F448356

General Info

Members Datasets Scaffolds Average Seq Length
459 226 918 217

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10369729|Ga0105246_103697291
Length 239
Sequence VVEEALCARLETPISRLGAVGIQITPSILNADFARLGDEVARIGSADWVHVDVMDNHFVPNLTFGPTMVEALTRRTDVPLDAHLMIEDPDSNAIEYVEAGCGSVTFHVEAAAAPVRLARELRAHGARAAMALKPATPIEPYEELLPELDMLLVMTVEPGFGGQRFLDLCLPKIRAARQLIEKHGVETWLQVDGGISLETIERCAEAGADVFVAGSAVYSADDPDRMVQELRAKAEAAAG

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
114 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
117 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
118 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
125 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
184 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
193 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
196 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
197 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
198 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
199 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
204 2643221561 Nocardioides sp. Root151 Isolate Unclassified
205 2643221576 Nocardioides sp. Root614 Isolate Unclassified
206 2643221590 Nocardioides sp. Root682 Isolate Unclassified
207 2643221604 Nocardioides sp. Root190 Isolate Unclassified
208 2643221615 Nocardioides sp. Root224 Isolate Unclassified
209 2643221617 Nocardioides sp. Root79 Isolate Unclassified
210 2643221620 Nocardioides sp. Root240 Isolate Unclassified
211 2643221641 Nocardioides sp. Root122 Isolate Unclassified
212 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
213 2643221696 Nocardioides sp. Root140 Isolate Unclassified
214 2739367898 Nocardioides sp. CF479 Isolate Unclassified
215 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
216 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
217 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
218 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
219 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
220 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
221 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
222 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
223 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
224 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
225 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
226 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.77
Metatranscriptomes 0.22
Isolates 5.01

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 13.07
Nodule 0.22
Rhizoplane 6.97
Rhizosphere 74.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10369729 3300011119 Bacteria 1181
2 LJQas_1003428 3300000549 Bacteria 2123
3 Ga0070658_10039254 3300005327 Bacteria 3819
4 Ga0070658_10060256 3300005327 Bacteria 3091
5 Ga0070658_10127175 3300005327 Bacteria 2121
6 Ga0070658_10524561 3300005327 Bacteria 1024
7 Ga0070683_100015288 3300005329 Bacteria 6738
8 Ga0070683_100053807 3300005329 Bacteria 3731
9 Ga0070670_100874369 3300005331 Bacteria 814
10 Ga0068869_100219301 3300005334 Bacteria 1507
11 Ga0070682_100053834 3300005337 Bacteria 2523
12 Ga0070660_100051324 3300005339 Bacteria 3176
13 Ga0070660_100061043 3300005339 Bacteria 2927
14 Ga0070660_100073412 3300005339 Bacteria 2675
15 Ga0070689_100071680 3300005340 Bacteria 2707
16 Ga0070661_100409378 3300005344 Bacteria 1073
17 Ga0070692_10010753 3300005345 Bacteria 4179
18 Ga0070688_100164867 3300005365 Bacteria 1525
19 Ga0070659_100013213 3300005366 Bacteria 6141
20 Ga0070659_100014591 3300005366 Bacteria 5875
21 Ga0070667_100210690 3300005367 Bacteria 1727
22 Ga0070700_100268236 3300005441 Bacteria 1232
23 Ga0070663_100858339 3300005455 Bacteria 782
24 Ga0070678_100236292 3300005456 Bacteria 1526
25 Ga0070681_10069036 3300005458 Bacteria 3501
26 Ga0070681_10457958 3300005458 Bacteria 1188
27 Ga0070679_100010892 3300005530 Bacteria 8639
28 Ga0070684_100011120 3300005535 Bacteria 7162
29 Ga0070684_100276173 3300005535 Bacteria 1539
30 Ga0068853_100140850 3300005539 Bacteria 2165
31 Ga0070686_100181400 3300005544 Bacteria 1496
32 Ga0070686_100255071 3300005544 Bacteria 1283
33 Ga0070665_100000703 3300005548 Bacteria 44593
34 Ga0070665_100177813 3300005548 Bacteria 2129
35 Ga0070665_100232399 3300005548 Bacteria 1844
36 Ga0068855_100024275 3300005563 Bacteria 7259
37 Ga0068855_100173643 3300005563 Bacteria 2440
38 Ga0068857_100016243 3300005577 Bacteria 6522
39 Ga0068857_100170005 3300005577 Bacteria 1981
40 Ga0070702_100077955 3300005615 Bacteria 1977
