 32 | Ga0070681_10003595 | 3300005458 | Bacteria | 14536 |
| 33 | Ga0070681_10013434 | 3300005458 | Bacteria | 8136 |
| 34 | Ga0070685_10308821 | 3300005466 | Bacteria | 1068 |
| 35 | Ga0070707_100000633 | 3300005468 | Bacteria | 35138 |
| 36 | Ga0070707_100052628 | 3300005468 | Bacteria | 3904 |
| 37 | Ga0070707_100242761 | 3300005468 | Bacteria | 1753 |
| 38 | Ga0070698_100068513 | 3300005471 | Bacteria | 3565 |
| 39 | Ga0070698_100326436 | 3300005471 | Bacteria | 1465 |
| 40 | Ga0070698_100336487 | 3300005471 | Bacteria | 1441 |
| 41 | Ga0070698_100589745 | 3300005471 | Bacteria | 1051 |
| 42 | Ga0070699_100449024 | 3300005518 | Bacteria | 1169 |
| 43 | Ga0070679_100079465 | 3300005530 | Bacteria | 3269 |
| 44 | Ga0070684_100031649 | 3300005535 | Bacteria | 4505 |
| 45 | Ga0070704_100209331 | 3300005549 | Bacteria | 1579 |
| 46 | Ga0068855_100105521 | 3300005563 | Bacteria | 3239 |
| 47 | Ga0070664_100355626 | 3300005564 | Bacteria | 1333 |
| 48 | Ga0070664_100845414 | 3300005564 | Bacteria | 857 |
| 49 | Ga0068856_100033958 | 3300005614 | Bacteria | 4995 |
| 50 | Ga0068856_100087922 | 3300005614 | Bacteria | 3090 |
| 51 | Ga0068856_100200584 | 3300005614 | Bacteria | 2009 |
| 52 | Ga0068864_101845923 | 3300005618 | Bacteria | 610 |
| 53 | Ga0068863_100418566 | 3300005841 | Bacteria | 1312 |
| 54 | Ga0070717_10014842 | 3300006028 | Bacteria | 5994 |
| 55 | Ga0070717_10027009 | 3300006028 | Bacteria | 4585 |
| 56 | Ga0070717_10335870 | 3300006028 | Unclassified | 1348 |
| 57 | Ga0070717_10475523 | 3300006028 | Bacteria | 1128 |
| 58 | Ga0070717_10575789 | 3300006028 | Bacteria | 1021 |
| 59 | Ga0070717_10707277 | 3300006028 | Bacteria | 915 |
| 60 | Ga0070715_10000701 | 3300006163 | Bacteria | 8994 |
| 61 | Ga0070716_100001043 | 3300006173 | Bacteria | 12156 |
| 62 | Ga0070716_100107271 | 3300006173 | Bacteria | 1724 |
| 63 | Ga0070716_100432256 | 3300006173 | Bacteria | 955 |
| 64 | Ga0070712_100328553 | 3300006175 | Bacteria | 1245 |
| 65 | Ga0070712_100359003 | 3300006175 | Bacteria | 1194 |
| 66 | Ga0097621_100282853 | 3300006237 | Bacteria | 1460 |
| 67 | Ga0075433_10285354 | 3300006852 | Bacteria | 1462 |
| 68 | Ga0075434_100009519 | 3300006871 | Bacteria | 9066 |
| 69 | Ga0075435_101020081 | 3300007076 | Bacteria | 723 |
| 70 | Ga0105240_10288175 | 3300009093 | Bacteria | 1884 |
| 71 | Ga0105240_10502732 | 3300009093 | Bacteria | 1347 |
| 72 | Ga0105245_10090770 | 3300009098 | Bacteria | 2810 |
| 73 | Ga0105247_10027858 | 3300009101 | Bacteria | 3416 |
| 74 | Ga0105241_10602163 | 3300009174 | Bacteria | 993 |
| 75 | Ga0105248_10360621 | 3300009177 | Bacteria | 1636 |
| 76 | Ga0105237_10632372 | 3300009545 | Unclassified | 1077 |
| 77 | Ga0105238_10383407 | 3300009551 | Bacteria | 1397 |
| 78 | Ga0105238_10407726 | 3300009551 | Bacteria | 1353 |
| 79 | Ga0157369_10031406 | 3300013105 | Bacteria | 5849 |
| 80 | Ga0157369_10258371 | 3300013105 | Bacteria | 1817 |
| 81 | Ga0157374_10022751 | 3300013296 | Bacteria | 5596 |
| 82 | Ga0157372_10082283 | 3300013307 | Bacteria | 3644 |
| 83 | Ga0157375_10137041 | 3300013308 | Bacteria | 2573 |
| 84 | Ga0182008_10075272 | 3300014497 | Bacteria | 1661 |
| 85 | Ga0182008_10373925 | 3300014497 | Bacteria | 760 |
| 86 | Ga0157379_10749164 | 3300014968 | Bacteria | 919 |
| 87 | Ga0157376_10030962 | 3300014969 | Bacteria | 4279 |
| 88 | Ga0206354_10392503 | 3300020081 | Bacteria | 774 |
| 89 | Ga0206353_12024428 | 3300020082 | Bacteria | 1051 |
| 90 | Ga0207653_10052122 | 3300025885 | Bacteria | 1364 |
| 91 | Ga0207692_10001802 | 3300025898 | Bacteria | 8121 |
| 92 | Ga0207692_10011594 | 3300025898 | Bacteria | 3758 |
| 93 | Ga0207685_10002415 | 3300025905 | Bacteria | 4274 |
| 94 | Ga0207699_10013618 | 3300025906 | Bacteria | 4169 |
| 95 | Ga0207699_10184150 | 3300025906 | Bacteria | 1405 |
| 96 | Ga0207699_10240759 | 3300025906 | Bacteria | 1243 |
| 97 | Ga0207693_10001153 | 3300025915 | Bacteria | 23583 |
| 98 | Ga0207693_10005510 | 3300025915 | Bacteria | 10533 |
| 99 | Ga0207663_10007699 | 3300025916 | Bacteria | 5604 |
| 100 | Ga0207663_10560338 | 3300025916 | Bacteria | 894 |
| 101 | Ga0207657_10003855 | 3300025919 | Bacteria | 15925 |
| 102 | Ga0207652_10047416 | 3300025921 | Bacteria | 3670 |
| 103 | Ga0207646_10001749 | 3300025922 | Bacteria | 26367 |
| 104 | Ga0207646_10040720 | 3300025922 | Bacteria | 4178 |
| 105 | Ga0207646_10342347 | 3300025922 | Bacteria | 1351 |
| 106 | Ga0207646_10814076 | 3300025922 | Bacteria | 831 |
| 107 | Ga0207687_11270920 | 3300025927 | Bacteria | 633 |
| 108 | Ga0207700_10081589 | 3300025928 | Bacteria | 2526 |
| 109 | Ga0207700_10097104 | 3300025928 | Bacteria | 2341 |
| 110 | Ga0207664_10012447 | 3300025929 | Bacteria | 6083 |
| 111 | Ga0207664_10141853 | 3300025929 | Bacteria | 2033 |
| 112 | Ga0207664_10179045 | 3300025929 | Bacteria | 1819 |
| 113 | Ga0207664_10307709 | 3300025929 | Bacteria | 1396 |
| 114 | Ga0207664_10428100 | 3300025929 | Bacteria | 1179 |
| 115 | Ga0207664_10546016 | 3300025929 | Bacteria | 1040 |
| 116 | Ga0207690_10031594 | 3300025932 | Bacteria | 3390 |
| 117 | Ga0207665_10000298 | 3300025939 | Bacteria | 34286 |
| 118 | Ga0207665_10563838 | 3300025939 | Bacteria | 886 |
| 119 | Ga0207711_10306518 | 3300025941 | Bacteria | 1465 |
