F448356
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 459 | 226 | 918 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300011119|Ga0105246_10369729|Ga0105246_103697291 |
| Length | 239 |
| Sequence | VVEEALCARLETPISRLGAVGIQITPSILNADFARLGDEVARIGSADWVHVDVMDNHFVPNLTFGPTMVEALTRRTDVPLDAHLMIEDPDSNAIEYVEAGCGSVTFHVEAAAAPVRLARELRAHGARAAMALKPATPIEPYEELLPELDMLLVMTVEPGFGGQRFLDLCLPKIRAARQLIEKHGVETWLQVDGGISLETIERCAEAGADVFVAGSAVYSADDPDRMVQELRAKAEAAAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 29 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 30 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 31 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 32 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 33 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 34 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 35 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 36 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 37 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 38 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 39 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 40 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 43 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 44 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 60 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 100 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 101 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 102 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 103 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 104 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 105 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 106 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 107 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 108 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 109 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 110 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 111 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 112 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 113 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 114 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 115 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 116 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 117 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 118 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 119 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 120 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 121 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 122 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 123 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 124 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 125 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 126 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 127 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 128 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 129 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 130 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 131 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 132 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 139 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 140 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 141 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 142 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 143 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 144 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 147 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 148 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 149 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 150 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 151 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 184 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 185 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 186 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 187 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 188 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 189 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 190 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 193 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 196 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 197 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 198 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 199 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 200 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 203 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 204 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 205 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 206 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 207 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 208 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 209 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 210 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 211 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 212 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 213 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 214 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 215 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 216 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 217 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 218 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 219 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 220 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 221 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 222 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 223 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 224 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 225 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 226 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.77 |