41 Ga0068852_100134178 3300005616 Bacteria 2284
42 Ga0068864_100802547 3300005618 Bacteria 925
43 Ga0068870_10237258 3300005840 Bacteria 1124
44 Ga0068863_100856397 3300005841 Bacteria 908
45 Ga0068860_100000696 3300005843 Bacteria 38651
46 Ga0068860_100222278 3300005843 Bacteria 1834
47 Ga0068862_100054770 3300005844 Bacteria 3415
48 Ga0068862_100081566 3300005844 Bacteria 2806
49 Ga0075365_10019412 3300006038 Bacteria 4195
50 Ga0075365_10028081 3300006038 Bacteria 3586
51 Ga0075365_10031425 3300006038 Bacteria 3406
52 Ga0075365_10073863 3300006038 Bacteria 2299
53 Ga0075365_10096423 3300006038 Bacteria 2021
54 Ga0075365_10109472 3300006038 Bacteria 1898
55 Ga0075365_10147879 3300006038 Bacteria 1633
56 Ga0075365_10390728 3300006038 Bacteria 981
57 Ga0075368_10005403 3300006042 Bacteria 4390
58 Ga0075368_10019955 3300006042 Bacteria 2534
59 Ga0075363_100000197 3300006048 Bacteria 16386
60 Ga0075363_100000954 3300006048 Bacteria 10275
61 Ga0075363_100332654 3300006048 Bacteria 885
62 Ga0075363_100334345 3300006048 Bacteria 883
63 Ga0075363_100342963 3300006048 Bacteria 871
64 Ga0075364_10015899 3300006051 Bacteria 4671
65 Ga0075364_10021762 3300006051 Bacteria 4042
66 Ga0075364_10037198 3300006051 Bacteria 3150
67 Ga0075364_10072624 3300006051 Bacteria 2268
68 Ga0075364_10206962 3300006051 Bacteria 1330
69 Ga0075367_10000646 3300006178 Bacteria 13401
70 Ga0075367_10036938 3300006178 Bacteria 2835
71 Ga0075367_10060845 3300006178 Bacteria 2252
72 Ga0075367_10150933 3300006178 Bacteria 1442
73 Ga0075367_10204279 3300006178 Bacteria 1235
74 Ga0075370_10009898 3300006353 Bacteria 4967
75 Ga0075370_10027739 3300006353 Bacteria 3144
76 Ga0075370_10131308 3300006353 Bacteria 1461
77 Ga0075428_100050198 3300006844 Bacteria 4577
78 Ga0075430_100289578 3300006846 Bacteria 1355
79 Ga0075431_100076521 3300006847 Bacteria 3453
80 Ga0075429_100302145 3300006880 Bacteria 1401
81 Ga0068865_100091139 3300006881 Bacteria 2211
82 Ga0111539_10735296 3300009094 Bacteria 1149
83 Ga0105245_10018959 3300009098 Bacteria 6022
84 Ga0105245_10271970 3300009098 Bacteria 1653
85 Ga0105243_10097121 3300009148 Bacteria 2438
86 Ga0105243_10415652 3300009148 Bacteria 1253
87 Ga0105243_11334540 3300009148 Bacteria 736
88 Ga0105242_10641682 3300009176 Bacteria 1031
89 Ga0105248_10499214 3300009177 Bacteria 1372
90 Ga0105237_10093307 3300009545 Bacteria 2999
91 Ga0105238_10151831 3300009551 Bacteria 2291
92 Ga0105249_10142262 3300009553 Bacteria 2301
93 Ga0105239_10000854 3300010375 Bacteria 43307
94 Ga0105239_10036170 3300010375 Bacteria 5422
95 Ga0105239_10613005 3300010375 Bacteria 1242
96 Ga0105246_10000321 3300011119 Bacteria 25383
97 Ga0105246_10049110 3300011119 Bacteria 2888
98 Ga0105246_10315395 3300011119 Bacteria 1268
99 Ga0157369_10001578 3300013105 Bacteria 27888
100 Ga0163162_10069059 3300013306 Bacteria 3586
101 Ga0163162_11429809 3300013306 Bacteria 787
102 Ga0157372_10029195 3300013307 Bacteria 6020
103 Ga0157372_10519469 3300013307 Bacteria 1388
104 Ga0157375_10100763 3300013308 Bacteria 2970
105 Ga0157375_10133580 3300013308 Bacteria 2603
106 Ga0157375_10168851 3300013308 Bacteria 2334
107 Ga0157375_10185006 3300013308 Bacteria 2236
108 Ga0157375_10257650 3300013308 Bacteria 1906
109 Ga0163163_10063250 3300014325 Bacteria 3668
110 Ga0157380_10132270 3300014326 Bacteria 2130
111 Ga0182008_10035053 3300014497 Bacteria 2515
112 Ga0157377_10483627 3300014745 Bacteria 862
113 Ga0157379_10002714 3300014968 Bacteria 14938
114 Ga0157376_10171759 3300014969 Bacteria 1975
115 Ga0157376_10337796 3300014969 Bacteria 1438
116 Ga0163161_10009694 3300017792 Bacteria 6666
117 Ga0206353_11692696 3300020082 Bacteria 1797
118 Ga0207688_10010855 3300025901 Bacteria 4956
119 Ga0207688_10254253 3300025901 Bacteria 1065
120 Ga0207647_10028161 3300025904 Bacteria 3652
121 Ga0207647_10073960 3300025904 Bacteria 2053
122 Ga0207647_10246708 3300025904 Bacteria 1025
123 Ga0207643_10220571 3300025908 Bacteria 1160
124 Ga0207705_10073763 3300025909 Bacteria 2476
125 Ga0207705_10107816 3300025909 Bacteria 2055
126 Ga0207705_10171922 3300025909 Bacteria 1632
127 Ga0207707_10037490 3300025912 Bacteria 4237
128 Ga0207657_10010487 3300025919 Bacteria 9243
129 Ga0207657_10146150 3300025919 Bacteria 1928
130 Ga0207657_10155584 3300025919 Bacteria 1859
131 Ga0207657_10380846 3300025919 Bacteria 1111
132 Ga0207649_10241925 3300025920 Bacteria 1296
133 Ga0207652_10198153 3300025921 Bacteria 1807
134 Ga0207646_10426837 3300025922 Bacteria 1196
135 Ga0207687_10015163 3300025927 Bacteria 5051
136 Ga0207690_10088742 3300025932 Bacteria 2179