| 120 | Ga0207661_10279794 | 3300025944 | Bacteria | 1491 |
| 121 | Ga0207661_11280327 | 3300025944 | Bacteria | 674 |
| 122 | Ga0207679_10458691 | 3300025945 | Unclassified | 1131 |
| 123 | Ga0207639_10675300 | 3300026041 | Bacteria | 957 |
| 124 | Ga0207678_10326554 | 3300026067 | Bacteria | 1320 |
| 125 | Ga0207702_10100265 | 3300026078 | Bacteria | 2554 |
| 126 | Ga0207702_10119218 | 3300026078 | Bacteria | 2359 |
| 127 | Ga0207702_10136697 | 3300026078 | Bacteria | 2212 |
| 128 | Ga0207641_10589451 | 3300026088 | Bacteria | 1087 |
| 129 | Ga0207674_10099954 | 3300026116 | Bacteria | 2883 |
| 130 | Ga0265334_10006308 | 3300028573 | Bacteria | 5119 |
| 131 | Ga0265322_10086010 | 3300028654 | Bacteria | 893 |
| 132 | Ga0265336_10004130 | 3300028666 | Bacteria | 5530 |
| 133 | Ga0265336_10042062 | 3300028666 | Bacteria | 1395 |
| 134 | Ga0265338_10002936 | 3300028800 | Bacteria | 24729 |
| 135 | Ga0265338_10004663 | 3300028800 | Bacteria | 18409 |
| 136 | Ga0265338_10005415 | 3300028800 | Bacteria | 16665 |
| 137 | Ga0265338_10008744 | 3300028800 | Bacteria | 12242 |
| 138 | Ga0265338_10011028 | 3300028800 | Bacteria | 10493 |
| 139 | Ga0265338_10077857 | 3300028800 | Bacteria | 2800 |
| 140 | Ga0265338_10083785 | 3300028800 | Bacteria | 2665 |
| 141 | Ga0265338_10844998 | 3300028800 | Bacteria | 625 |
| 142 | Ga0265324_10010089 | 3300029957 | Bacteria | 3658 |
| 143 | Ga0265320_10072803 | 3300031240 | Bacteria | 1616 |
| 144 | Ga0265327_10035186 | 3300031251 | Bacteria | 2772 |
| 145 | Ga0265313_10034948 | 3300031595 | Bacteria | 2535 |
| 146 | Ga0265342_10039995 | 3300031712 | Bacteria | 2846 |
| 147 | Ga0265342_10068449 | 3300031712 | Bacteria | 2075 |
| 148 | Ga0373926_0014617 | 3300035083 | Bacteria | 2670 |
| 149 | Ga0373944_0011024 | 3300035089 | Bacteria | 2472 |
| 150 | Ga0373952_0147447 | 3300035092 | Bacteria | 658 |
| 151 | Ga0373936_0174960 | 3300035113 | Bacteria | 940 |
| 152 | Ga0373945_0006065 | 3300035116 | Bacteria | 3886 |
| 153 | Ga0373957_0045800 | 3300035120 | Bacteria | 1659 |
| 154 | Ga0373960_0018309 | 3300035121 | Bacteria | 1825 |
| 155 | Ga0373943_0000628 | 3300035170 | Bacteria | 15270 |
| 156 | Ga0373946_0048003 | 3300035171 | Bacteria | 1775 |
| 157 | Ga0373942_0172094 | 3300035207 | Unclassified | 706 |
| 158 | Ga0373961_0193943 | 3300035241 | Bacteria | 714 |
| 159 | Ga0373935_0021166 | 3300035692 | Bacteria | 3980 |
| 160 | Ga0373947_0004063 | 3300035725 | Bacteria | 8608 |
| 161 | Ga0373947_0441760 | 3300035725 | Bacteria | 881 |
| 162 | Ga0373947_0505267 | 3300035725 | Bacteria | 822 |
| 163 | Ga0373937_0000447 | 3300036401 | Bacteria | 38075 |
| 164 | Ga0373937_0141234 | 3300036401 | Bacteria | 2253 |
| 165 | Ga0395900_0361709 | 3300037418 | Bacteria | 1422 |
| 166 | Ga0395898_0008130 | 3300037466 | Bacteria | 11106 |
| 167 | Ga0395898_0998194 | 3300037466 | Bacteria | 773 |
| 168 | Ga0395901_0068108 | 3300038443 | Bacteria | 3708 |
| 169 | Ga0395901_0726623 | 3300038443 | Bacteria | 988 |
| 170 | Ga0436360_0831043 | 3300039438 | Bacteria | 12975 |
| 171 | Ga0436363_0881618 | 3300039450 | Bacteria | 893 |
| 172 | Ga0439448_0024394 | 3300042005 | Bacteria | 1891 |
| 173 | Ga0439459_0039731 | 3300042438 | Bacteria | 995 |
| 174 | Ga0466969_0003769 | 3300044656 | Bacteria | 8058 |
| 175 | Ga0466972_0342673 | 3300044658 | Bacteria | 699 |
| 176 | Ga0466965_0030986 | 3300044683 | Bacteria | 2607 |
| 177 | Ga0466966_0028895 | 3300044684 | Bacteria | 3610 |
| 178 | Ga0466966_0036603 | 3300044684 | Bacteria | 3168 |
| 179 | Ga0466966_0155680 | 3300044684 | Bacteria | 1392 |
| 180 | Ga0466961_0004522 | 3300044693 | Bacteria | 8722 |
| 181 | Ga0466961_0041602 | 3300044693 | Bacteria | 2946 |
| 182 | Ga0466961_0059672 | 3300044693 | Bacteria | 2425 |
| 183 | Ga0466963_0000137 | 3300044694 | Bacteria | 28326 |
| 184 | Ga0466963_0000632 | 3300044694 | Bacteria | 16887 |
| 185 | Ga0466963_0000741 | 3300044694 | Bacteria | 16079 |
| 186 | Ga0466963_0002688 | 3300044694 | Bacteria | 10010 |
| 187 | Ga0466963_0009551 | 3300044694 | Bacteria | 5843 |
| 188 | Ga0466963_0017815 | 3300044694 | Bacteria | 4432 |
| 189 | Ga0466963_0018829 | 3300044694 | Bacteria | 4323 |
| 190 | Ga0466963_0146673 | 3300044694 | Bacteria | 1637 |
| 191 | Ga0466963_0163942 | 3300044694 | Unclassified | 1548 |
| 192 | Ga0466963_0207022 | 3300044694 | Bacteria | 1372 |
| 193 | Ga0466963_0207571 | 3300044694 | Bacteria | 1370 |
| 194 | Ga0466963_0635637 | 3300044694 | Unclassified | 753 |
| 195 | Ga0466964_0006725 | 3300044706 | Bacteria | 4286 |
| 196 | Ga0466964_0011482 | 3300044706 | Bacteria | 3346 |
| 197 | Ga0466964_0040882 | 3300044706 | Bacteria | 1873 |
| 198 | Ga0466964_0045261 | 3300044706 | Bacteria | 1791 |
| 199 | Ga0466971_0001552 | 3300044719 | Bacteria | 9688 |
| 200 | Ga0466971_0011501 | 3300044719 | Bacteria | 3874 |
| 201 | Ga0466968_0006450 | 3300044735 | Bacteria | 4423 |
| 202 | Ga0466968_0007172 | 3300044735 | Bacteria | 4233 |
| 203 | Ga0466968_0090288 | 3300044735 | Bacteria | 1356 |
| 204 | Ga0466968_0374111 | 3300044735 | Bacteria | 695 |
| 205 | Ga0466970_0062868 | 3300044765 | Bacteria | 1990 |
| 206 | Ga0466957_0001689 | 3300044842 | Bacteria | 11606 |
| 207 | Ga0466957_0003049 | 3300044842 | Bacteria | 9108 |
| 208 | Ga0466957_0003662 | 3300044842 | Bacteria | 8480 |