| Metatranscriptomes | 0.22 |
| Isolates | 5.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.44 |
| Bulb | 0 |
| Endosphere | 13.07 |
| Nodule | 0.22 |
| Rhizoplane | 6.97 |
| Rhizosphere | 74.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105246_10369729 | 3300011119 | Bacteria | 1181 |
| 2 | LJQas_1003428 | 3300000549 | Bacteria | 2123 |
| 3 | Ga0070658_10039254 | 3300005327 | Bacteria | 3819 |
| 4 | Ga0070658_10060256 | 3300005327 | Bacteria | 3091 |
| 5 | Ga0070658_10127175 | 3300005327 | Bacteria | 2121 |
| 6 | Ga0070658_10524561 | 3300005327 | Bacteria | 1024 |
| 7 | Ga0070683_100015288 | 3300005329 | Bacteria | 6738 |
| 8 | Ga0070683_100053807 | 3300005329 | Bacteria | 3731 |
| 9 | Ga0070670_100874369 | 3300005331 | Bacteria | 814 |
| 10 | Ga0068869_100219301 | 3300005334 | Bacteria | 1507 |
| 11 | Ga0070682_100053834 | 3300005337 | Bacteria | 2523 |
| 12 | Ga0070660_100051324 | 3300005339 | Bacteria | 3176 |
| 13 | Ga0070660_100061043 | 3300005339 | Bacteria | 2927 |
| 14 | Ga0070660_100073412 | 3300005339 | Bacteria | 2675 |
| 15 | Ga0070689_100071680 | 3300005340 | Bacteria | 2707 |
| 16 | Ga0070661_100409378 | 3300005344 | Bacteria | 1073 |
| 17 | Ga0070692_10010753 | 3300005345 | Bacteria | 4179 |
| 18 | Ga0070688_100164867 | 3300005365 | Bacteria | 1525 |
| 19 | Ga0070659_100013213 | 3300005366 | Bacteria | 6141 |
| 20 | Ga0070659_100014591 | 3300005366 | Bacteria | 5875 |
| 21 | Ga0070667_100210690 | 3300005367 | Bacteria | 1727 |
| 22 | Ga0070700_100268236 | 3300005441 | Bacteria | 1232 |
| 23 | Ga0070663_100858339 | 3300005455 | Bacteria | 782 |
| 24 | Ga0070678_100236292 | 3300005456 | Bacteria | 1526 |
| 25 | Ga0070681_10069036 | 3300005458 | Bacteria | 3501 |
| 26 | Ga0070681_10457958 | 3300005458 | Bacteria | 1188 |
| 27 | Ga0070679_100010892 | 3300005530 | Bacteria | 8639 |
| 28 | Ga0070684_100011120 | 3300005535 | Bacteria | 7162 |
| 29 | Ga0070684_100276173 | 3300005535 | Bacteria | 1539 |
| 30 | Ga0068853_100140850 | 3300005539 | Bacteria | 2165 |
| 31 | Ga0070686_100181400 | 3300005544 | Bacteria | 1496 |
| 32 | Ga0070686_100255071 | 3300005544 | Bacteria | 1283 |
| 33 | Ga0070665_100000703 | 3300005548 | Bacteria | 44593 |
| 34 | Ga0070665_100177813 | 3300005548 | Bacteria | 2129 |
| 35 | Ga0070665_100232399 | 3300005548 | Bacteria | 1844 |
| 36 | Ga0068855_100024275 | 3300005563 | Bacteria | 7259 |
| 37 | Ga0068855_100173643 | 3300005563 | Bacteria | 2440 |
| 38 | Ga0068857_100016243 | 3300005577 | Bacteria | 6522 |
| 39 | Ga0068857_100170005 | 3300005577 | Bacteria | 1981 |
| 40 | Ga0070702_100077955 | 3300005615 | Bacteria | 1977 |
| 41 | Ga0068852_100134178 | 3300005616 | Bacteria | 2284 |
| 42 | Ga0068864_100802547 | 3300005618 | Bacteria | 925 |
| 43 | Ga0068870_10237258 | 3300005840 | Bacteria | 1124 |
| 44 | Ga0068863_100856397 | 3300005841 | Bacteria | 908 |
| 45 | Ga0068860_100000696 | 3300005843 | Bacteria | 38651 |
| 46 | Ga0068860_100222278 | 3300005843 | Bacteria | 1834 |
| 47 | Ga0068862_100054770 | 3300005844 | Bacteria | 3415 |
| 48 | Ga0068862_100081566 | 3300005844 | Bacteria | 2806 |
| 49 | Ga0075365_10019412 | 3300006038 | Bacteria | 4195 |
| 50 | Ga0075365_10028081 | 3300006038 | Bacteria | 3586 |
| 51 | Ga0075365_10031425 | 3300006038 | Bacteria | 3406 |
| 52 | Ga0075365_10073863 | 3300006038 | Bacteria | 2299 |
| 53 | Ga0075365_10096423 | 3300006038 | Bacteria | 2021 |
| 54 | Ga0075365_10109472 | 3300006038 | Bacteria | 1898 |
| 55 | Ga0075365_10147879 | 3300006038 | Bacteria | 1633 |
| 56 | Ga0075365_10390728 | 3300006038 | Bacteria | 981 |
| 57 | Ga0075368_10005403 | 3300006042 | Bacteria | 4390 |
| 58 | Ga0075368_10019955 | 3300006042 | Bacteria | 2534 |
| 59 | Ga0075363_100000197 | 3300006048 | Bacteria | 16386 |
| 60 | Ga0075363_100000954 | 3300006048 | Bacteria | 10275 |
| 61 | Ga0075363_100332654 | 3300006048 | Bacteria | 885 |
| 62 | Ga0075363_100334345 | 3300006048 | Bacteria | 883 |
| 63 | Ga0075363_100342963 | 3300006048 | Bacteria | 871 |
| 64 | Ga0075364_10015899 | 3300006051 | Bacteria | 4671 |
| 65 | Ga0075364_10021762 | 3300006051 | Bacteria | 4042 |
| 66 | Ga0075364_10037198 | 3300006051 | Bacteria | 3150 |
| 67 | Ga0075364_10072624 | 3300006051 | Bacteria | 2268 |
| 68 | Ga0075364_10206962 | 3300006051 | Bacteria | 1330 |
| 69 | Ga0075367_10000646 | 3300006178 | Bacteria | 13401 |
| 70 | Ga0075367_10036938 | 3300006178 | Bacteria | 2835 |
| 71 | Ga0075367_10060845 | 3300006178 | Bacteria | 2252 |
| 72 | Ga0075367_10150933 | 3300006178 | Bacteria | 1442 |
| 73 | Ga0075367_10204279 | 3300006178 | Bacteria | 1235 |
| 74 | Ga0075370_10009898 | 3300006353 | Bacteria | 4967 |
| 75 | Ga0075370_10027739 | 3300006353 | Bacteria | 3144 |
| 76 | Ga0075370_10131308 | 3300006353 | Bacteria | 1461 |
| 77 | Ga0075428_100050198 | 3300006844 | Bacteria | 4577 |
| 78 | Ga0075430_100289578 | 3300006846 | Bacteria | 1355 |
| 79 | Ga0075431_100076521 | 3300006847 | Bacteria | 3453 |
| 80 | Ga0075429_100302145 | 3300006880 | Bacteria | 1401 |
| 81 | Ga0068865_100091139 | 3300006881 | Bacteria | 2211 |
| 82 | Ga0111539_10735296 | 3300009094 | Bacteria | 1149 |
| 83 | Ga0105245_10018959 | 3300009098 | Bacteria | 6022 |
| 84 | Ga0105245_10271970 | 3300009098 | Bacteria | 1653 |
| 85 | Ga0105243_10097121 | 3300009148 | Bacteria | 2438 |
| 86 | Ga0105243_10415652 | 3300009148 | Bacteria | 1253 |
| 87 | Ga0105243_11334540 | 3300009148 | Bacteria | 736 |