137 Ga0207690_10127180 3300025932 Bacteria 1860
138 Ga0207706_10527433 3300025933 Bacteria 1018
139 Ga0207686_10244382 3300025934 Bacteria 1308
140 Ga0207709_10026973 3300025935 Bacteria 3304
141 Ga0207709_10174964 3300025935 Bacteria 1510
142 Ga0207709_10200949 3300025935 Bacteria 1423
143 Ga0207709_10357434 3300025935 Bacteria 1105
144 Ga0207704_10564796 3300025938 Bacteria 926
145 Ga0207711_10954229 3300025941 Bacteria 796
146 Ga0207689_10554371 3300025942 Bacteria 965
147 Ga0207661_10011595 3300025944 Bacteria 6394
148 Ga0207661_10102308 3300025944 Bacteria 2408
149 Ga0207679_10321923 3300025945 Bacteria 1339
150 Ga0207667_10143612 3300025949 Bacteria 2457
151 Ga0207712_10317104 3300025961 Bacteria 1285
152 Ga0207658_10021990 3300025986 Bacteria 4436
153 Ga0207658_10152885 3300025986 Bacteria 1882
154 Ga0207658_10631332 3300025986 Bacteria 964
155 Ga0207677_10661596 3300026023 Bacteria 923
156 Ga0207678_10731249 3300026067 Bacteria 872
157 Ga0207708_10078620 3300026075 Bacteria 2533
158 Ga0207702_10143619 3300026078 Bacteria 2163
159 Ga0207674_10011797 3300026116 Bacteria 9806
160 Ga0207674_10336013 3300026116 Bacteria 1461
161 Ga0207675_100151043 3300026118 Bacteria 2210
162 Ga0207683_10093319 3300026121 Bacteria 2682
163 Ga0207683_10314111 3300026121 Bacteria 1435
164 Ga0207698_10495881 3300026142 Bacteria 1187
165 Ga0209813_10017724 3300027866 Bacteria 1958
166 Ga0209813_10017731 3300027866 Bacteria 1957
167 Ga0268266_10001679 3300028379 Bacteria 25483
168 Ga0268266_10152713 3300028379 Bacteria 2083
169 Ga0268266_10292283 3300028379 Bacteria 1518
170 Ga0268265_10107905 3300028380 Bacteria 2265
171 Ga0268265_10303576 3300028380 Bacteria 1438
172 Ga0268264_10000697 3300028381 Bacteria 39075
173 Ga0307405_10417689 3300031731 Bacteria 1055
174 Ga0307413_10584748 3300031824 Bacteria 911
175 Ga0307410_10026425 3300031852 Bacteria 3655
176 Ga0307410_10097963 3300031852 Bacteria 2096
177 Ga0307410_10362718 3300031852 Bacteria 1161
178 Ga0307406_10278810 3300031901 Bacteria 1274
179 Ga0307407_10114240 3300031903 Bacteria 1701
180 Ga0307412_10114961 3300031911 Bacteria 1928
181 Ga0307409_100011367 3300031995 Bacteria 5607
182 Ga0307409_100514597 3300031995 Bacteria 1168
183 Ga0307416_100547827 3300032002 Bacteria 1230
184 Ga0307411_10130836 3300032005 Bacteria 1834
185 Ga0307411_10469517 3300032005 Bacteria 1057
186 Ga0307415_100003367 3300032126 Bacteria 8125
187 Ga0307415_100037623 3300032126 Bacteria 3182
188 Ga0395900_0082652 3300037418 Bacteria 3300
189 Ga0395900_0618056 3300037418 Bacteria 1023
190 Ga0395898_0191551 3300037466 Bacteria 1954
191 Ga0395898_0321049 3300037466 Bacteria 1477
192 Ga0395898_0523640 3300037466 Bacteria 1127
193 Ga0395905_0008526 3300037471 Bacteria 10108
194 Ga0395905_0128076 3300037471 Bacteria 2388
195 Ga0395901_0036005 3300038443 Bacteria 5114
196 Ga0451793_0707906 3300041452 Bacteria 725
197 Ga0451835_1074365 3300041492 Bacteria 954
198 Ga0451853_0503194 3300041512 Bacteria 737
199 Ga0451853_1424034 3300041512 Bacteria 1077
200 Ga0439445_0112401 3300042004 Bacteria 778
201 Ga0439448_0061906 3300042005 Bacteria 1238
202 Ga0450907_007119 3300042146 Bacteria 1867
203 Ga0466972_0017865 3300044658 Bacteria 3549
204 Ga0466972_0073138 3300044658 Bacteria 1634
205 Ga0466972_0158566 3300044658 Bacteria 1063
206 Ga0466965_0002652 3300044683 Bacteria 7664
207 Ga0466965_0009106 3300044683 Bacteria 4607
208 Ga0466965_0027097 3300044683 Bacteria 2780
209 Ga0466965_0115692 3300044683 Bacteria 1381
210 Ga0466965_0152726 3300044683 Bacteria 1207
211 Ga0466966_0126775 3300044684 Bacteria 1565
212 Ga0466961_0055280 3300044693 Bacteria 2531
213 Ga0466961_0056585 3300044693 Bacteria 2499
214 Ga0466961_0104156 3300044693 Bacteria 1787
215 Ga0466961_0184903 3300044693 Bacteria 1293
216 Ga0466963_0158877 3300044694 Bacteria 1573
217 Ga0466963_0160304 3300044694 Bacteria 1565
218 Ga0466963_0201290 3300044694 Bacteria 1393
219 Ga0466964_0012524 3300044706 Bacteria 3210
220 Ga0466964_0022735 3300044706 Bacteria 2435
221 Ga0466968_0025445 3300044735 Bacteria 2424
222 Ga0466970_0037203 3300044765 Bacteria 2579
223 Ga0466970_0130822 3300044765 Bacteria 1378
224 Ga0466970_0216843 3300044765 Bacteria 1067
225 Ga0466970_0232094 3300044765 Bacteria 1031
226 Ga0466957_0045693 3300044842 Bacteria 2656
227 Ga0466957_0047778 3300044842 Bacteria 2601
228 Ga0466957_0376251 3300044842 Bacteria 968
229 Ga0466957_0642493 3300044842 Bacteria 745
230 Ga0466960_0006034 3300044901 Bacteria 4838
231 Ga0466960_0012568 3300044901 Bacteria 3577