| 209 | Ga0466957_0028712 | 3300044842 | Bacteria | 3313 |
| 210 | Ga0466957_0132902 | 3300044842 | Bacteria | 1596 |
| 211 | Ga0466957_0322207 | 3300044842 | Unclassified | 1043 |
| 212 | Ga0466960_0010750 | 3300044901 | Bacteria | 3809 |
| 213 | Ga0466960_0103536 | 3300044901 | Bacteria | 1469 |
| 214 | Ga0466959_0001767 | 3300045049 | Bacteria | 13474 |
| 215 | Ga0466959_0010806 | 3300045049 | Bacteria | 6543 |
| 216 | Ga0466959_0028028 | 3300045049 | Bacteria | 4176 |
| 217 | Ga0466959_0049810 | 3300045049 | Bacteria | 3077 |
| 218 | Ga0466959_0408742 | 3300045049 | Bacteria | 922 |
| 219 | Ga0466958_0002075 | 3300045836 | Bacteria | 9910 |
| 220 | Ga0466958_0004062 | 3300045836 | Bacteria | 7677 |
| 221 | Ga0466958_0005483 | 3300045836 | Bacteria | 6838 |
| 222 | Ga0466958_0007875 | 3300045836 | Bacteria | 5888 |
| 223 | Ga0466958_0010034 | 3300045836 | Bacteria | 5292 |
| 224 | Ga0466958_0057233 | 3300045836 | Bacteria | 2369 |
| 225 | Ga0466958_0201591 | 3300045836 | Bacteria | 1266 |
| 226 | Ga0466967_0000047 | 3300045976 | Bacteria | 43648 |
| 227 | Ga0466967_0000300 | 3300045976 | Bacteria | 22193 |
| 228 | Ga0466967_0002201 | 3300045976 | Bacteria | 11993 |
| 229 | Ga0466967_0003956 | 3300045976 | Bacteria | 9857 |
| 230 | Ga0466967_0010424 | 3300045976 | Bacteria | 6973 |
| 231 | Ga0466967_0016795 | 3300045976 | Bacteria | 5785 |
| 232 | Ga0466967_0019725 | 3300045976 | Bacteria | 5428 |
| 233 | Ga0466967_0020648 | 3300045976 | Bacteria | 5330 |
| 234 | Ga0466967_0054441 | 3300045976 | Bacteria | 3521 |
| 235 | Ga0466967_0057794 | 3300045976 | Bacteria | 3426 |
| 236 | Ga0466967_0089923 | 3300045976 | Bacteria | 2788 |
| 237 | Ga0466967_0090251 | 3300045976 | Bacteria | 2783 |
| 238 | Ga0466967_0137289 | 3300045976 | Bacteria | 2274 |
| 239 | Ga0466967_0174655 | 3300045976 | Bacteria | 2023 |
| 240 | Ga0466967_0311342 | 3300045976 | Bacteria | 1517 |
| 241 | Ga0466967_0346221 | 3300045976 | Bacteria | 1438 |
| 242 | Ga0466967_0624399 | 3300045976 | Bacteria | 1064 |
| 243 | Ga0495592_0000124 | 3300046454 | Bacteria | 68396 |
| 244 | Ga0495592_0002732 | 3300046454 | Bacteria | 12499 |
| 245 | Ga0495592_0068925 | 3300046454 | Unclassified | 2580 |
| 246 | Ga0495592_0118416 | 3300046454 | Unclassified | 1866 |
| 247 | Ga0495603_0066180 | 3300046455 | Bacteria | 2128 |
| 248 | Ga0495603_0320853 | 3300046455 | Bacteria | 889 |
| 249 | Ga0495629_0018947 | 3300046459 | Bacteria | 4922 |
| 250 | Ga0495629_0270777 | 3300046459 | Bacteria | 1166 |
| 251 | Ga0495641_0003398 | 3300046461 | Bacteria | 11936 |
| 252 | Ga0495641_0041073 | 3300046461 | Bacteria | 2149 |
| 253 | Ga0495641_0061125 | 3300046461 | Bacteria | 1701 |
| 254 | Ga0495641_0070324 | 3300046461 | Unclassified | 1572 |
| 255 | Ga0495641_0157653 | 3300046461 | Bacteria | 1015 |
| 256 | Ga0495641_0213381 | 3300046461 | Unclassified | 865 |
| 257 | Ga0495651_0000011 | 3300046462 | Bacteria | 147193 |
| 258 | Ga0495651_0054488 | 3300046462 | Bacteria | 3075 |
| 259 | Ga0495651_0090009 | 3300046462 | Bacteria | 2302 |
| 260 | Ga0495651_0229764 | 3300046462 | Bacteria | 1278 |
| 261 | Ga0495653_0005518 | 3300046463 | Bacteria | 10305 |
| 262 | Ga0495653_0040209 | 3300046463 | Bacteria | 3657 |
| 263 | Ga0495653_0048893 | 3300046463 | Bacteria | 3261 |
| 264 | Ga0495580_0006348 | 3300046472 | Bacteria | 9644 |
| 265 | Ga0495582_0017838 | 3300046473 | Bacteria | 3880 |
| 266 | Ga0495582_0070183 | 3300046473 | Unclassified | 1938 |
| 267 | Ga0495582_0110834 | 3300046473 | Bacteria | 1541 |
| 268 | Ga0495582_0285294 | 3300046473 | Bacteria | 948 |
| 269 | Ga0495639_0000291 | 3300046475 | Bacteria | 24492 |
| 270 | Ga0495664_0142701 | 3300046477 | Bacteria | 1452 |
| 271 | Ga0495664_0214867 | 3300046477 | Unclassified | 1164 |
| 272 | Ga0495585_0036223 | 3300046492 | Bacteria | 2785 |
| 273 | Ga0495594_0158374 | 3300046499 | Bacteria | 1286 |
| 274 | Ga0495596_0110675 | 3300046500 | Bacteria | 1066 |
| 275 | Ga0495608_0009377 | 3300046511 | Bacteria | 6843 |
| 276 | Ga0495608_0045032 | 3300046511 | Bacteria | 2943 |
| 277 | Ga0495608_0506111 | 3300046511 | Bacteria | 731 |
| 278 | Ga0495618_0002423 | 3300046514 | Bacteria | 11988 |
| 279 | Ga0495618_0052983 | 3300046514 | Bacteria | 2566 |
| 280 | Ga0495618_0082157 | 3300046514 | Bacteria | 2058 |
| 281 | Ga0495618_0106816 | 3300046514 | Bacteria | 1792 |
| 282 | Ga0495628_0000024 | 3300046516 | Bacteria | 130196 |
| 283 | Ga0495628_0053021 | 3300046516 | Bacteria | 3202 |
| 284 | Ga0495628_0471050 | 3300046516 | Bacteria | 910 |
| 285 | Ga0495630_0000631 | 3300046517 | Bacteria | 25489 |
| 286 | Ga0495630_0040376 | 3300046517 | Bacteria | 3487 |
| 287 | Ga0495630_0515757 | 3300046517 | Bacteria | 916 |
| 288 | Ga0495644_0011502 | 3300046523 | Bacteria | 3406 |
| 289 | Ga0495663_0053894 | 3300046525 | Bacteria | 1251 |
| 290 | Ga0495666_0000270 | 3300046526 | Bacteria | 22402 |
| 291 | Ga0495666_0068897 | 3300046526 | Bacteria | 1684 |
| 292 | Ga0495652_0000050 | 3300046529 | Bacteria | 120480 |
| 293 | Ga0495652_0004378 | 3300046529 | Bacteria | 13510 |
| 294 | Ga0495652_0058144 | 3300046529 | Bacteria | 3275 |
| 295 | Ga0495652_0071415 | 3300046529 | Unclassified | 2898 |
| 296 | Ga0495652_0880650 | 3300046529 | Bacteria | 592 |