| 88 | Ga0105242_10641682 | 3300009176 | Bacteria | 1031 |
| 89 | Ga0105248_10499214 | 3300009177 | Bacteria | 1372 |
| 90 | Ga0105237_10093307 | 3300009545 | Bacteria | 2999 |
| 91 | Ga0105238_10151831 | 3300009551 | Bacteria | 2291 |
| 92 | Ga0105249_10142262 | 3300009553 | Bacteria | 2301 |
| 93 | Ga0105239_10000854 | 3300010375 | Bacteria | 43307 |
| 94 | Ga0105239_10036170 | 3300010375 | Bacteria | 5422 |
| 95 | Ga0105239_10613005 | 3300010375 | Bacteria | 1242 |
| 96 | Ga0105246_10000321 | 3300011119 | Bacteria | 25383 |
| 97 | Ga0105246_10049110 | 3300011119 | Bacteria | 2888 |
| 98 | Ga0105246_10315395 | 3300011119 | Bacteria | 1268 |
| 99 | Ga0157369_10001578 | 3300013105 | Bacteria | 27888 |
| 100 | Ga0163162_10069059 | 3300013306 | Bacteria | 3586 |
| 101 | Ga0163162_11429809 | 3300013306 | Bacteria | 787 |
| 102 | Ga0157372_10029195 | 3300013307 | Bacteria | 6020 |
| 103 | Ga0157372_10519469 | 3300013307 | Bacteria | 1388 |
| 104 | Ga0157375_10100763 | 3300013308 | Bacteria | 2970 |
| 105 | Ga0157375_10133580 | 3300013308 | Bacteria | 2603 |
| 106 | Ga0157375_10168851 | 3300013308 | Bacteria | 2334 |
| 107 | Ga0157375_10185006 | 3300013308 | Bacteria | 2236 |
| 108 | Ga0157375_10257650 | 3300013308 | Bacteria | 1906 |
| 109 | Ga0163163_10063250 | 3300014325 | Bacteria | 3668 |
| 110 | Ga0157380_10132270 | 3300014326 | Bacteria | 2130 |
| 111 | Ga0182008_10035053 | 3300014497 | Bacteria | 2515 |
| 112 | Ga0157377_10483627 | 3300014745 | Bacteria | 862 |
| 113 | Ga0157379_10002714 | 3300014968 | Bacteria | 14938 |
| 114 | Ga0157376_10171759 | 3300014969 | Bacteria | 1975 |
| 115 | Ga0157376_10337796 | 3300014969 | Bacteria | 1438 |
| 116 | Ga0163161_10009694 | 3300017792 | Bacteria | 6666 |
| 117 | Ga0206353_11692696 | 3300020082 | Bacteria | 1797 |
| 118 | Ga0207688_10010855 | 3300025901 | Bacteria | 4956 |
| 119 | Ga0207688_10254253 | 3300025901 | Bacteria | 1065 |
| 120 | Ga0207647_10028161 | 3300025904 | Bacteria | 3652 |
| 121 | Ga0207647_10073960 | 3300025904 | Bacteria | 2053 |
| 122 | Ga0207647_10246708 | 3300025904 | Bacteria | 1025 |
| 123 | Ga0207643_10220571 | 3300025908 | Bacteria | 1160 |
| 124 | Ga0207705_10073763 | 3300025909 | Bacteria | 2476 |
| 125 | Ga0207705_10107816 | 3300025909 | Bacteria | 2055 |
| 126 | Ga0207705_10171922 | 3300025909 | Bacteria | 1632 |
| 127 | Ga0207707_10037490 | 3300025912 | Bacteria | 4237 |
| 128 | Ga0207657_10010487 | 3300025919 | Bacteria | 9243 |
| 129 | Ga0207657_10146150 | 3300025919 | Bacteria | 1928 |
| 130 | Ga0207657_10155584 | 3300025919 | Bacteria | 1859 |
| 131 | Ga0207657_10380846 | 3300025919 | Bacteria | 1111 |
| 132 | Ga0207649_10241925 | 3300025920 | Bacteria | 1296 |
| 133 | Ga0207652_10198153 | 3300025921 | Bacteria | 1807 |
| 134 | Ga0207646_10426837 | 3300025922 | Bacteria | 1196 |
| 135 | Ga0207687_10015163 | 3300025927 | Bacteria | 5051 |
| 136 | Ga0207690_10088742 | 3300025932 | Bacteria | 2179 |
| 137 | Ga0207690_10127180 | 3300025932 | Bacteria | 1860 |
| 138 | Ga0207706_10527433 | 3300025933 | Bacteria | 1018 |
| 139 | Ga0207686_10244382 | 3300025934 | Bacteria | 1308 |
| 140 | Ga0207709_10026973 | 3300025935 | Bacteria | 3304 |
| 141 | Ga0207709_10174964 | 3300025935 | Bacteria | 1510 |
| 142 | Ga0207709_10200949 | 3300025935 | Bacteria | 1423 |
| 143 | Ga0207709_10357434 | 3300025935 | Bacteria | 1105 |
| 144 | Ga0207704_10564796 | 3300025938 | Bacteria | 926 |
| 145 | Ga0207711_10954229 | 3300025941 | Bacteria | 796 |
| 146 | Ga0207689_10554371 | 3300025942 | Bacteria | 965 |
| 147 | Ga0207661_10011595 | 3300025944 | Bacteria | 6394 |
| 148 | Ga0207661_10102308 | 3300025944 | Bacteria | 2408 |
| 149 | Ga0207679_10321923 | 3300025945 | Bacteria | 1339 |
| 150 | Ga0207667_10143612 | 3300025949 | Bacteria | 2457 |
| 151 | Ga0207712_10317104 | 3300025961 | Bacteria | 1285 |
| 152 | Ga0207658_10021990 | 3300025986 | Bacteria | 4436 |
| 153 | Ga0207658_10152885 | 3300025986 | Bacteria | 1882 |
| 154 | Ga0207658_10631332 | 3300025986 | Bacteria | 964 |
| 155 | Ga0207677_10661596 | 3300026023 | Bacteria | 923 |
| 156 | Ga0207678_10731249 | 3300026067 | Bacteria | 872 |
| 157 | Ga0207708_10078620 | 3300026075 | Bacteria | 2533 |
| 158 | Ga0207702_10143619 | 3300026078 | Bacteria | 2163 |
| 159 | Ga0207674_10011797 | 3300026116 | Bacteria | 9806 |
| 160 | Ga0207674_10336013 | 3300026116 | Bacteria | 1461 |
| 161 | Ga0207675_100151043 | 3300026118 | Bacteria | 2210 |
| 162 | Ga0207683_10093319 | 3300026121 | Bacteria | 2682 |
| 163 | Ga0207683_10314111 | 3300026121 | Bacteria | 1435 |
| 164 | Ga0207698_10495881 | 3300026142 | Bacteria | 1187 |
| 165 | Ga0209813_10017724 | 3300027866 | Bacteria | 1958 |
| 166 | Ga0209813_10017731 | 3300027866 | Bacteria | 1957 |
| 167 | Ga0268266_10001679 | 3300028379 | Bacteria | 25483 |
| 168 | Ga0268266_10152713 | 3300028379 | Bacteria | 2083 |
| 169 | Ga0268266_10292283 | 3300028379 | Bacteria | 1518 |
| 170 | Ga0268265_10107905 | 3300028380 | Bacteria | 2265 |
| 171 | Ga0268265_10303576 | 3300028380 | Bacteria | 1438 |
| 172 | Ga0268264_10000697 | 3300028381 | Bacteria | 39075 |
| 173 | Ga0307405_10417689 | 3300031731 | Bacteria | 1055 |
| 174 | Ga0307413_10584748 | 3300031824 | Bacteria | 911 |
| 175 | Ga0307410_10026425 | 3300031852 | Bacteria | 3655 |
| 176 | Ga0307410_10097963 | 3300031852 | Bacteria | 2096 |
| 177 | Ga0307410_10362718 | 3300031852 | Bacteria | 1161 |
| 178 | Ga0307406_10278810 | 3300031901 | Bacteria | 1274 |
| 179 | Ga0307407_10114240 | 3300031903 | Bacteria | 1701 |
| 180 | Ga0307412_10114961 | 3300031911 | Bacteria | 1928 |
| 181 | Ga0307409_100011367 | 3300031995 | Bacteria | 5607 |
| 182 | Ga0307409_100514597 | 3300031995 | Bacteria | 1168 |
| 183 | Ga0307416_100547827 | 3300032002 | Bacteria | 1230 |