232 Ga0466960_0025110 3300044901 Bacteria 2694
233 Ga0466960_0047591 3300044901 Bacteria 2057
234 Ga0466960_0109474 3300044901 Bacteria 1433
235 Ga0466960_0122484 3300044901 Bacteria 1363
236 Ga0466960_0155582 3300044901 Bacteria 1224
237 Ga0466959_0299776 3300045049 Bacteria 1101
238 Ga0451576_0465826 3300045051 Bacteria 1327
239 Ga0466967_0008799 3300045976 Bacteria 7439
240 Ga0466967_0303799 3300045976 Bacteria 1536
241 Ga0466967_0625390 3300045976 Bacteria 1063
242 Ga0466967_0705571 3300045976 Bacteria 999
243 Ga0466967_0900937 3300045976 Bacteria 880
244 Ga0466967_0927032 3300045976 Bacteria 866
245 Ga0466967_1242654 3300045976 Bacteria 742
246 Ga0495603_0045282 3300046455 Bacteria 2624
247 Ga0495629_0533534 3300046459 Bacteria 789
248 Ga0495651_0265972 3300046462 Bacteria 1165
249 Ga0495604_0365661 3300047317 Bacteria 956
250 Ga0496100_0068908 3300048903 Bacteria 2354
251 Ga0496100_0278569 3300048903 Bacteria 1246
252 Ga0496101_0068374 3300048904 Bacteria 2597
253 Ga0496101_0206628 3300048904 Bacteria 1520
254 Ga0496101_0830240 3300048904 Bacteria 728
255 Ga0496102_0074402 3300048905 Bacteria 3122
256 Ga0496102_0141974 3300048905 Bacteria 2252
257 Ga0496102_0327791 3300048905 Bacteria 1442
258 Ga0496103_0224758 3300048906 Bacteria 1207
259 Ga0496104_0094223 3300048907 Bacteria 2864
260 Ga0496104_0146118 3300048907 Bacteria 2271
261 Ga0496105_0060940 3300048908 Bacteria 3113
262 Ga0496106_0096102 3300048909 Bacteria 2292
263 Ga0496106_0334897 3300048909 Bacteria 1215
264 Ga0496106_0366078 3300048909 Bacteria 1158
265 Ga0496107_0544943 3300048910 Bacteria 859
266 Ga0496108_0092877 3300048911 Bacteria 2566
267 Ga0496108_0122856 3300048911 Bacteria 2228
268 Ga0496108_0291114 3300048911 Bacteria 1422
269 Ga0496108_0498369 3300048911 Bacteria 1064
270 Ga0496109_0016934 3300048912 Bacteria 6380
271 Ga0496109_0040972 3300048912 Bacteria 4196
272 Ga0496110_0007114 3300048913 Bacteria 8911
273 Ga0496110_0395595 3300048913 Bacteria 1260
274 Ga0496110_0547264 3300048913 Bacteria 1052
275 Ga0496111_0102957 3300048914 Bacteria 2099
276 Ga0496111_0490547 3300048914 Bacteria 905
277 Ga0496113_0439076 3300048916 Bacteria 1049
278 Ga0496114_0008673 3300048917 Bacteria 8056
279 Ga0496114_0031053 3300048917 Bacteria 4394
280 Ga0496114_0184686 3300048917 Bacteria 1822
281 Ga0496124_0134068 3300048927 Bacteria 1964
282 Ga0501031_0013319 3300049568 Bacteria 5367
283 Ga0501031_0027049 3300049568 Bacteria 3739
284 Ga0501031_0122947 3300049568 Bacteria 1695
285 Ga0501032_0009910 3300049569 Bacteria 6883
286 Ga0501032_0103502 3300049569 Bacteria 1886
287 Ga0501032_0257013 3300049569 Bacteria 1133
288 Ga0501033_0201331 3300049570 Bacteria 1422
289 Ga0501034_0009485 3300049571 Bacteria 10187
290 Ga0501034_0039899 3300049571 Bacteria 4755
291 Ga0501036_0002967 3300049572 Bacteria 13477
292 Ga0501036_0004918 3300049572 Bacteria 10794
293 Ga0501036_0136091 3300049572 Bacteria 2074
294 Ga0501036_0188488 3300049572 Bacteria 1736
295 Ga0501036_0237737 3300049572 Bacteria 1528
296 Ga0501036_0676803 3300049572 Bacteria 853
297 Ga0501037_0011954 3300049573 Bacteria 6395
298 Ga0501037_0133424 3300049573 Bacteria 1779
299 Ga0501038_0006565 3300049574 Bacteria 10761
300 Ga0501038_0008097 3300049574 Bacteria 9672
301 Ga0501038_0104192 3300049574 Bacteria 2358
302 Ga0501039_0006003 3300049575 Bacteria 9210
303 Ga0501039_0164035 3300049575 Bacteria 1747
304 Ga0501040_0008428 3300049576 Bacteria 6698
305 Ga0501040_0381328 3300049576 Bacteria 1011
306 Ga0501042_0001539 3300049578 Bacteria 13664
307 Ga0501042_0008859 3300049578 Bacteria 6671
308 Ga0501042_0241811 3300049578 Bacteria 1302
309 Ga0501043_0007999 3300049579 Bacteria 8345
310 Ga0501043_0103523 3300049579 Bacteria 2237
311 Ga0501043_0129441 3300049579 Bacteria 1978
312 Ga0501043_0394070 3300049579 Bacteria 1047
313 Ga0501046_0001157 3300049580 Bacteria 25667
314 Ga0501046_0041540 3300049580 Bacteria 3670
315 Ga0501046_0202288 3300049580 Bacteria 1477
316 Ga0501046_0531560 3300049580 Bacteria 840
317 Ga0501047_0031782 3300049581 Bacteria 5092
318 Ga0501047_0121115 3300049581 Bacteria 2498
319 Ga0501048_0018719 3300049582 Bacteria 5090
320 Ga0501048_0038607 3300049582 Bacteria 3426
321 Ga0501048_0152345 3300049582 Bacteria 1636
322 Ga0501048_0259604 3300049582 Bacteria 1234
323 Ga0501048_0598821 3300049582 Bacteria 791
324 Ga0501067_0001727 3300049583 Bacteria 12003
325 Ga0501067_0036530 3300049583 Bacteria 2727
326 Ga0501067_0044792 3300049583 Bacteria 2458
327 Ga0501068_0421971 3300049584 Bacteria 861