| 297 | Ga0495665_0001487 | 3300046531 | Bacteria | 12555 |
| 298 | Ga0495640_0014623 | 3300046533 | Bacteria | 5930 |
| 299 | Ga0495640_0019213 | 3300046533 | Bacteria | 5047 |
| 300 | Ga0495640_0239909 | 3300046533 | Bacteria | 1138 |
| 301 | Ga0495586_0004266 | 3300046535 | Bacteria | 7645 |
| 302 | Ga0495586_0044620 | 3300046535 | Bacteria | 2388 |
| 303 | Ga0495587_0000084 | 3300046536 | Bacteria | 72926 |
| 304 | Ga0495587_0027639 | 3300046536 | Bacteria | 3454 |
| 305 | Ga0495587_0224272 | 3300046536 | Bacteria | 1060 |
| 306 | Ga0495587_0262865 | 3300046536 | Bacteria | 969 |
| 307 | Ga0495645_0000067 | 3300046543 | Bacteria | 73037 |
| 308 | Ga0495645_0035797 | 3300046543 | Bacteria | 3619 |
| 309 | Ga0495645_0090305 | 3300046543 | Bacteria | 2189 |
| 310 | Ga0495645_0577296 | 3300046543 | Bacteria | 694 |
| 311 | Ga0495667_0015940 | 3300046559 | Bacteria | 5080 |
| 312 | Ga0495667_0021882 | 3300046559 | Bacteria | 4311 |
| 313 | Ga0495667_0043339 | 3300046559 | Bacteria | 2982 |
| 314 | Ga0495656_0009318 | 3300046615 | Bacteria | 3527 |
| 315 | Ga0495634_0004560 | 3300046642 | Bacteria | 10823 |
| 316 | Ga0495634_0016205 | 3300046642 | Bacteria | 5333 |
| 317 | Ga0495634_0071949 | 3300046642 | Bacteria | 2275 |
| 318 | Ga0495634_0119578 | 3300046642 | Bacteria | 1687 |
| 319 | Ga0495634_0665678 | 3300046642 | Bacteria | 600 |
| 320 | Ga0495611_0027342 | 3300046648 | Bacteria | 2493 |
| 321 | Ga0495635_0006305 | 3300046663 | Bacteria | 8263 |
| 322 | Ga0495635_0013922 | 3300046663 | Bacteria | 5627 |
| 323 | Ga0495635_0014612 | 3300046663 | Bacteria | 5492 |
| 324 | Ga0495635_0258932 | 3300046663 | Bacteria | 1172 |
| 325 | Ga0495635_0350907 | 3300046663 | Bacteria | 984 |
| 326 | Ga0495657_0003575 | 3300046675 | Bacteria | 12645 |
| 327 | Ga0495657_0019913 | 3300046675 | Bacteria | 4834 |
| 328 | Ga0495657_0038051 | 3300046675 | Bacteria | 3312 |
| 329 | Ga0495657_0066898 | 3300046675 | Bacteria | 2360 |
| 330 | Ga0495657_0170515 | 3300046675 | Bacteria | 1340 |
| 331 | Ga0495657_0330402 | 3300046675 | Unclassified | 905 |
| 332 | Ga0495599_0000009 | 3300046678 | Bacteria | 217299 |
| 333 | Ga0495599_0177871 | 3300046678 | Bacteria | 1312 |
| 334 | Ga0495599_0199096 | 3300046678 | Bacteria | 1230 |
| 335 | Ga0495623_0000219 | 3300046679 | Bacteria | 36687 |
| 336 | Ga0495623_0042995 | 3300046679 | Bacteria | 2876 |
| 337 | Ga0495623_0098426 | 3300046679 | Unclassified | 1785 |
| 338 | Ga0495623_0294555 | 3300046679 | Bacteria | 899 |
| 339 | Ga0495623_0475930 | 3300046679 | Bacteria | 662 |
| 340 | Ga0495646_0024086 | 3300046680 | Bacteria | 3833 |
| 341 | Ga0495646_0185549 | 3300046680 | Bacteria | 1139 |
| 342 | Ga0495647_0000243 | 3300046681 | Bacteria | 14906 |
| 343 | Ga0495647_0046477 | 3300046681 | Bacteria | 1672 |
| 344 | Ga0495658_0000970 | 3300046683 | Bacteria | 15222 |
| 345 | Ga0495658_0019086 | 3300046683 | Bacteria | 3575 |
| 346 | Ga0495658_0108632 | 3300046683 | Bacteria | 1665 |
| 347 | Ga0495613_0022344 | 3300046689 | Bacteria | 4714 |
| 348 | Ga0495613_0059925 | 3300046689 | Bacteria | 2788 |
| 349 | Ga0495613_0634777 | 3300046689 | Unclassified | 708 |
| 350 | Ga0495624_0001273 | 3300046690 | Bacteria | 19870 |
| 351 | Ga0495624_0044964 | 3300046690 | Bacteria | 2813 |
| 352 | Ga0495624_0060502 | 3300046690 | Bacteria | 2374 |
| 353 | Ga0495670_0060695 | 3300046691 | Bacteria | 1900 |
| 354 | Ga0495589_0047622 | 3300046794 | Bacteria | 2124 |
| 355 | Ga0495600_0036851 | 3300046809 | Bacteria | 3179 |
| 356 | Ga0495581_0000258 | 3300047315 | Bacteria | 25364 |
| 357 | Ga0495581_0029612 | 3300047315 | Bacteria | 3173 |
| 358 | Ga0495604_0000334 | 3300047317 | Bacteria | 42026 |
| 359 | Ga0495604_0485290 | 3300047317 | Bacteria | 803 |
| 360 | Ga0495674_0004337 | 3300047319 | Bacteria | 13635 |
| 361 | Ga0495674_0036575 | 3300047319 | Bacteria | 4418 |
| 362 | Ga0495674_0105724 | 3300047319 | Bacteria | 2391 |
| 363 | Ga0495674_0278131 | 3300047319 | Bacteria | 1372 |
| 364 | Ga0495676_0158421 | 3300047321 | Bacteria | 1604 |
| 365 | Ga0495676_0303617 | 3300047321 | Unclassified | 1076 |
| 366 | Ga0495676_0404521 | 3300047321 | Bacteria | 905 |
| 367 | Ga0495680_0001263 | 3300047322 | Bacteria | 27605 |
| 368 | Ga0495680_0002837 | 3300047322 | Bacteria | 17416 |
| 369 | Ga0495680_0018640 | 3300047322 | Bacteria | 5882 |
| 370 | Ga0495680_0159727 | 3300047322 | Bacteria | 1637 |
| 371 | Ga0495680_0405500 | 3300047322 | Bacteria | 940 |
| 372 | Ga0495675_0000972 | 3300047444 | Bacteria | 17397 |
| 373 | Ga0495675_0089444 | 3300047444 | Bacteria | 1933 |
| 374 | Ga0495675_0096899 | 3300047444 | Bacteria | 1849 |
| 375 | Ga0495675_0193179 | 3300047444 | Unclassified | 1242 |
| 376 | Ga0495675_0594559 | 3300047444 | Bacteria | 628 |
| 377 | Ga0495684_0007604 | 3300047471 | Bacteria | 8385 |
| 378 | Ga0495684_0030087 | 3300047471 | Bacteria | 4168 |
| 379 | Ga0495684_0051951 | 3300047471 | Bacteria | 3127 |
| 380 | Ga0495684_0061022 | 3300047471 | Bacteria | 2869 |
| 381 | Ga0495684_0107303 | 3300047471 | Bacteria | 2109 |
| 382 | Ga0495684_0469450 | 3300047471 | Bacteria | 871 |
| 383 | Ga0495593_0000732 | 3300047673 | Bacteria | 19043 |
| 384 | Ga0495602_0000234 | 3300048088 | Bacteria | 51947 |
| 385 | Ga0495602_0085890 | 3300048088 | Bacteria | 2628 |