| 184 | Ga0307411_10130836 | 3300032005 | Bacteria | 1834 |
| 185 | Ga0307411_10469517 | 3300032005 | Bacteria | 1057 |
| 186 | Ga0307415_100003367 | 3300032126 | Bacteria | 8125 |
| 187 | Ga0307415_100037623 | 3300032126 | Bacteria | 3182 |
| 188 | Ga0395900_0082652 | 3300037418 | Bacteria | 3300 |
| 189 | Ga0395900_0618056 | 3300037418 | Bacteria | 1023 |
| 190 | Ga0395898_0191551 | 3300037466 | Bacteria | 1954 |
| 191 | Ga0395898_0321049 | 3300037466 | Bacteria | 1477 |
| 192 | Ga0395898_0523640 | 3300037466 | Bacteria | 1127 |
| 193 | Ga0395905_0008526 | 3300037471 | Bacteria | 10108 |
| 194 | Ga0395905_0128076 | 3300037471 | Bacteria | 2388 |
| 195 | Ga0395901_0036005 | 3300038443 | Bacteria | 5114 |
| 196 | Ga0451793_0707906 | 3300041452 | Bacteria | 725 |
| 197 | Ga0451835_1074365 | 3300041492 | Bacteria | 954 |
| 198 | Ga0451853_0503194 | 3300041512 | Bacteria | 737 |
| 199 | Ga0451853_1424034 | 3300041512 | Bacteria | 1077 |
| 200 | Ga0439445_0112401 | 3300042004 | Bacteria | 778 |
| 201 | Ga0439448_0061906 | 3300042005 | Bacteria | 1238 |
| 202 | Ga0450907_007119 | 3300042146 | Bacteria | 1867 |
| 203 | Ga0466972_0017865 | 3300044658 | Bacteria | 3549 |
| 204 | Ga0466972_0073138 | 3300044658 | Bacteria | 1634 |
| 205 | Ga0466972_0158566 | 3300044658 | Bacteria | 1063 |
| 206 | Ga0466965_0002652 | 3300044683 | Bacteria | 7664 |
| 207 | Ga0466965_0009106 | 3300044683 | Bacteria | 4607 |
| 208 | Ga0466965_0027097 | 3300044683 | Bacteria | 2780 |
| 209 | Ga0466965_0115692 | 3300044683 | Bacteria | 1381 |
| 210 | Ga0466965_0152726 | 3300044683 | Bacteria | 1207 |
| 211 | Ga0466966_0126775 | 3300044684 | Bacteria | 1565 |
| 212 | Ga0466961_0055280 | 3300044693 | Bacteria | 2531 |
| 213 | Ga0466961_0056585 | 3300044693 | Bacteria | 2499 |
| 214 | Ga0466961_0104156 | 3300044693 | Bacteria | 1787 |
| 215 | Ga0466961_0184903 | 3300044693 | Bacteria | 1293 |
| 216 | Ga0466963_0158877 | 3300044694 | Bacteria | 1573 |
| 217 | Ga0466963_0160304 | 3300044694 | Bacteria | 1565 |
| 218 | Ga0466963_0201290 | 3300044694 | Bacteria | 1393 |
| 219 | Ga0466964_0012524 | 3300044706 | Bacteria | 3210 |
| 220 | Ga0466964_0022735 | 3300044706 | Bacteria | 2435 |
| 221 | Ga0466968_0025445 | 3300044735 | Bacteria | 2424 |
| 222 | Ga0466970_0037203 | 3300044765 | Bacteria | 2579 |
| 223 | Ga0466970_0130822 | 3300044765 | Bacteria | 1378 |
| 224 | Ga0466970_0216843 | 3300044765 | Bacteria | 1067 |
| 225 | Ga0466970_0232094 | 3300044765 | Bacteria | 1031 |
| 226 | Ga0466957_0045693 | 3300044842 | Bacteria | 2656 |
| 227 | Ga0466957_0047778 | 3300044842 | Bacteria | 2601 |
| 228 | Ga0466957_0376251 | 3300044842 | Bacteria | 968 |
| 229 | Ga0466957_0642493 | 3300044842 | Bacteria | 745 |
| 230 | Ga0466960_0006034 | 3300044901 | Bacteria | 4838 |
| 231 | Ga0466960_0012568 | 3300044901 | Bacteria | 3577 |
| 232 | Ga0466960_0025110 | 3300044901 | Bacteria | 2694 |
| 233 | Ga0466960_0047591 | 3300044901 | Bacteria | 2057 |
| 234 | Ga0466960_0109474 | 3300044901 | Bacteria | 1433 |
| 235 | Ga0466960_0122484 | 3300044901 | Bacteria | 1363 |
| 236 | Ga0466960_0155582 | 3300044901 | Bacteria | 1224 |
| 237 | Ga0466959_0299776 | 3300045049 | Bacteria | 1101 |
| 238 | Ga0451576_0465826 | 3300045051 | Bacteria | 1327 |
| 239 | Ga0466967_0008799 | 3300045976 | Bacteria | 7439 |
| 240 | Ga0466967_0303799 | 3300045976 | Bacteria | 1536 |
| 241 | Ga0466967_0625390 | 3300045976 | Bacteria | 1063 |
| 242 | Ga0466967_0705571 | 3300045976 | Bacteria | 999 |
| 243 | Ga0466967_0900937 | 3300045976 | Bacteria | 880 |
| 244 | Ga0466967_0927032 | 3300045976 | Bacteria | 866 |
| 245 | Ga0466967_1242654 | 3300045976 | Bacteria | 742 |
| 246 | Ga0495603_0045282 | 3300046455 | Bacteria | 2624 |
| 247 | Ga0495629_0533534 | 3300046459 | Bacteria | 789 |
| 248 | Ga0495651_0265972 | 3300046462 | Bacteria | 1165 |
| 249 | Ga0495604_0365661 | 3300047317 | Bacteria | 956 |
| 250 | Ga0496100_0068908 | 3300048903 | Bacteria | 2354 |
| 251 | Ga0496100_0278569 | 3300048903 | Bacteria | 1246 |
| 252 | Ga0496101_0068374 | 3300048904 | Bacteria | 2597 |
| 253 | Ga0496101_0206628 | 3300048904 | Bacteria | 1520 |
| 254 | Ga0496101_0830240 | 3300048904 | Bacteria | 728 |
| 255 | Ga0496102_0074402 | 3300048905 | Bacteria | 3122 |
| 256 | Ga0496102_0141974 | 3300048905 | Bacteria | 2252 |
| 257 | Ga0496102_0327791 | 3300048905 | Bacteria | 1442 |
| 258 | Ga0496103_0224758 | 3300048906 | Bacteria | 1207 |
| 259 | Ga0496104_0094223 | 3300048907 | Bacteria | 2864 |
| 260 | Ga0496104_0146118 | 3300048907 | Bacteria | 2271 |
| 261 | Ga0496105_0060940 | 3300048908 | Bacteria | 3113 |
| 262 | Ga0496106_0096102 | 3300048909 | Bacteria | 2292 |
| 263 | Ga0496106_0334897 | 3300048909 | Bacteria | 1215 |
| 264 | Ga0496106_0366078 | 3300048909 | Bacteria | 1158 |
| 265 | Ga0496107_0544943 | 3300048910 | Bacteria | 859 |
| 266 | Ga0496108_0092877 | 3300048911 | Bacteria | 2566 |
| 267 | Ga0496108_0122856 | 3300048911 | Bacteria | 2228 |
| 268 | Ga0496108_0291114 | 3300048911 | Bacteria | 1422 |
| 269 | Ga0496108_0498369 | 3300048911 | Bacteria | 1064 |
| 270 | Ga0496109_0016934 | 3300048912 | Bacteria | 6380 |
| 271 | Ga0496109_0040972 | 3300048912 | Bacteria | 4196 |
| 272 | Ga0496110_0007114 | 3300048913 | Bacteria | 8911 |
| 273 | Ga0496110_0395595 | 3300048913 | Bacteria | 1260 |
| 274 | Ga0496110_0547264 | 3300048913 | Bacteria | 1052 |
| 275 | Ga0496111_0102957 | 3300048914 | Bacteria | 2099 |
| 276 | Ga0496111_0490547 | 3300048914 | Bacteria | 905 |
| 277 | Ga0496113_0439076 | 3300048916 | Bacteria | 1049 |
| 278 | Ga0496114_0008673 | 3300048917 | Bacteria | 8056 |
| 279 | Ga0496114_0031053 | 3300048917 | Bacteria | 4394 |
| 280 | Ga0496114_0184686 | 3300048917 | Bacteria | 1822 |
| 281 | Ga0496124_0134068 | 3300048927 | Bacteria | 1964 |