328 Ga0501068_0469787 3300049584 Bacteria 815
329 Ga0501069_0252320 3300049585 Bacteria 1029
330 Ga0501070_0005938 3300049586 Bacteria 10406
331 Ga0501070_0013052 3300049586 Bacteria 7001
332 Ga0501070_0017927 3300049586 Bacteria 5944
333 Ga0501070_0020025 3300049586 Bacteria 5609
334 Ga0501070_0086556 3300049586 Bacteria 2594
335 Ga0501070_0200227 3300049586 Bacteria 1640
336 Ga0501071_0000355 3300049587 Bacteria 22415
337 Ga0501071_0007777 3300049587 Bacteria 7069
338 Ga0501071_0043140 3300049587 Bacteria 3233
339 Ga0501071_0167055 3300049587 Bacteria 1647
340 Ga0501071_0199356 3300049587 Bacteria 1503
341 Ga0501071_0365385 3300049587 Bacteria 1099
342 Ga0501072_0061707 3300049588 Bacteria 2957
343 Ga0501072_0077480 3300049588 Bacteria 2632
344 Ga0501072_0193592 3300049588 Bacteria 1621
345 Ga0501072_0444192 3300049588 Bacteria 1027
346 Ga0501072_0520032 3300049588 Bacteria 941
347 Ga0501073_0017121 3300049589 Bacteria 5249
348 Ga0501073_0026782 3300049589 Bacteria 4128
349 Ga0501073_0045087 3300049589 Bacteria 3106
350 Ga0501073_0106439 3300049589 Bacteria 1946
351 Ga0501073_0120028 3300049589 Bacteria 1822
352 Ga0501074_0001472 3300049590 Bacteria 15829
353 Ga0501074_0059993 3300049590 Bacteria 2740
354 Ga0501074_0130318 3300049590 Bacteria 1799
355 Ga0501074_0196970 3300049590 Bacteria 1436
356 Ga0501074_0272823 3300049590 Bacteria 1202
357 Ga0501074_0288723 3300049590 Bacteria 1166
358 Ga0501075_0009937 3300049591 Bacteria 6670
359 Ga0501075_0175603 3300049591 Bacteria 1635
360 Ga0501075_0424014 3300049591 Bacteria 1014
361 Ga0501076_0000758 3300049592 Bacteria 20827
362 Ga0501076_0070635 3300049592 Bacteria 2792
363 Ga0501076_0306282 3300049592 Bacteria 1303
364 Ga0501076_0429499 3300049592 Bacteria 1087
365 Ga0501077_0024168 3300049593 Bacteria 3857
366 Ga0501077_0199836 3300049593 Bacteria 1270
367 Ga0501077_0432931 3300049593 Bacteria 842
368 Ga0501079_0012673 3300049741 Bacteria 6440
369 Ga0501079_0018510 3300049741 Bacteria 5322
370 Ga0501079_0352316 3300049741 Bacteria 1153
371 Ga0501079_0753179 3300049741 Bacteria 767
372 Ga0501080_0018761 3300049742 Bacteria 6402
373 Ga0501080_0153394 3300049742 Bacteria 2128
374 Ga0501080_0162993 3300049742 Bacteria 2058
375 Ga0501080_0295546 3300049742 Bacteria 1470
376 Ga0501081_0020912 3300049743 Bacteria 4367
377 Ga0501081_0167578 3300049743 Bacteria 1585
378 Ga0501083_0048774 3300049744 Bacteria 2857
379 Ga0501083_0073435 3300049744 Bacteria 2274
380 Ga0501083_0177483 3300049744 Bacteria 1391
381 Ga0501035_0017073 3300049822 Bacteria 6687
382 Ga0501035_0097516 3300049822 Bacteria 2581
383 Ga0501035_0120029 3300049822 Bacteria 2299
384 Ga0501035_0316147 3300049822 Bacteria 1313
385 Ga0501044_0015803 3300049823 Bacteria 8126
386 Ga0501044_0110419 3300049823 Bacteria 2758
387 Ga0501045_0038334 3300049824 Bacteria 3485
388 Ga0501045_0122968 3300049824 Bacteria 1927
389 Ga0501045_0124884 3300049824 Bacteria 1911
390 Ga0501045_0348232 3300049824 Bacteria 1103
391 nmdc:mga03683_7351_c1 3300050489 Bacteria 3821
392 nmdc:mga03n38_111303_c1 3300050490 Bacteria 1334
393 nmdc:mga03n38_3654_c1 3300050490 Bacteria 4975
394 nmdc:mga00v17_11317_c1 3300050491 Bacteria 4904
395 nmdc:mga00v17_174114_c1 3300050491 Bacteria 1388
396 nmdc:mga00v17_233452_c1 3300050491 Bacteria 1192
397 nmdc:mga00v17_32424_c1 3300050491 Bacteria 3088
398 nmdc:mga00v17_41417_c1 3300050491 Bacteria 2766
399 nmdc:mga00v17_4230_c1 3300050491 Bacteria 7448
400 nmdc:mga00v17_73424_c1 3300050491 Bacteria 2124
401 nmdc:mga0yw44_1568_c1 3300050492 Bacteria 9161
402 nmdc:mga0yw44_19027_c1 3300050492 Bacteria 3777
403 nmdc:mga0yw44_3212_c1 3300050492 Bacteria 7194
404 nmdc:mga0yw44_43647_c1 3300050492 Bacteria 2678
405 nmdc:mga0yw44_46657_c1 3300050492 Bacteria 2603
406 nmdc:mga0yw44_527597_c1 3300050492 Bacteria 801
407 nmdc:mga0yw44_89911_c1 3300050492 Bacteria 1939
408 nmdc:mga06z11_5974_c1 3300050494 Bacteria 4920
409 nmdc:mga04h51_13994_c1 3300050495 Bacteria 2284
410 nmdc:mga04h51_6049_c1 3300050495 Bacteria 3117
411 nmdc:mga07m45_170309_c1 3300050496 Bacteria 1266
412 nmdc:mga07m45_233495_c1 3300050496 Bacteria 1070
413 nmdc:mga07m45_39833_c1 3300050496 Bacteria 2627
414 nmdc:mga07m45_87608_c1 3300050496 Bacteria 1782
415 nmdc:mga0qj67_137414_c1 3300050509 Bacteria 1980
416 nmdc:mga08y16_547878_c1 3300050511 Bacteria 1171
417 nmdc:mga0sz30_5762_c1 3300050516 Bacteria 4562
418 Ga0495595_0189362 3300053084 Bacteria 1022
419 Ga0495619_0265516 3300053085 Bacteria 1189
420 Ga0500644_0000284 3300053088 Bacteria 28069
421 Ga0500641_0008775 3300053096 Bacteria 3617