| 386 | Ga0495602_0125431 | 3300048088 | Unclassified | 2058 |
| 387 | Ga0495614_0000557 | 3300048089 | Bacteria | 15456 |
| 388 | Ga0496100_0164744 | 3300048903 | Bacteria | 1591 |
| 389 | Ga0496100_0354475 | 3300048903 | Bacteria | 1109 |
| 390 | Ga0496101_0022901 | 3300048904 | Bacteria | 4308 |
| 391 | Ga0496101_0041713 | 3300048904 | Bacteria | 3273 |
| 392 | Ga0496101_0057073 | 3300048904 | Bacteria | 2823 |
| 393 | Ga0496101_0102851 | 3300048904 | Bacteria | 2140 |
| 394 | Ga0496101_0753848 | 3300048904 | Bacteria | 768 |
| 395 | Ga0496102_0206464 | 3300048905 | Bacteria | 1852 |
| 396 | Ga0496102_0251487 | 3300048905 | Bacteria | 1666 |
| 397 | Ga0496102_0717230 | 3300048905 | Bacteria | 923 |
| 398 | Ga0496103_0011428 | 3300048906 | Bacteria | 5262 |
| 399 | Ga0496103_0141983 | 3300048906 | Bacteria | 1536 |
| 400 | Ga0496104_0018025 | 3300048907 | Bacteria | 6437 |
| 401 | Ga0496104_0089334 | 3300048907 | Bacteria | 2943 |
| 402 | Ga0496104_0156900 | 3300048907 | Bacteria | 2184 |
| 403 | Ga0496104_0172353 | 3300048907 | Bacteria | 2074 |
| 404 | Ga0496105_0002794 | 3300048908 | Bacteria | 12764 |
| 405 | Ga0496105_0004249 | 3300048908 | Bacteria | 10772 |
| 406 | Ga0496105_0068741 | 3300048908 | Bacteria | 2926 |
| 407 | Ga0496105_0112668 | 3300048908 | Bacteria | 2245 |
| 408 | Ga0496105_0156572 | 3300048908 | Bacteria | 1871 |
| 409 | Ga0496106_0011451 | 3300048909 | Bacteria | 6561 |
| 410 | Ga0496106_0022799 | 3300048909 | Bacteria | 4650 |
| 411 | Ga0496107_0001150 | 3300048910 | Bacteria | 16019 |
| 412 | Ga0496107_0001783 | 3300048910 | Bacteria | 13566 |
| 413 | Ga0496107_0049541 | 3300048910 | Bacteria | 3027 |
| 414 | Ga0496108_0002204 | 3300048911 | Bacteria | 15597 |
| 415 | Ga0496108_0013097 | 3300048911 | Bacteria | 6760 |
| 416 | Ga0496108_0024322 | 3300048911 | Bacteria | 4985 |
| 417 | Ga0496108_0059428 | 3300048911 | Bacteria | 3214 |
| 418 | Ga0496108_0455061 | 3300048911 | Bacteria | 1118 |
| 419 | Ga0496109_0116607 | 3300048912 | Bacteria | 2485 |
| 420 | Ga0496109_0165154 | 3300048912 | Bacteria | 2075 |
| 421 | Ga0496110_0012547 | 3300048913 | Bacteria | 6969 |
| 422 | Ga0496110_0151330 | 3300048913 | Bacteria | 2101 |
| 423 | Ga0496111_0005755 | 3300048914 | Bacteria | 8000 |
| 424 | Ga0496111_0161576 | 3300048914 | Bacteria | 1663 |
| 425 | Ga0496111_0937263 | 3300048914 | Unclassified | 622 |
| 426 | Ga0496112_0131927 | 3300048915 | Bacteria | 2469 |
| 427 | Ga0496112_0236360 | 3300048915 | Bacteria | 1781 |
| 428 | Ga0496112_0309657 | 3300048915 | Bacteria | 1524 |
| 429 | Ga0496112_0642496 | 3300048915 | Bacteria | 991 |
| 430 | Ga0496113_0041850 | 3300048916 | Bacteria | 3383 |
| 431 | Ga0496113_0333993 | 3300048916 | Bacteria | 1215 |
| 432 | Ga0496113_0546066 | 3300048916 | Bacteria | 929 |
| 433 | Ga0496114_0012709 | 3300048917 | Bacteria | 6744 |
| 434 | Ga0496114_0014142 | 3300048917 | Bacteria | 6399 |
| 435 | Ga0496115_0011946 | 3300048918 | Bacteria | 6522 |
| 436 | Ga0496115_0020286 | 3300048918 | Bacteria | 5126 |
| 437 | nmdc:mga0n895_93477_c1 | 3300050512 | Bacteria | 3011 |
| 438 | nmdc:mga0rr50_1120557_c1 | 3300050513 | Bacteria | 669 |
| 439 | nmdc:mga0a205_277757_c1 | 3300050515 | Bacteria | 1551 |
| 440 | Ga0495601_0002020 | 3300053077 | Bacteria | 11388 |
| 441 | Ga0495601_0006407 | 3300053077 | Bacteria | 6882 |
| 442 | Ga0495601_0019609 | 3300053077 | Bacteria | 4125 |
| 443 | Ga0495601_0075806 | 3300053077 | Unclassified | 2153 |
| 444 | Ga0495612_0014189 | 3300053078 | Bacteria | 3206 |
| 445 | Ga0495612_0027373 | 3300053078 | Bacteria | 2292 |
| 446 | Ga0495612_0067723 | 3300053078 | Bacteria | 1485 |
| 447 | Ga0495655_0016166 | 3300053083 | Bacteria | 1602 |
| 448 | Ga0495595_0003079 | 3300053084 | Bacteria | 6595 |
| 449 | Ga0495595_0005410 | 3300053084 | Bacteria | 5172 |
| 450 | Ga0495595_0024174 | 3300053084 | Bacteria | 2682 |
| 451 | Ga0495595_0043939 | 3300053084 | Bacteria | 2051 |
| 452 | Ga0495595_0056091 | 3300053084 | Bacteria | 1835 |
| 453 | Ga0495619_0001368 | 3300053085 | Bacteria | 16040 |
| 454 | Ga0495619_0001604 | 3300053085 | Bacteria | 14872 |
| 455 | Ga0495619_0031532 | 3300053085 | Bacteria | 3434 |
| 456 | Ga0495619_0082549 | 3300053085 | Bacteria | 2166 |
| 457 | Ga0495619_0189282 | 3300053085 | Bacteria | 1424 |
| 458 | Ga0500566_0004146 | 3300053094 | Bacteria | 8645 |
| 459 | Ga0466962_0012591 | 3300061719 | Bacteria | 4069 |
| 460 | Ga0207695_10559624 | |||
| 461 | Ga0070658_10048704 | |||
| 462 | Ga0070683_100077033 | |||
| 463 | Ga0070683_100349211 | |||
| 464 | Ga0070683_101232145 | |||
| 465 | Ga0070680_100051216 | |||
| 466 | Ga0070680_100083768 | |||
| 467 | Ga0070682_100152768 | |||
| 468 | Ga0068868_100134423 | |||
| 469 | Ga0068868_100884850 | |||
| 470 | Ga0070660_100008244 | |||
| 471 | Ga0070687_100360738 | |||
| 472 | Ga0070661_100014019 | |||
| 473 | Ga0070671_100097752 | |||
| 474 | Ga0070671_100183073 | |||
| 475 | Ga0070703_10066499 | |||
| 476 | Ga0070709_10008850 | |||
| 477 | Ga0070709_10010287 | |||
| 478 | Ga0070714_100004653 | |||
| 479 | Ga0070714_100030993 | |||
| 480 | Ga0070714_100033375 | |||
| 481 | Ga0070714_100053762 | |||
| 482 | Ga0070714_100252025 | |||
| 483 | Ga0070714_101027067 | |||
| 484 | Ga0070713_100003675 | |||
| 485 | Ga0070713_100107884 | |||