| 282 | Ga0501031_0013319 | 3300049568 | Bacteria | 5367 |
| 283 | Ga0501031_0027049 | 3300049568 | Bacteria | 3739 |
| 284 | Ga0501031_0122947 | 3300049568 | Bacteria | 1695 |
| 285 | Ga0501032_0009910 | 3300049569 | Bacteria | 6883 |
| 286 | Ga0501032_0103502 | 3300049569 | Bacteria | 1886 |
| 287 | Ga0501032_0257013 | 3300049569 | Bacteria | 1133 |
| 288 | Ga0501033_0201331 | 3300049570 | Bacteria | 1422 |
| 289 | Ga0501034_0009485 | 3300049571 | Bacteria | 10187 |
| 290 | Ga0501034_0039899 | 3300049571 | Bacteria | 4755 |
| 291 | Ga0501036_0002967 | 3300049572 | Bacteria | 13477 |
| 292 | Ga0501036_0004918 | 3300049572 | Bacteria | 10794 |
| 293 | Ga0501036_0136091 | 3300049572 | Bacteria | 2074 |
| 294 | Ga0501036_0188488 | 3300049572 | Bacteria | 1736 |
| 295 | Ga0501036_0237737 | 3300049572 | Bacteria | 1528 |
| 296 | Ga0501036_0676803 | 3300049572 | Bacteria | 853 |
| 297 | Ga0501037_0011954 | 3300049573 | Bacteria | 6395 |
| 298 | Ga0501037_0133424 | 3300049573 | Bacteria | 1779 |
| 299 | Ga0501038_0006565 | 3300049574 | Bacteria | 10761 |
| 300 | Ga0501038_0008097 | 3300049574 | Bacteria | 9672 |
| 301 | Ga0501038_0104192 | 3300049574 | Bacteria | 2358 |
| 302 | Ga0501039_0006003 | 3300049575 | Bacteria | 9210 |
| 303 | Ga0501039_0164035 | 3300049575 | Bacteria | 1747 |
| 304 | Ga0501040_0008428 | 3300049576 | Bacteria | 6698 |
| 305 | Ga0501040_0381328 | 3300049576 | Bacteria | 1011 |
| 306 | Ga0501042_0001539 | 3300049578 | Bacteria | 13664 |
| 307 | Ga0501042_0008859 | 3300049578 | Bacteria | 6671 |
| 308 | Ga0501042_0241811 | 3300049578 | Bacteria | 1302 |
| 309 | Ga0501043_0007999 | 3300049579 | Bacteria | 8345 |
| 310 | Ga0501043_0103523 | 3300049579 | Bacteria | 2237 |
| 311 | Ga0501043_0129441 | 3300049579 | Bacteria | 1978 |
| 312 | Ga0501043_0394070 | 3300049579 | Bacteria | 1047 |
| 313 | Ga0501046_0001157 | 3300049580 | Bacteria | 25667 |
| 314 | Ga0501046_0041540 | 3300049580 | Bacteria | 3670 |
| 315 | Ga0501046_0202288 | 3300049580 | Bacteria | 1477 |
| 316 | Ga0501046_0531560 | 3300049580 | Bacteria | 840 |
| 317 | Ga0501047_0031782 | 3300049581 | Bacteria | 5092 |
| 318 | Ga0501047_0121115 | 3300049581 | Bacteria | 2498 |
| 319 | Ga0501048_0018719 | 3300049582 | Bacteria | 5090 |
| 320 | Ga0501048_0038607 | 3300049582 | Bacteria | 3426 |
| 321 | Ga0501048_0152345 | 3300049582 | Bacteria | 1636 |
| 322 | Ga0501048_0259604 | 3300049582 | Bacteria | 1234 |
| 323 | Ga0501048_0598821 | 3300049582 | Bacteria | 791 |
| 324 | Ga0501067_0001727 | 3300049583 | Bacteria | 12003 |
| 325 | Ga0501067_0036530 | 3300049583 | Bacteria | 2727 |
| 326 | Ga0501067_0044792 | 3300049583 | Bacteria | 2458 |
| 327 | Ga0501068_0421971 | 3300049584 | Bacteria | 861 |
| 328 | Ga0501068_0469787 | 3300049584 | Bacteria | 815 |
| 329 | Ga0501069_0252320 | 3300049585 | Bacteria | 1029 |
| 330 | Ga0501070_0005938 | 3300049586 | Bacteria | 10406 |
| 331 | Ga0501070_0013052 | 3300049586 | Bacteria | 7001 |
| 332 | Ga0501070_0017927 | 3300049586 | Bacteria | 5944 |
| 333 | Ga0501070_0020025 | 3300049586 | Bacteria | 5609 |
| 334 | Ga0501070_0086556 | 3300049586 | Bacteria | 2594 |
| 335 | Ga0501070_0200227 | 3300049586 | Bacteria | 1640 |
| 336 | Ga0501071_0000355 | 3300049587 | Bacteria | 22415 |
| 337 | Ga0501071_0007777 | 3300049587 | Bacteria | 7069 |
| 338 | Ga0501071_0043140 | 3300049587 | Bacteria | 3233 |
| 339 | Ga0501071_0167055 | 3300049587 | Bacteria | 1647 |
| 340 | Ga0501071_0199356 | 3300049587 | Bacteria | 1503 |
| 341 | Ga0501071_0365385 | 3300049587 | Bacteria | 1099 |
| 342 | Ga0501072_0061707 | 3300049588 | Bacteria | 2957 |
| 343 | Ga0501072_0077480 | 3300049588 | Bacteria | 2632 |
| 344 | Ga0501072_0193592 | 3300049588 | Bacteria | 1621 |
| 345 | Ga0501072_0444192 | 3300049588 | Bacteria | 1027 |
| 346 | Ga0501072_0520032 | 3300049588 | Bacteria | 941 |
| 347 | Ga0501073_0017121 | 3300049589 | Bacteria | 5249 |
| 348 | Ga0501073_0026782 | 3300049589 | Bacteria | 4128 |
| 349 | Ga0501073_0045087 | 3300049589 | Bacteria | 3106 |
| 350 | Ga0501073_0106439 | 3300049589 | Bacteria | 1946 |
| 351 | Ga0501073_0120028 | 3300049589 | Bacteria | 1822 |
| 352 | Ga0501074_0001472 | 3300049590 | Bacteria | 15829 |
| 353 | Ga0501074_0059993 | 3300049590 | Bacteria | 2740 |
| 354 | Ga0501074_0130318 | 3300049590 | Bacteria | 1799 |
| 355 | Ga0501074_0196970 | 3300049590 | Bacteria | 1436 |
| 356 | Ga0501074_0272823 | 3300049590 | Bacteria | 1202 |
| 357 | Ga0501074_0288723 | 3300049590 | Bacteria | 1166 |
| 358 | Ga0501075_0009937 | 3300049591 | Bacteria | 6670 |
| 359 | Ga0501075_0175603 | 3300049591 | Bacteria | 1635 |
| 360 | Ga0501075_0424014 | 3300049591 | Bacteria | 1014 |
| 361 | Ga0501076_0000758 | 3300049592 | Bacteria | 20827 |
| 362 | Ga0501076_0070635 | 3300049592 | Bacteria | 2792 |
| 363 | Ga0501076_0306282 | 3300049592 | Bacteria | 1303 |
| 364 | Ga0501076_0429499 | 3300049592 | Bacteria | 1087 |
| 365 | Ga0501077_0024168 | 3300049593 | Bacteria | 3857 |
| 366 | Ga0501077_0199836 | 3300049593 | Bacteria | 1270 |
| 367 | Ga0501077_0432931 | 3300049593 | Bacteria | 842 |
| 368 | Ga0501079_0012673 | 3300049741 | Bacteria | 6440 |
| 369 | Ga0501079_0018510 | 3300049741 | Bacteria | 5322 |
| 370 | Ga0501079_0352316 | 3300049741 | Bacteria | 1153 |
| 371 | Ga0501079_0753179 | 3300049741 | Bacteria | 767 |
| 372 | Ga0501080_0018761 | 3300049742 | Bacteria | 6402 |
| 373 | Ga0501080_0153394 | 3300049742 | Bacteria | 2128 |
| 374 | Ga0501080_0162993 | 3300049742 | Bacteria | 2058 |
| 375 | Ga0501080_0295546 | 3300049742 | Bacteria | 1470 |
| 376 | Ga0501081_0020912 | 3300049743 | Bacteria | 4367 |
| 377 | Ga0501081_0167578 | 3300049743 | Bacteria | 1585 |
| 378 | Ga0501083_0048774 | 3300049744 | Bacteria | 2857 |