422 Ga0500556_0000588 3300053104 Bacteria 23996
423 Ga0500593_000190 3300053117 Bacteria 25004
424 Ga0500573_0055780 3300053140 Bacteria 2267
425 Ga0501084_0009366 3300054114 Bacteria 8103
426 Ga0501084_0136865 3300054114 Bacteria 2062
427 Ga0501084_0141961 3300054114 Bacteria 2022
428 Ga0501084_0196397 3300054114 Bacteria 1702
429 Ga0501084_0253590 3300054114 Bacteria 1485
430 Ga0501084_0346419 3300054114 Bacteria 1255
431 Ga0501082_0072179 3300060353 Bacteria 2973
432 Ga0501082_0152282 3300060353 Bacteria 2009
433 Ga0466962_0147119 3300061719 Bacteria 1142
434 Ga0530510_0062271 3300061734 Bacteria 2701
435 Ga0530510_0166180 3300061734 Bacteria 1633
436 Ga0530510_0229527 3300061734 Bacteria 1381
437 2643823615 2643221561 Bacteria 4984412
438 2643891694 2643221576 Bacteria 5214352
439 2643960742 2643221590 Bacteria 5214697
440 2644035746 2643221604 Bacteria 5014917
441 2644093954 2643221615 Bacteria 5487866
442 2644102372 2643221617 Bacteria 5139111
443 2644115596 2643221620 Bacteria 5134593
444 2644230362 2643221641 Bacteria 4490190
445 2644323798 2643221657 Bacteria 5490246
446 2644535296 2643221696 Bacteria 5431823
447 2740168963 2739367898 Bacteria 4367674
448 2774392881 2773857762 Bacteria 5971770
449 2804843693 2802429296 Bacteria 7227771
450 2809196712 2808606439 Bacteria 5952208
451 2812333106 2811994874 Bacteria 5367947
452 2812351155 2811994878 Bacteria 5992952
453 2855391115 2855386786 Bacteria 4752232
454 2857486414 2857481737 Bacteria 4761446
455 2891971221 2891968417 Bacteria 5821697
456 2984579979 2984576629 Bacteria 4248407
457 2990260760 2990256926 Bacteria 4252839
458 8025414849 8025413630 Bacteria 7014048
459 8054611209 8054609563 Bacteria 5170090
460 Ga0105246_10369729
461 LJQas_1003428
462 Ga0070658_10039254
463 Ga0070658_10060256
464 Ga0070658_10127175
465 Ga0070658_10524561
466 Ga0070683_100015288
467 Ga0070683_100053807
468 Ga0070670_100874369
469 Ga0068869_100219301
470 Ga0070682_100053834
471 Ga0070660_100051324
472 Ga0070660_100061043
473 Ga0070660_100073412
474 Ga0070689_100071680
475 Ga0070661_100409378
476 Ga0070692_10010753
477 Ga0070688_100164867
478 Ga0070659_100013213
479 Ga0070659_100014591
480 Ga0070667_100210690
481 Ga0070700_100268236
482 Ga0070663_100858339
483 Ga0070678_100236292
484 Ga0070681_10069036
485 Ga0070681_10457958
486 Ga0070679_100010892
487 Ga0070684_100011120
488 Ga0070684_100276173
489 Ga0068853_100140850
490 Ga0070686_100181400
491 Ga0070686_100255071
492 Ga0070665_100000703
493 Ga0070665_100177813
494 Ga0070665_100232399
495 Ga0068855_100024275
496 Ga0068855_100173643
497 Ga0068857_100016243
498 Ga0068857_100170005
499 Ga0070702_100077955
500 Ga0068852_100134178
501 Ga0068864_100802547
502 Ga0068870_10237258
503 Ga0068863_100856397
504 Ga0068860_100000696
505 Ga0068860_100222278
506 Ga0068862_100054770
507 Ga0068862_100081566
508 Ga0075365_10019412
509 Ga0075365_10028081
510 Ga0075365_10031425
511 Ga0075365_10073863
512 Ga0075365_10096423
513 Ga0075365_10109472
514 Ga0075365_10147879
515 Ga0075365_10390728
516 Ga0075368_10005403
517 Ga0075368_10019955
518 Ga0075363_100000197
519 Ga0075363_100000954
520 Ga0075363_100332654
521 Ga0075363_100334345
522 Ga0075363_100342963
523 Ga0075364_10015899
524 Ga0075364_10021762
525 Ga0075364_10037198
526 Ga0075364_10072624
527 Ga0075364_10206962
528 Ga0075367_10000646
529 Ga0075367_10036938
530 Ga0075367_10060845
531 Ga0075367_10150933
532 Ga0075367_10204279
533 Ga0075370_10009898
534 Ga0075370_10027739
535 Ga0075370_10131308
536 Ga0075428_100050198
537 Ga0075430_100289578
538 Ga0075431_100076521
539 Ga0075429_100302145
540 Ga0068865_100091139
541 Ga0111539_10735296
542 Ga0105245_10018959
543 Ga0105245_10271970
544 Ga0105243_10097121
545 Ga0105243_10415652
546 Ga0105243_11334540
547 Ga0105242_10641682
548 Ga0105248_10499214
549 Ga0105237_10093307
550 Ga0105238_10151831
551 Ga0105249_10142262
552 Ga0105239_10000854
553 Ga0105239_10036170
554 Ga0105239_10613005
555 Ga0105246_10000321
556 Ga0105246_10049110
557 Ga0105246_10315395
558 Ga0157369_10001578
559 Ga0163162_10069059
560 Ga0163162_11429809
561 Ga0157372_10029195
562 Ga0157372_10519469
563 Ga0157375_10100763
564 Ga0157375_10133580
565 Ga0157375_10168851
566 Ga0157375_10185006
567 Ga0157375_10257650
568 Ga0163163_10063250
569 Ga0157380_10132270
570 Ga0182008_10035053
571 Ga0157377_10483627
572 Ga0157379_10002714
573 Ga0157376_10171759
574 Ga0157376_10337796
575 Ga0163161_10009694
576 Ga0206353_11692696
577 Ga0207688_10010855
578 Ga0207688_10254253
579 Ga0207647_10028161