| 486 | Ga0070710_10002865 | |||
| 487 | Ga0070711_100010102 | |||
| 488 | Ga0070711_100061829 | |||
| 489 | Ga0070711_100306987 | |||
| 490 | Ga0070663_100489438 | |||
| 491 | Ga0070681_10003595 | |||
| 492 | Ga0070681_10013434 | |||
| 493 | Ga0070685_10308821 | |||
| 494 | Ga0070707_100000633 | |||
| 495 | Ga0070707_100052628 | |||
| 496 | Ga0070707_100242761 | |||
| 497 | Ga0070698_100068513 | |||
| 498 | Ga0070698_100326436 | |||
| 499 | Ga0070698_100336487 | |||
| 500 | Ga0070698_100589745 | |||
| 501 | Ga0070699_100449024 | |||
| 502 | Ga0070679_100079465 | |||
| 503 | Ga0070684_100031649 | |||
| 504 | Ga0070704_100209331 | |||
| 505 | Ga0068855_100105521 | |||
| 506 | Ga0070664_100355626 | |||
| 507 | Ga0070664_100845414 | |||
| 508 | Ga0068856_100033958 | |||
| 509 | Ga0068856_100087922 | |||
| 510 | Ga0068856_100200584 | |||
| 511 | Ga0068864_101845923 | |||
| 512 | Ga0068863_100418566 | |||
| 513 | Ga0070717_10014842 | |||
| 514 | Ga0070717_10027009 | |||
| 515 | Ga0070717_10335870 | |||
| 516 | Ga0070717_10475523 | |||
| 517 | Ga0070717_10575789 | |||
| 518 | Ga0070717_10707277 | |||
| 519 | Ga0070715_10000701 | |||
| 520 | Ga0070716_100001043 | |||
| 521 | Ga0070716_100107271 | |||
| 522 | Ga0070716_100432256 | |||
| 523 | Ga0070712_100328553 | |||
| 524 | Ga0070712_100359003 | |||
| 525 | Ga0097621_100282853 | |||
| 526 | Ga0075433_10285354 | |||
| 527 | Ga0075434_100009519 | |||
| 528 | Ga0075435_101020081 | |||
| 529 | Ga0105240_10288175 | |||
| 530 | Ga0105240_10502732 | |||
| 531 | Ga0105245_10090770 | |||
| 532 | Ga0105247_10027858 | |||
| 533 | Ga0105241_10602163 | |||
| 534 | Ga0105248_10360621 | |||
| 535 | Ga0105237_10632372 | |||
| 536 | Ga0105238_10383407 | |||
| 537 | Ga0105238_10407726 | |||
| 538 | Ga0157369_10031406 | |||
| 539 | Ga0157369_10258371 | |||
| 540 | Ga0157374_10022751 | |||
| 541 | Ga0157372_10082283 | |||
| 542 | Ga0157375_10137041 | |||
| 543 | Ga0182008_10075272 | |||
| 544 | Ga0182008_10373925 | |||
| 545 | Ga0157379_10749164 | |||
| 546 | Ga0157376_10030962 | |||
| 547 | Ga0206354_10392503 | |||
| 548 | Ga0206353_12024428 | |||
| 549 | Ga0207653_10052122 | |||
| 550 | Ga0207692_10001802 | |||
| 551 | Ga0207692_10011594 | |||
| 552 | Ga0207685_10002415 | |||
| 553 | Ga0207699_10013618 | |||
| 554 | Ga0207699_10184150 | |||
| 555 | Ga0207699_10240759 | |||
| 556 | Ga0207693_10001153 | |||
| 557 | Ga0207693_10005510 | |||
| 558 | Ga0207663_10007699 | |||
| 559 | Ga0207663_10560338 | |||
| 560 | Ga0207657_10003855 | |||
| 561 | Ga0207652_10047416 | |||
| 562 | Ga0207646_10001749 | |||
| 563 | Ga0207646_10040720 | |||
| 564 | Ga0207646_10342347 | |||
| 565 | Ga0207646_10814076 | |||
| 566 | Ga0207687_11270920 | |||
| 567 | Ga0207700_10081589 | |||
| 568 | Ga0207700_10097104 | |||
| 569 | Ga0207664_10012447 | |||
| 570 | Ga0207664_10141853 | |||
| 571 | Ga0207664_10179045 | |||
| 572 | Ga0207664_10307709 | |||
| 573 | Ga0207664_10428100 | |||
| 574 | Ga0207664_10546016 | |||
| 575 | Ga0207690_10031594 | |||
| 576 | Ga0207665_10000298 | |||
| 577 | Ga0207665_10563838 | |||
| 578 | Ga0207711_10306518 | |||
| 579 | Ga0207661_10279794 | |||
| 580 | Ga0207661_11280327 | |||
| 581 | Ga0207679_10458691 | |||
| 582 | Ga0207639_10675300 | |||
| 583 | Ga0207678_10326554 | |||
| 584 | Ga0207702_10100265 | |||
| 585 | Ga0207702_10119218 | |||
| 586 | Ga0207702_10136697 | |||
| 587 | Ga0207641_10589451 | |||
| 588 | Ga0207674_10099954 | |||
| 589 | Ga0265334_10006308 | |||
| 590 | Ga0265322_10086010 | |||
| 591 | Ga0265336_10004130 | |||
| 592 | Ga0265336_10042062 | |||
| 593 | Ga0265338_10002936 | |||
| 594 | Ga0265338_10004663 | |||
| 595 | Ga0265338_10005415 | |||
| 596 | Ga0265338_10008744 | |||
| 597 | Ga0265338_10011028 | |||
| 598 | Ga0265338_10077857 | |||
| 599 | Ga0265338_10083785 | |||
| 600 | Ga0265338_10844998 | |||
| 601 | Ga0265324_10010089 | |||
| 602 | Ga0265320_10072803 | |||
| 603 | Ga0265327_10035186 | |||
| 604 | Ga0265313_10034948 | |||
| 605 | Ga0265342_10039995 | |||
| 606 | Ga0265342_10068449 | |||
| 607 | Ga0373926_0014617 | |||
| 608 | Ga0373944_0011024 | |||
| 609 | Ga0373952_0147447 | |||
| 610 | Ga0373936_0174960 | |||
| 611 | Ga0373945_0006065 | |||
| 612 | Ga0373957_0045800 | |||
| 613 | Ga0373960_0018309 | |||
| 614 | Ga0373943_0000628 | |||
| 615 | Ga0373946_0048003 | |||
| 616 | Ga0373942_0172094 | |||
| 617 | Ga0373961_0193943 | |||
| 618 | Ga0373935_0021166 | |||
| 619 | Ga0373947_0004063 | |||
| 620 | Ga0373947_0441760 | |||
| 621 | Ga0373947_0505267 | |||
| 622 | Ga0373937_0000447 | |||
| 623 | Ga0373937_0141234 | |||
| 624 | Ga0395900_0361709 | |||
| 625 | Ga0395898_0008130 | |||
| 626 | Ga0395898_0998194 | |||
| 627 | Ga0395901_0068108 | |||
| 628 | Ga0395901_0726623 | |||
| 629 | Ga0436360_0831043 | |||
| 630 | Ga0436363_0881618 | |||
| 631 | Ga0439448_0024394 | |||
| 632 | Ga0439459_0039731 | |||
| 633 | Ga0466969_0003769 | |||
| 634 | Ga0466972_0342673 | |||
| 635 | Ga0466965_0030986 | |||
| 636 | Ga0466966_0028895 | |||
| 637 | Ga0466966_0036603 | |||
| 638 | Ga0466966_0155680 | |||
| 639 | Ga0466961_0004522 | |||
| 640 | Ga0466961_0041602 | |||
| 641 | Ga0466961_0059672 | |||
| 642 | Ga0466963_0000137 | |||
| 643 | Ga0466963_0000632 | |||
| 644 | Ga0466963_0000741 | |||
| 645 | Ga0466963_0002688 | |||