| 379 | Ga0501083_0073435 | 3300049744 | Bacteria | 2274 |
| 380 | Ga0501083_0177483 | 3300049744 | Bacteria | 1391 |
| 381 | Ga0501035_0017073 | 3300049822 | Bacteria | 6687 |
| 382 | Ga0501035_0097516 | 3300049822 | Bacteria | 2581 |
| 383 | Ga0501035_0120029 | 3300049822 | Bacteria | 2299 |
| 384 | Ga0501035_0316147 | 3300049822 | Bacteria | 1313 |
| 385 | Ga0501044_0015803 | 3300049823 | Bacteria | 8126 |
| 386 | Ga0501044_0110419 | 3300049823 | Bacteria | 2758 |
| 387 | Ga0501045_0038334 | 3300049824 | Bacteria | 3485 |
| 388 | Ga0501045_0122968 | 3300049824 | Bacteria | 1927 |
| 389 | Ga0501045_0124884 | 3300049824 | Bacteria | 1911 |
| 390 | Ga0501045_0348232 | 3300049824 | Bacteria | 1103 |
| 391 | nmdc:mga03683_7351_c1 | 3300050489 | Bacteria | 3821 |
| 392 | nmdc:mga03n38_111303_c1 | 3300050490 | Bacteria | 1334 |
| 393 | nmdc:mga03n38_3654_c1 | 3300050490 | Bacteria | 4975 |
| 394 | nmdc:mga00v17_11317_c1 | 3300050491 | Bacteria | 4904 |
| 395 | nmdc:mga00v17_174114_c1 | 3300050491 | Bacteria | 1388 |
| 396 | nmdc:mga00v17_233452_c1 | 3300050491 | Bacteria | 1192 |
| 397 | nmdc:mga00v17_32424_c1 | 3300050491 | Bacteria | 3088 |
| 398 | nmdc:mga00v17_41417_c1 | 3300050491 | Bacteria | 2766 |
| 399 | nmdc:mga00v17_4230_c1 | 3300050491 | Bacteria | 7448 |
| 400 | nmdc:mga00v17_73424_c1 | 3300050491 | Bacteria | 2124 |
| 401 | nmdc:mga0yw44_1568_c1 | 3300050492 | Bacteria | 9161 |
| 402 | nmdc:mga0yw44_19027_c1 | 3300050492 | Bacteria | 3777 |
| 403 | nmdc:mga0yw44_3212_c1 | 3300050492 | Bacteria | 7194 |
| 404 | nmdc:mga0yw44_43647_c1 | 3300050492 | Bacteria | 2678 |
| 405 | nmdc:mga0yw44_46657_c1 | 3300050492 | Bacteria | 2603 |
| 406 | nmdc:mga0yw44_527597_c1 | 3300050492 | Bacteria | 801 |
| 407 | nmdc:mga0yw44_89911_c1 | 3300050492 | Bacteria | 1939 |
| 408 | nmdc:mga06z11_5974_c1 | 3300050494 | Bacteria | 4920 |
| 409 | nmdc:mga04h51_13994_c1 | 3300050495 | Bacteria | 2284 |
| 410 | nmdc:mga04h51_6049_c1 | 3300050495 | Bacteria | 3117 |
| 411 | nmdc:mga07m45_170309_c1 | 3300050496 | Bacteria | 1266 |
| 412 | nmdc:mga07m45_233495_c1 | 3300050496 | Bacteria | 1070 |
| 413 | nmdc:mga07m45_39833_c1 | 3300050496 | Bacteria | 2627 |
| 414 | nmdc:mga07m45_87608_c1 | 3300050496 | Bacteria | 1782 |
| 415 | nmdc:mga0qj67_137414_c1 | 3300050509 | Bacteria | 1980 |
| 416 | nmdc:mga08y16_547878_c1 | 3300050511 | Bacteria | 1171 |
| 417 | nmdc:mga0sz30_5762_c1 | 3300050516 | Bacteria | 4562 |
| 418 | Ga0495595_0189362 | 3300053084 | Bacteria | 1022 |
| 419 | Ga0495619_0265516 | 3300053085 | Bacteria | 1189 |
| 420 | Ga0500644_0000284 | 3300053088 | Bacteria | 28069 |
| 421 | Ga0500641_0008775 | 3300053096 | Bacteria | 3617 |
| 422 | Ga0500556_0000588 | 3300053104 | Bacteria | 23996 |
| 423 | Ga0500593_000190 | 3300053117 | Bacteria | 25004 |
| 424 | Ga0500573_0055780 | 3300053140 | Bacteria | 2267 |
| 425 | Ga0501084_0009366 | 3300054114 | Bacteria | 8103 |
| 426 | Ga0501084_0136865 | 3300054114 | Bacteria | 2062 |
| 427 | Ga0501084_0141961 | 3300054114 | Bacteria | 2022 |
| 428 | Ga0501084_0196397 | 3300054114 | Bacteria | 1702 |
| 429 | Ga0501084_0253590 | 3300054114 | Bacteria | 1485 |
| 430 | Ga0501084_0346419 | 3300054114 | Bacteria | 1255 |
| 431 | Ga0501082_0072179 | 3300060353 | Bacteria | 2973 |
| 432 | Ga0501082_0152282 | 3300060353 | Bacteria | 2009 |
| 433 | Ga0466962_0147119 | 3300061719 | Bacteria | 1142 |
| 434 | Ga0530510_0062271 | 3300061734 | Bacteria | 2701 |
| 435 | Ga0530510_0166180 | 3300061734 | Bacteria | 1633 |
| 436 | Ga0530510_0229527 | 3300061734 | Bacteria | 1381 |
| 437 | 2643823615 | 2643221561 | Bacteria | 4984412 |
| 438 | 2643891694 | 2643221576 | Bacteria | 5214352 |
| 439 | 2643960742 | 2643221590 | Bacteria | 5214697 |
| 440 | 2644035746 | 2643221604 | Bacteria | 5014917 |
| 441 | 2644093954 | 2643221615 | Bacteria | 5487866 |
| 442 | 2644102372 | 2643221617 | Bacteria | 5139111 |
| 443 | 2644115596 | 2643221620 | Bacteria | 5134593 |
| 444 | 2644230362 | 2643221641 | Bacteria | 4490190 |
| 445 | 2644323798 | 2643221657 | Bacteria | 5490246 |
| 446 | 2644535296 | 2643221696 | Bacteria | 5431823 |
| 447 | 2740168963 | 2739367898 | Bacteria | 4367674 |
| 448 | 2774392881 | 2773857762 | Bacteria | 5971770 |
| 449 | 2804843693 | 2802429296 | Bacteria | 7227771 |
| 450 | 2809196712 | 2808606439 | Bacteria | 5952208 |
| 451 | 2812333106 | 2811994874 | Bacteria | 5367947 |
| 452 | 2812351155 | 2811994878 | Bacteria | 5992952 |
| 453 | 2855391115 | 2855386786 | Bacteria | 4752232 |
| 454 | 2857486414 | 2857481737 | Bacteria | 4761446 |
| 455 | 2891971221 | 2891968417 | Bacteria | 5821697 |
| 456 | 2984579979 | 2984576629 | Bacteria | 4248407 |
| 457 | 2990260760 | 2990256926 | Bacteria | 4252839 |
| 458 | 8025414849 | 8025413630 | Bacteria | 7014048 |
| 459 | 8054611209 | 8054609563 | Bacteria | 5170090 |
| 460 | Ga0105246_10369729 | |||
| 461 | LJQas_1003428 | |||
| 462 | Ga0070658_10039254 | |||
| 463 | Ga0070658_10060256 | |||
| 464 | Ga0070658_10127175 | |||
| 465 | Ga0070658_10524561 | |||
| 466 | Ga0070683_100015288 | |||
| 467 | Ga0070683_100053807 | |||
| 468 | Ga0070670_100874369 | |||
| 469 | Ga0068869_100219301 | |||
| 470 | Ga0070682_100053834 | |||
| 471 | Ga0070660_100051324 | |||
| 472 | Ga0070660_100061043 | |||
| 473 | Ga0070660_100073412 | |||
| 474 | Ga0070689_100071680 | |||
| 475 | Ga0070661_100409378 | |||
| 476 | Ga0070692_10010753 | |||
| 477 | Ga0070688_100164867 | |||
| 478 | Ga0070659_100013213 | |||
| 479 | Ga0070659_100014591 | |||
| 480 | Ga0070667_100210690 | |||
| 481 | Ga0070700_100268236 | |||
| 482 | Ga0070663_100858339 | |||
| 483 | Ga0070678_100236292 | |||
| 484 | Ga0070681_10069036 | |||
| 485 | Ga0070681_10457958 | |||
| 486 | Ga0070679_100010892 | |||