580 Ga0207647_10073960
581 Ga0207647_10246708
582 Ga0207643_10220571
583 Ga0207705_10073763
584 Ga0207705_10107816
585 Ga0207705_10171922
586 Ga0207707_10037490
587 Ga0207657_10010487
588 Ga0207657_10146150
589 Ga0207657_10155584
590 Ga0207657_10380846
591 Ga0207649_10241925
592 Ga0207652_10198153
593 Ga0207646_10426837
594 Ga0207687_10015163
595 Ga0207690_10088742
596 Ga0207690_10127180
597 Ga0207706_10527433
598 Ga0207686_10244382
599 Ga0207709_10026973
600 Ga0207709_10174964
601 Ga0207709_10200949
602 Ga0207709_10357434
603 Ga0207704_10564796
604 Ga0207711_10954229
605 Ga0207689_10554371
606 Ga0207661_10011595
607 Ga0207661_10102308
608 Ga0207679_10321923
609 Ga0207667_10143612
610 Ga0207712_10317104
611 Ga0207658_10021990
612 Ga0207658_10152885
613 Ga0207658_10631332
614 Ga0207677_10661596
615 Ga0207678_10731249
616 Ga0207708_10078620
617 Ga0207702_10143619
618 Ga0207674_10011797
619 Ga0207674_10336013
620 Ga0207675_100151043
621 Ga0207683_10093319
622 Ga0207683_10314111
623 Ga0207698_10495881
624 Ga0209813_10017724
625 Ga0209813_10017731
626 Ga0268266_10001679
627 Ga0268266_10152713
628 Ga0268266_10292283
629 Ga0268265_10107905
630 Ga0268265_10303576
631 Ga0268264_10000697
632 Ga0307405_10417689
633 Ga0307413_10584748
634 Ga0307410_10026425
635 Ga0307410_10097963
636 Ga0307410_10362718
637 Ga0307406_10278810
638 Ga0307407_10114240
639 Ga0307412_10114961
640 Ga0307409_100011367
641 Ga0307409_100514597
642 Ga0307416_100547827
643 Ga0307411_10130836
644 Ga0307411_10469517
645 Ga0307415_100003367
646 Ga0307415_100037623
647 Ga0395900_0082652
648 Ga0395900_0618056
649 Ga0395898_0191551
650 Ga0395898_0321049
651 Ga0395898_0523640
652 Ga0395905_0008526
653 Ga0395905_0128076
654 Ga0395901_0036005
655 Ga0451793_0707906
656 Ga0451835_1074365
657 Ga0451853_0503194
658 Ga0451853_1424034
659 Ga0439445_0112401
660 Ga0439448_0061906
661 Ga0450907_007119
662 Ga0466972_0017865
663 Ga0466972_0073138
664 Ga0466972_0158566
665 Ga0466965_0002652
666 Ga0466965_0009106
667 Ga0466965_0027097
668 Ga0466965_0115692
669 Ga0466965_0152726
670 Ga0466966_0126775
671 Ga0466961_0055280
672 Ga0466961_0056585
673 Ga0466961_0104156
674 Ga0466961_0184903
675 Ga0466963_0158877
676 Ga0466963_0160304
677 Ga0466963_0201290
678 Ga0466964_0012524
679 Ga0466964_0022735
680 Ga0466968_0025445
681 Ga0466970_0037203
682 Ga0466970_0130822
683 Ga0466970_0216843
684 Ga0466970_0232094
685 Ga0466957_0045693
686 Ga0466957_0047778
687 Ga0466957_0376251
688 Ga0466957_0642493
689 Ga0466960_0006034
690 Ga0466960_0012568
691 Ga0466960_0025110
692 Ga0466960_0047591
693 Ga0466960_0109474
694 Ga0466960_0122484
695 Ga0466960_0155582
696 Ga0466959_0299776
697 Ga0451576_0465826
698 Ga0466967_0008799
699 Ga0466967_0303799
700 Ga0466967_0625390
701 Ga0466967_0705571
702 Ga0466967_0900937
703 Ga0466967_0927032
704 Ga0466967_1242654
705 Ga0495603_0045282
706 Ga0495629_0533534
707 Ga0495651_0265972
708 Ga0495604_0365661
709 Ga0496100_0068908
710 Ga0496100_0278569
711 Ga0496101_0068374
712 Ga0496101_0206628
713 Ga0496101_0830240
714 Ga0496102_0074402
715 Ga0496102_0141974
716 Ga0496102_0327791
717 Ga0496103_0224758
718 Ga0496104_0094223
719 Ga0496104_0146118
720 Ga0496105_0060940
721 Ga0496106_0096102
722 Ga0496106_0334897
723 Ga0496106_0366078
724 Ga0496107_0544943
725 Ga0496108_0092877
726 Ga0496108_0122856
727 Ga0496108_0291114
728 Ga0496108_0498369
729 Ga0496109_0016934
730 Ga0496109_0040972
731 Ga0496110_0007114
732 Ga0496110_0395595
733 Ga0496110_0547264
734 Ga0496111_0102957
735 Ga0496111_0490547
736 Ga0496113_0439076
737 Ga0496114_0008673
738 Ga0496114_0031053
739 Ga0496114_0184686
740 Ga0496124_0134068
741 Ga0501031_0013319
742 Ga0501031_0027049
743 Ga0501031_0122947
744 Ga0501032_0009910
745 Ga0501032_0103502
746 Ga0501032_0257013
747 Ga0501033_0201331
748 Ga0501034_0009485
749 Ga0501034_0039899
750 Ga0501036_0002967
751 Ga0501036_0004918
752 Ga0501036_0136091
753 Ga0501036_0188488
754 Ga0501036_0237737
755 Ga0501036_0676803
756 Ga0501037_0011954
757 Ga0501037_0133424
758 Ga0501038_0006565
759 Ga0501038_0008097
760 Ga0501038_0104192
761 Ga0501039_0006003
762 Ga0501039_0164035
763 Ga0501040_0008428
764 Ga0501040_0381328
765 Ga0501042_0001539
766 Ga0501042_0008859
767 Ga0501042_0241811
768 Ga0501043_0007999
769 Ga0501043_0103523
770 Ga0501043_0129441
771 Ga0501043_0394070
772 Ga0501046_0001157
773 Ga0501046_0041540
774 Ga0501046_0202288
775 Ga0501046_0531560
776 Ga0501047_0031782
777 Ga0501047_0121115
778 Ga0501048_0018719
779 Ga0501048_0038607
780 Ga0501048_0152345
781 Ga0501048_0259604
782 Ga0501048_0598821