| 646 | Ga0466963_0009551 | |||
| 647 | Ga0466963_0017815 | |||
| 648 | Ga0466963_0018829 | |||
| 649 | Ga0466963_0146673 | |||
| 650 | Ga0466963_0163942 | |||
| 651 | Ga0466963_0207022 | |||
| 652 | Ga0466963_0207571 | |||
| 653 | Ga0466963_0635637 | |||
| 654 | Ga0466964_0006725 | |||
| 655 | Ga0466964_0011482 | |||
| 656 | Ga0466964_0040882 | |||
| 657 | Ga0466964_0045261 | |||
| 658 | Ga0466971_0001552 | |||
| 659 | Ga0466971_0011501 | |||
| 660 | Ga0466968_0006450 | |||
| 661 | Ga0466968_0007172 | |||
| 662 | Ga0466968_0090288 | |||
| 663 | Ga0466968_0374111 | |||
| 664 | Ga0466970_0062868 | |||
| 665 | Ga0466957_0001689 | |||
| 666 | Ga0466957_0003049 | |||
| 667 | Ga0466957_0003662 | |||
| 668 | Ga0466957_0028712 | |||
| 669 | Ga0466957_0132902 | |||
| 670 | Ga0466957_0322207 | |||
| 671 | Ga0466960_0010750 | |||
| 672 | Ga0466960_0103536 | |||
| 673 | Ga0466959_0001767 | |||
| 674 | Ga0466959_0010806 | |||
| 675 | Ga0466959_0028028 | |||
| 676 | Ga0466959_0049810 | |||
| 677 | Ga0466959_0408742 | |||
| 678 | Ga0466958_0002075 | |||
| 679 | Ga0466958_0004062 | |||
| 680 | Ga0466958_0005483 | |||
| 681 | Ga0466958_0007875 | |||
| 682 | Ga0466958_0010034 | |||
| 683 | Ga0466958_0057233 | |||
| 684 | Ga0466958_0201591 | |||
| 685 | Ga0466967_0000047 | |||
| 686 | Ga0466967_0000300 | |||
| 687 | Ga0466967_0002201 | |||
| 688 | Ga0466967_0003956 | |||
| 689 | Ga0466967_0010424 | |||
| 690 | Ga0466967_0016795 | |||
| 691 | Ga0466967_0019725 | |||
| 692 | Ga0466967_0020648 | |||
| 693 | Ga0466967_0054441 | |||
| 694 | Ga0466967_0057794 | |||
| 695 | Ga0466967_0089923 | |||
| 696 | Ga0466967_0090251 | |||
| 697 | Ga0466967_0137289 | |||
| 698 | Ga0466967_0174655 | |||
| 699 | Ga0466967_0311342 | |||
| 700 | Ga0466967_0346221 | |||
| 701 | Ga0466967_0624399 | |||
| 702 | Ga0495592_0000124 | |||
| 703 | Ga0495592_0002732 | |||
| 704 | Ga0495592_0068925 | |||
| 705 | Ga0495592_0118416 | |||
| 706 | Ga0495603_0066180 | |||
| 707 | Ga0495603_0320853 | |||
| 708 | Ga0495629_0018947 | |||
| 709 | Ga0495629_0270777 | |||
| 710 | Ga0495641_0003398 | |||
| 711 | Ga0495641_0041073 | |||
| 712 | Ga0495641_0061125 | |||
| 713 | Ga0495641_0070324 | |||
| 714 | Ga0495641_0157653 | |||
| 715 | Ga0495641_0213381 | |||
| 716 | Ga0495651_0000011 | |||
| 717 | Ga0495651_0054488 | |||
| 718 | Ga0495651_0090009 | |||
| 719 | Ga0495651_0229764 | |||
| 720 | Ga0495653_0005518 | |||
| 721 | Ga0495653_0040209 | |||
| 722 | Ga0495653_0048893 | |||
| 723 | Ga0495580_0006348 | |||
| 724 | Ga0495582_0017838 | |||
| 725 | Ga0495582_0070183 | |||
| 726 | Ga0495582_0110834 | |||
| 727 | Ga0495582_0285294 | |||
| 728 | Ga0495639_0000291 | |||
| 729 | Ga0495664_0142701 | |||
| 730 | Ga0495664_0214867 | |||
| 731 | Ga0495585_0036223 | |||
| 732 | Ga0495594_0158374 | |||
| 733 | Ga0495596_0110675 | |||
| 734 | Ga0495608_0009377 | |||
| 735 | Ga0495608_0045032 | |||
| 736 | Ga0495608_0506111 | |||
| 737 | Ga0495618_0002423 | |||
| 738 | Ga0495618_0052983 | |||
| 739 | Ga0495618_0082157 | |||
| 740 | Ga0495618_0106816 | |||
| 741 | Ga0495628_0000024 | |||
| 742 | Ga0495628_0053021 | |||
| 743 | Ga0495628_0471050 | |||
| 744 | Ga0495630_0000631 | |||
| 745 | Ga0495630_0040376 | |||
| 746 | Ga0495630_0515757 | |||
| 747 | Ga0495644_0011502 | |||
| 748 | Ga0495663_0053894 | |||
| 749 | Ga0495666_0000270 | |||
| 750 | Ga0495666_0068897 | |||
| 751 | Ga0495652_0000050 | |||
| 752 | Ga0495652_0004378 | |||
| 753 | Ga0495652_0058144 | |||
| 754 | Ga0495652_0071415 | |||
| 755 | Ga0495652_0880650 | |||
| 756 | Ga0495665_0001487 | |||
| 757 | Ga0495640_0014623 | |||
| 758 | Ga0495640_0019213 | |||
| 759 | Ga0495640_0239909 | |||
| 760 | Ga0495586_0004266 | |||
| 761 | Ga0495586_0044620 | |||
| 762 | Ga0495587_0000084 | |||
| 763 | Ga0495587_0027639 | |||
| 764 | Ga0495587_0224272 | |||
| 765 | Ga0495587_0262865 | |||
| 766 | Ga0495645_0000067 | |||
| 767 | Ga0495645_0035797 | |||
| 768 | Ga0495645_0090305 | |||
| 769 | Ga0495645_0577296 | |||
| 770 | Ga0495667_0015940 | |||
| 771 | Ga0495667_0021882 | |||
| 772 | Ga0495667_0043339 | |||
| 773 | Ga0495656_0009318 | |||
| 774 | Ga0495634_0004560 | |||
| 775 | Ga0495634_0016205 | |||
| 776 | Ga0495634_0071949 | |||
| 777 | Ga0495634_0119578 | |||
| 778 | Ga0495634_0665678 | |||
| 779 | Ga0495611_0027342 | |||
| 780 | Ga0495635_0006305 | |||
| 781 | Ga0495635_0013922 | |||
| 782 | Ga0495635_0014612 | |||
| 783 | Ga0495635_0258932 | |||
| 784 | Ga0495635_0350907 | |||
| 785 | Ga0495657_0003575 | |||
| 786 | Ga0495657_0019913 | |||
| 787 | Ga0495657_0038051 | |||
| 788 | Ga0495657_0066898 | |||
| 789 | Ga0495657_0170515 | |||
| 790 | Ga0495657_0330402 | |||
| 791 | Ga0495599_0000009 | |||
| 792 | Ga0495599_0177871 | |||
| 793 | Ga0495599_0199096 | |||
| 794 | Ga0495623_0000219 | |||
| 795 | Ga0495623_0042995 | |||
| 796 | Ga0495623_0098426 | |||
| 797 | Ga0495623_0294555 | |||
| 798 | Ga0495623_0475930 | |||
| 799 | Ga0495646_0024086 | |||
| 800 | Ga0495646_0185549 | |||
| 801 | Ga0495647_0000243 | |||
| 802 | Ga0495647_0046477 | |||
| 803 | Ga0495658_0000970 | |||
| 804 | Ga0495658_0019086 | |||
| 805 | Ga0495658_0108632 | |||
| 806 | Ga0495613_0022344 | |||
| 807 | Ga0495613_0059925 | |||
| 808 | Ga0495613_0634777 | |||
| 809 | Ga0495624_0001273 | |||
| 810 | Ga0495624_0044964 | |||