| 487 | Ga0070684_100011120 | |||
| 488 | Ga0070684_100276173 | |||
| 489 | Ga0068853_100140850 | |||
| 490 | Ga0070686_100181400 | |||
| 491 | Ga0070686_100255071 | |||
| 492 | Ga0070665_100000703 | |||
| 493 | Ga0070665_100177813 | |||
| 494 | Ga0070665_100232399 | |||
| 495 | Ga0068855_100024275 | |||
| 496 | Ga0068855_100173643 | |||
| 497 | Ga0068857_100016243 | |||
| 498 | Ga0068857_100170005 | |||
| 499 | Ga0070702_100077955 | |||
| 500 | Ga0068852_100134178 | |||
| 501 | Ga0068864_100802547 | |||
| 502 | Ga0068870_10237258 | |||
| 503 | Ga0068863_100856397 | |||
| 504 | Ga0068860_100000696 | |||
| 505 | Ga0068860_100222278 | |||
| 506 | Ga0068862_100054770 | |||
| 507 | Ga0068862_100081566 | |||
| 508 | Ga0075365_10019412 | |||
| 509 | Ga0075365_10028081 | |||
| 510 | Ga0075365_10031425 | |||
| 511 | Ga0075365_10073863 | |||
| 512 | Ga0075365_10096423 | |||
| 513 | Ga0075365_10109472 | |||
| 514 | Ga0075365_10147879 | |||
| 515 | Ga0075365_10390728 | |||
| 516 | Ga0075368_10005403 | |||
| 517 | Ga0075368_10019955 | |||
| 518 | Ga0075363_100000197 | |||
| 519 | Ga0075363_100000954 | |||
| 520 | Ga0075363_100332654 | |||
| 521 | Ga0075363_100334345 | |||
| 522 | Ga0075363_100342963 | |||
| 523 | Ga0075364_10015899 | |||
| 524 | Ga0075364_10021762 | |||
| 525 | Ga0075364_10037198 | |||
| 526 | Ga0075364_10072624 | |||
| 527 | Ga0075364_10206962 | |||
| 528 | Ga0075367_10000646 | |||
| 529 | Ga0075367_10036938 | |||
| 530 | Ga0075367_10060845 | |||
| 531 | Ga0075367_10150933 | |||
| 532 | Ga0075367_10204279 | |||
| 533 | Ga0075370_10009898 | |||
| 534 | Ga0075370_10027739 | |||
| 535 | Ga0075370_10131308 | |||
| 536 | Ga0075428_100050198 | |||
| 537 | Ga0075430_100289578 | |||
| 538 | Ga0075431_100076521 | |||
| 539 | Ga0075429_100302145 | |||
| 540 | Ga0068865_100091139 | |||
| 541 | Ga0111539_10735296 | |||
| 542 | Ga0105245_10018959 | |||
| 543 | Ga0105245_10271970 | |||
| 544 | Ga0105243_10097121 | |||
| 545 | Ga0105243_10415652 | |||
| 546 | Ga0105243_11334540 | |||
| 547 | Ga0105242_10641682 | |||
| 548 | Ga0105248_10499214 | |||
| 549 | Ga0105237_10093307 | |||
| 550 | Ga0105238_10151831 | |||
| 551 | Ga0105249_10142262 | |||
| 552 | Ga0105239_10000854 | |||
| 553 | Ga0105239_10036170 | |||
| 554 | Ga0105239_10613005 | |||
| 555 | Ga0105246_10000321 | |||
| 556 | Ga0105246_10049110 | |||
| 557 | Ga0105246_10315395 | |||
| 558 | Ga0157369_10001578 | |||
| 559 | Ga0163162_10069059 | |||
| 560 | Ga0163162_11429809 | |||
| 561 | Ga0157372_10029195 | |||
| 562 | Ga0157372_10519469 | |||
| 563 | Ga0157375_10100763 | |||
| 564 | Ga0157375_10133580 | |||
| 565 | Ga0157375_10168851 | |||
| 566 | Ga0157375_10185006 | |||
| 567 | Ga0157375_10257650 | |||
| 568 | Ga0163163_10063250 | |||
| 569 | Ga0157380_10132270 | |||
| 570 | Ga0182008_10035053 | |||
| 571 | Ga0157377_10483627 | |||
| 572 | Ga0157379_10002714 | |||
| 573 | Ga0157376_10171759 | |||
| 574 | Ga0157376_10337796 | |||
| 575 | Ga0163161_10009694 | |||
| 576 | Ga0206353_11692696 | |||
| 577 | Ga0207688_10010855 | |||
| 578 | Ga0207688_10254253 | |||
| 579 | Ga0207647_10028161 | |||
| 580 | Ga0207647_10073960 | |||
| 581 | Ga0207647_10246708 | |||
| 582 | Ga0207643_10220571 | |||
| 583 | Ga0207705_10073763 | |||
| 584 | Ga0207705_10107816 | |||
| 585 | Ga0207705_10171922 | |||
| 586 | Ga0207707_10037490 | |||
| 587 | Ga0207657_10010487 | |||
| 588 | Ga0207657_10146150 | |||
| 589 | Ga0207657_10155584 | |||
| 590 | Ga0207657_10380846 | |||
| 591 | Ga0207649_10241925 | |||
| 592 | Ga0207652_10198153 | |||
| 593 | Ga0207646_10426837 | |||
| 594 | Ga0207687_10015163 | |||
| 595 | Ga0207690_10088742 | |||
| 596 | Ga0207690_10127180 | |||
| 597 | Ga0207706_10527433 | |||
| 598 | Ga0207686_10244382 | |||
| 599 | Ga0207709_10026973 | |||
| 600 | Ga0207709_10174964 | |||
| 601 | Ga0207709_10200949 | |||
| 602 | Ga0207709_10357434 | |||
| 603 | Ga0207704_10564796 | |||
| 604 | Ga0207711_10954229 | |||
| 605 | Ga0207689_10554371 | |||
| 606 | Ga0207661_10011595 | |||
| 607 | Ga0207661_10102308 | |||
| 608 | Ga0207679_10321923 | |||
| 609 | Ga0207667_10143612 | |||
| 610 | Ga0207712_10317104 | |||
| 611 | Ga0207658_10021990 | |||
| 612 | Ga0207658_10152885 | |||
| 613 | Ga0207658_10631332 | |||
| 614 | Ga0207677_10661596 | |||
| 615 | Ga0207678_10731249 | |||
| 616 | Ga0207708_10078620 | |||
| 617 | Ga0207702_10143619 | |||
| 618 | Ga0207674_10011797 | |||
| 619 | Ga0207674_10336013 | |||
| 620 | Ga0207675_100151043 | |||
| 621 | Ga0207683_10093319 | |||
| 622 | Ga0207683_10314111 | |||
| 623 | Ga0207698_10495881 | |||
| 624 | Ga0209813_10017724 | |||
| 625 | Ga0209813_10017731 | |||
| 626 | Ga0268266_10001679 | |||
| 627 | Ga0268266_10152713 | |||
| 628 | Ga0268266_10292283 | |||
| 629 | Ga0268265_10107905 | |||
| 630 | Ga0268265_10303576 | |||
| 631 | Ga0268264_10000697 | |||
| 632 | Ga0307405_10417689 | |||
| 633 | Ga0307413_10584748 | |||
| 634 | Ga0307410_10026425 | |||
| 635 | Ga0307410_10097963 | |||
| 636 | Ga0307410_10362718 | |||
| 637 | Ga0307406_10278810 | |||
| 638 | Ga0307407_10114240 | |||
| 639 | Ga0307412_10114961 | |||
| 640 | Ga0307409_100011367 | |||
| 641 | Ga0307409_100514597 | |||
| 642 | Ga0307416_100547827 | |||
| 643 | Ga0307411_10130836 | |||
| 644 | Ga0307411_10469517 | |||
| 645 | Ga0307415_100003367 | |||
| 646 | Ga0307415_100037623 | |||
| 647 | Ga0395900_0082652 | |||
| 648 | Ga0395900_0618056 | |||
| 649 | Ga0395898_0191551 | |||
| 650 | Ga0395898_0321049 | |||
| 651 | Ga0395898_0523640 | |||
| 652 | Ga0395905_0008526 | |||
| 653 | Ga0395905_0128076 | |||
| 654 | Ga0395901_0036005 | |||
| 655 | Ga0451793_0707906 | |||
| 656 | Ga0451835_1074365 | |||
| 657 | Ga0451853_0503194 | |||
| 658 | Ga0451853_1424034 | |||
| 659 | Ga0439445_0112401 | |||
| 660 | Ga0439448_0061906 | |||