783 Ga0501067_0001727
784 Ga0501067_0036530
785 Ga0501067_0044792
786 Ga0501068_0421971
787 Ga0501068_0469787
788 Ga0501069_0252320
789 Ga0501070_0005938
790 Ga0501070_0013052
791 Ga0501070_0017927
792 Ga0501070_0020025
793 Ga0501070_0086556
794 Ga0501070_0200227
795 Ga0501071_0000355
796 Ga0501071_0007777
797 Ga0501071_0043140
798 Ga0501071_0167055
799 Ga0501071_0199356
800 Ga0501071_0365385
801 Ga0501072_0061707
802 Ga0501072_0077480
803 Ga0501072_0193592
804 Ga0501072_0444192
805 Ga0501072_0520032
806 Ga0501073_0017121
807 Ga0501073_0026782
808 Ga0501073_0045087
809 Ga0501073_0106439
810 Ga0501073_0120028
811 Ga0501074_0001472
812 Ga0501074_0059993
813 Ga0501074_0130318
814 Ga0501074_0196970
815 Ga0501074_0272823
816 Ga0501074_0288723
817 Ga0501075_0009937
818 Ga0501075_0175603
819 Ga0501075_0424014
820 Ga0501076_0000758
821 Ga0501076_0070635
822 Ga0501076_0306282
823 Ga0501076_0429499
824 Ga0501077_0024168
825 Ga0501077_0199836
826 Ga0501077_0432931
827 Ga0501079_0012673
828 Ga0501079_0018510
829 Ga0501079_0352316
830 Ga0501079_0753179
831 Ga0501080_0018761
832 Ga0501080_0153394
833 Ga0501080_0162993
834 Ga0501080_0295546
835 Ga0501081_0020912
836 Ga0501081_0167578
837 Ga0501083_0048774
838 Ga0501083_0073435
839 Ga0501083_0177483
840 Ga0501035_0017073
841 Ga0501035_0097516
842 Ga0501035_0120029
843 Ga0501035_0316147
844 Ga0501044_0015803
845 Ga0501044_0110419
846 Ga0501045_0038334
847 Ga0501045_0122968
848 Ga0501045_0124884
849 Ga0501045_0348232
850 nmdc:mga03683_7351_c1
851 nmdc:mga03n38_111303_c1
852 nmdc:mga03n38_3654_c1
853 nmdc:mga00v17_11317_c1
854 nmdc:mga00v17_174114_c1
855 nmdc:mga00v17_233452_c1
856 nmdc:mga00v17_32424_c1
857 nmdc:mga00v17_41417_c1
858 nmdc:mga00v17_4230_c1
859 nmdc:mga00v17_73424_c1
860 nmdc:mga0yw44_1568_c1
861 nmdc:mga0yw44_19027_c1
862 nmdc:mga0yw44_3212_c1
863 nmdc:mga0yw44_43647_c1
864 nmdc:mga0yw44_46657_c1
865 nmdc:mga0yw44_527597_c1
866 nmdc:mga0yw44_89911_c1
867 nmdc:mga06z11_5974_c1
868 nmdc:mga04h51_13994_c1
869 nmdc:mga04h51_6049_c1
870 nmdc:mga07m45_170309_c1
871 nmdc:mga07m45_233495_c1
872 nmdc:mga07m45_39833_c1
873 nmdc:mga07m45_87608_c1
874 nmdc:mga0qj67_137414_c1
875 nmdc:mga08y16_547878_c1
876 nmdc:mga0sz30_5762_c1
877 Ga0495595_0189362
878 Ga0495619_0265516
879 Ga0500644_0000284
880 Ga0500641_0008775
881 Ga0500556_0000588
882 Ga0500593_000190
883 Ga0500573_0055780
884 Ga0501084_0009366
885 Ga0501084_0136865
886 Ga0501084_0141961
887 Ga0501084_0196397
888 Ga0501084_0253590
889 Ga0501084_0346419
890 Ga0501082_0072179
891 Ga0501082_0152282
892 Ga0466962_0147119
893 Ga0530510_0062271
894 Ga0530510_0166180
895 Ga0530510_0229527
896 2643823615
897 2643891694
898 2643960742
899 2644035746
900 2644093954
901 2644102372
902 2644115596
903 2644230362
904 2644323798
905 2644535296
906 2740168963
907 2774392881
908 2804843693
909 2809196712
910 2812333106
911 2812351155
912 2855391115
913 2857486414
914 2891971221
915 2984579979
916 2990260760
917 8025414849
918 8054611209

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

23

218

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rpx-assembly1.cif.gz_A d-ribulose-5-phosphate 3-epimerase from solanum tuberosum chloroplasts 0.929 2 214
2fli-assembly1.cif.gz_E the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate 0.9289 3 214
7sbj-assembly1.cif.gz_C crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a 0.9274 4 218
5umf-assembly1.cif.gz_C crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate 0.9229 2 219
7u5y-assembly1.cif.gz_E crystal structure of ribulose-phosphate 3-epimerase from pseudomonas aeruginosa 0.9204 1 218
ID Description Score Start End Superfamily
af_P9WI51_4_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9322 2 217 3.20.20.70
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9294 1 216 3.20.20.70
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9268 1 219 3.20.20.70
af_A0A1D6PJ99_41_293_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9168 2 208 3.20.20.70
1tqjD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9163 1 214 3.20.20.70
ID Description Score Start End GO Terms
AF-W4UGP6-F1-model_v4 deleted 0.9732 51 218
AF-A0A519FSZ6-F1-model_v4 Ribulose-phosphate 3-epimerase 0.9705 76 218 GO:0005975
GO:0016857
AF-A0A3B9SKL1-F1-model_v4 Ribulose-phosphate 3-epimerase 0.9664 46 213 GO:0005975
GO:0016857
AF-A0A849FQY7-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9589 44 215 GO:0004750
GO:0005975
GO:0006098
AF-A0A6J7N4Z0-F1-model_v4 Unannotated protein 0.9583 50 217 GO:0005975
GO:0016857

Map