| 811 | Ga0495624_0060502 | |||
| 812 | Ga0495670_0060695 | |||
| 813 | Ga0495589_0047622 | |||
| 814 | Ga0495600_0036851 | |||
| 815 | Ga0495581_0000258 | |||
| 816 | Ga0495581_0029612 | |||
| 817 | Ga0495604_0000334 | |||
| 818 | Ga0495604_0485290 | |||
| 819 | Ga0495674_0004337 | |||
| 820 | Ga0495674_0036575 | |||
| 821 | Ga0495674_0105724 | |||
| 822 | Ga0495674_0278131 | |||
| 823 | Ga0495676_0158421 | |||
| 824 | Ga0495676_0303617 | |||
| 825 | Ga0495676_0404521 | |||
| 826 | Ga0495680_0001263 | |||
| 827 | Ga0495680_0002837 | |||
| 828 | Ga0495680_0018640 | |||
| 829 | Ga0495680_0159727 | |||
| 830 | Ga0495680_0405500 | |||
| 831 | Ga0495675_0000972 | |||
| 832 | Ga0495675_0089444 | |||
| 833 | Ga0495675_0096899 | |||
| 834 | Ga0495675_0193179 | |||
| 835 | Ga0495675_0594559 | |||
| 836 | Ga0495684_0007604 | |||
| 837 | Ga0495684_0030087 | |||
| 838 | Ga0495684_0051951 | |||
| 839 | Ga0495684_0061022 | |||
| 840 | Ga0495684_0107303 | |||
| 841 | Ga0495684_0469450 | |||
| 842 | Ga0495593_0000732 | |||
| 843 | Ga0495602_0000234 | |||
| 844 | Ga0495602_0085890 | |||
| 845 | Ga0495602_0125431 | |||
| 846 | Ga0495614_0000557 | |||
| 847 | Ga0496100_0164744 | |||
| 848 | Ga0496100_0354475 | |||
| 849 | Ga0496101_0022901 | |||
| 850 | Ga0496101_0041713 | |||
| 851 | Ga0496101_0057073 | |||
| 852 | Ga0496101_0102851 | |||
| 853 | Ga0496101_0753848 | |||
| 854 | Ga0496102_0206464 | |||
| 855 | Ga0496102_0251487 | |||
| 856 | Ga0496102_0717230 | |||
| 857 | Ga0496103_0011428 | |||
| 858 | Ga0496103_0141983 | |||
| 859 | Ga0496104_0018025 | |||
| 860 | Ga0496104_0089334 | |||
| 861 | Ga0496104_0156900 | |||
| 862 | Ga0496104_0172353 | |||
| 863 | Ga0496105_0002794 | |||
| 864 | Ga0496105_0004249 | |||
| 865 | Ga0496105_0068741 | |||
| 866 | Ga0496105_0112668 | |||
| 867 | Ga0496105_0156572 | |||
| 868 | Ga0496106_0011451 | |||
| 869 | Ga0496106_0022799 | |||
| 870 | Ga0496107_0001150 | |||
| 871 | Ga0496107_0001783 | |||
| 872 | Ga0496107_0049541 | |||
| 873 | Ga0496108_0002204 | |||
| 874 | Ga0496108_0013097 | |||
| 875 | Ga0496108_0024322 | |||
| 876 | Ga0496108_0059428 | |||
| 877 | Ga0496108_0455061 | |||
| 878 | Ga0496109_0116607 | |||
| 879 | Ga0496109_0165154 | |||
| 880 | Ga0496110_0012547 | |||
| 881 | Ga0496110_0151330 | |||
| 882 | Ga0496111_0005755 | |||
| 883 | Ga0496111_0161576 | |||
| 884 | Ga0496111_0937263 | |||
| 885 | Ga0496112_0131927 | |||
| 886 | Ga0496112_0236360 | |||
| 887 | Ga0496112_0309657 | |||
| 888 | Ga0496112_0642496 | |||
| 889 | Ga0496113_0041850 | |||
| 890 | Ga0496113_0333993 | |||
| 891 | Ga0496113_0546066 | |||
| 892 | Ga0496114_0012709 | |||
| 893 | Ga0496114_0014142 | |||
| 894 | Ga0496115_0011946 | |||
| 895 | Ga0496115_0020286 | |||
| 896 | nmdc:mga0n895_93477_c1 | |||
| 897 | nmdc:mga0rr50_1120557_c1 | |||
| 898 | nmdc:mga0a205_277757_c1 | |||
| 899 | Ga0495601_0002020 | |||
| 900 | Ga0495601_0006407 | |||
| 901 | Ga0495601_0019609 | |||
| 902 | Ga0495601_0075806 | |||
| 903 | Ga0495612_0014189 | |||
| 904 | Ga0495612_0027373 | |||
| 905 | Ga0495612_0067723 | |||
| 906 | Ga0495655_0016166 | |||
| 907 | Ga0495595_0003079 | |||
| 908 | Ga0495595_0005410 | |||
| 909 | Ga0495595_0024174 | |||
| 910 | Ga0495595_0043939 | |||
| 911 | Ga0495595_0056091 | |||
| 912 | Ga0495619_0001368 | |||
| 913 | Ga0495619_0001604 | |||
| 914 | Ga0495619_0031532 | |||
| 915 | Ga0495619_0082549 | |||
| 916 | Ga0495619_0189282 | |||
| 917 | Ga0500566_0004146 | |||
| 918 | Ga0466962_0012591 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2h1a-assembly1.cif.gz_A | resa c74a variant | 0.9422 | 39 | 176 |
| 3gl3-assembly1.cif.gz_A | crystal structure of a putative thiol:disulfide interchange protein dsbe from chlorobium tepidum | 0.9402 | 34 | 178 |
| 4nmu-assembly2.cif.gz_B | crystal structure of thiol-disulfide oxidoreductase from bacillus str. 'ames ancestor' | 0.937 | 36 | 178 |
| 3gl3-assembly1.cif.gz_A | crystal structure of a putative thiol:disulfide interchange protein dsbe from chlorobium tepidum | 0.9339 | 34 | 178 |
| 3ios-assembly1.cif.gz_A | structure of mtb dsbf in its mixed oxidized and reduced forms | 0.9294 | 44 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3iosA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9294 | 44 | 176 | 3.40.30.10 |
| 1st9A00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9293 | 38 | 173 | 3.40.30.10 |
| 3gl3B00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9098 | 36 | 177 | 3.40.30.10 |
| 1st9A00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9035 | 38 | 173 | 3.40.30.10 |
| af_Q655X0_59_172_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8881 | 62 | 176 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F9MSF8-F1-model_v4 | Cytochrome C biogenesis protein | 0.9712 | 31 | 158 |
GO:0016209
GO:0016491 |
| AF-A0A1G0FVZ1-F1-model_v4 | Thioredoxin domain-containing protein | 0.9671 | 39 | 176 |
GO:0015036
GO:0017004 GO:0030313 |
| AF-A0A2W5YZX2-F1-model_v4 | Thioredoxin domain-containing protein | 0.9671 | 33 | 178 |
GO:0016209
GO:0016491 |
| AF-A0A3B8Z219-F1-model_v4 | Thioredoxin domain-containing protein | 0.9645 | 32 | 158 |
GO:0016209
GO:0016491 |
| AF-A0A831TN47-F1-model_v4 | TlpA family protein disulfide reductase | 0.9636 | 32 | 177 |
GO:0016209
GO:0016491 |