| 661 | Ga0450907_007119 | |||
| 662 | Ga0466972_0017865 | |||
| 663 | Ga0466972_0073138 | |||
| 664 | Ga0466972_0158566 | |||
| 665 | Ga0466965_0002652 | |||
| 666 | Ga0466965_0009106 | |||
| 667 | Ga0466965_0027097 | |||
| 668 | Ga0466965_0115692 | |||
| 669 | Ga0466965_0152726 | |||
| 670 | Ga0466966_0126775 | |||
| 671 | Ga0466961_0055280 | |||
| 672 | Ga0466961_0056585 | |||
| 673 | Ga0466961_0104156 | |||
| 674 | Ga0466961_0184903 | |||
| 675 | Ga0466963_0158877 | |||
| 676 | Ga0466963_0160304 | |||
| 677 | Ga0466963_0201290 | |||
| 678 | Ga0466964_0012524 | |||
| 679 | Ga0466964_0022735 | |||
| 680 | Ga0466968_0025445 | |||
| 681 | Ga0466970_0037203 | |||
| 682 | Ga0466970_0130822 | |||
| 683 | Ga0466970_0216843 | |||
| 684 | Ga0466970_0232094 | |||
| 685 | Ga0466957_0045693 | |||
| 686 | Ga0466957_0047778 | |||
| 687 | Ga0466957_0376251 | |||
| 688 | Ga0466957_0642493 | |||
| 689 | Ga0466960_0006034 | |||
| 690 | Ga0466960_0012568 | |||
| 691 | Ga0466960_0025110 | |||
| 692 | Ga0466960_0047591 | |||
| 693 | Ga0466960_0109474 | |||
| 694 | Ga0466960_0122484 | |||
| 695 | Ga0466960_0155582 | |||
| 696 | Ga0466959_0299776 | |||
| 697 | Ga0451576_0465826 | |||
| 698 | Ga0466967_0008799 | |||
| 699 | Ga0466967_0303799 | |||
| 700 | Ga0466967_0625390 | |||
| 701 | Ga0466967_0705571 | |||
| 702 | Ga0466967_0900937 | |||
| 703 | Ga0466967_0927032 | |||
| 704 | Ga0466967_1242654 | |||
| 705 | Ga0495603_0045282 | |||
| 706 | Ga0495629_0533534 | |||
| 707 | Ga0495651_0265972 | |||
| 708 | Ga0495604_0365661 | |||
| 709 | Ga0496100_0068908 | |||
| 710 | Ga0496100_0278569 | |||
| 711 | Ga0496101_0068374 | |||
| 712 | Ga0496101_0206628 | |||
| 713 | Ga0496101_0830240 | |||
| 714 | Ga0496102_0074402 | |||
| 715 | Ga0496102_0141974 | |||
| 716 | Ga0496102_0327791 | |||
| 717 | Ga0496103_0224758 | |||
| 718 | Ga0496104_0094223 | |||
| 719 | Ga0496104_0146118 | |||
| 720 | Ga0496105_0060940 | |||
| 721 | Ga0496106_0096102 | |||
| 722 | Ga0496106_0334897 | |||
| 723 | Ga0496106_0366078 | |||
| 724 | Ga0496107_0544943 | |||
| 725 | Ga0496108_0092877 | |||
| 726 | Ga0496108_0122856 | |||
| 727 | Ga0496108_0291114 | |||
| 728 | Ga0496108_0498369 | |||
| 729 | Ga0496109_0016934 | |||
| 730 | Ga0496109_0040972 | |||
| 731 | Ga0496110_0007114 | |||
| 732 | Ga0496110_0395595 | |||
| 733 | Ga0496110_0547264 | |||
| 734 | Ga0496111_0102957 | |||
| 735 | Ga0496111_0490547 | |||
| 736 | Ga0496113_0439076 | |||
| 737 | Ga0496114_0008673 | |||
| 738 | Ga0496114_0031053 | |||
| 739 | Ga0496114_0184686 | |||
| 740 | Ga0496124_0134068 | |||
| 741 | Ga0501031_0013319 | |||
| 742 | Ga0501031_0027049 | |||
| 743 | Ga0501031_0122947 | |||
| 744 | Ga0501032_0009910 | |||
| 745 | Ga0501032_0103502 | |||
| 746 | Ga0501032_0257013 | |||
| 747 | Ga0501033_0201331 | |||
| 748 | Ga0501034_0009485 | |||
| 749 | Ga0501034_0039899 | |||
| 750 | Ga0501036_0002967 | |||
| 751 | Ga0501036_0004918 | |||
| 752 | Ga0501036_0136091 | |||
| 753 | Ga0501036_0188488 | |||
| 754 | Ga0501036_0237737 | |||
| 755 | Ga0501036_0676803 | |||
| 756 | Ga0501037_0011954 | |||
| 757 | Ga0501037_0133424 | |||
| 758 | Ga0501038_0006565 | |||
| 759 | Ga0501038_0008097 | |||
| 760 | Ga0501038_0104192 | |||
| 761 | Ga0501039_0006003 | |||
| 762 | Ga0501039_0164035 | |||
| 763 | Ga0501040_0008428 | |||
| 764 | Ga0501040_0381328 | |||
| 765 | Ga0501042_0001539 | |||
| 766 | Ga0501042_0008859 | |||
| 767 | Ga0501042_0241811 | |||
| 768 | Ga0501043_0007999 | |||
| 769 | Ga0501043_0103523 | |||
| 770 | Ga0501043_0129441 | |||
| 771 | Ga0501043_0394070 | |||
| 772 | Ga0501046_0001157 | |||
| 773 | Ga0501046_0041540 | |||
| 774 | Ga0501046_0202288 | |||
| 775 | Ga0501046_0531560 | |||
| 776 | Ga0501047_0031782 | |||
| 777 | Ga0501047_0121115 | |||
| 778 | Ga0501048_0018719 | |||
| 779 | Ga0501048_0038607 | |||
| 780 | Ga0501048_0152345 | |||
| 781 | Ga0501048_0259604 | |||
| 782 | Ga0501048_0598821 | |||
| 783 | Ga0501067_0001727 | |||
| 784 | Ga0501067_0036530 | |||
| 785 | Ga0501067_0044792 | |||
| 786 | Ga0501068_0421971 | |||
| 787 | Ga0501068_0469787 | |||
| 788 | Ga0501069_0252320 | |||
| 789 | Ga0501070_0005938 | |||
| 790 | Ga0501070_0013052 | |||
| 791 | Ga0501070_0017927 | |||
| 792 | Ga0501070_0020025 | |||
| 793 | Ga0501070_0086556 | |||
| 794 | Ga0501070_0200227 | |||
| 795 | Ga0501071_0000355 | |||
| 796 | Ga0501071_0007777 | |||
| 797 | Ga0501071_0043140 | |||
| 798 | Ga0501071_0167055 | |||
| 799 | Ga0501071_0199356 | |||
| 800 | Ga0501071_0365385 | |||
| 801 | Ga0501072_0061707 | |||
| 802 | Ga0501072_0077480 | |||
| 803 | Ga0501072_0193592 | |||
| 804 | Ga0501072_0444192 | |||
| 805 | Ga0501072_0520032 | |||
| 806 | Ga0501073_0017121 | |||
| 807 | Ga0501073_0026782 | |||
| 808 | Ga0501073_0045087 | |||
| 809 | Ga0501073_0106439 | |||
| 810 | Ga0501073_0120028 | |||
| 811 | Ga0501074_0001472 | |||
| 812 | Ga0501074_0059993 | |||
| 813 | Ga0501074_0130318 | |||
| 814 | Ga0501074_0196970 | |||
| 815 | Ga0501074_0272823 | |||
| 816 | Ga0501074_0288723 | |||
| 817 | Ga0501075_0009937 | |||
| 818 | Ga0501075_0175603 | |||
| 819 | Ga0501075_0424014 | |||
| 820 | Ga0501076_0000758 | |||
| 821 | Ga0501076_0070635 | |||
| 822 | Ga0501076_0306282 | |||
| 823 | Ga0501076_0429499 | |||
| 824 | Ga0501077_0024168 | |||
| 825 | Ga0501077_0199836 | |||
| 826 | Ga0501077_0432931 | |||
| 827 | Ga0501079_0012673 | |||
| 828 | Ga0501079_0018510 | |||
| 829 | Ga0501079_0352316 | |||
| 830 | Ga0501079_0753179 | |||
| 831 | Ga0501080_0018761 | |||
| 832 | Ga0501080_0153394 | |||
| 833 | Ga0501080_0162993 | |||
| 834 | Ga0501080_0295546 | |||
| 835 | Ga0501081_0020912 | |||
| 836 | Ga0501081_0167578 | |||
| 837 | Ga0501083_0048774 | |||
| 838 | Ga0501083_0073435 | |||
| 839 | Ga0501083_0177483 | |||
| 840 | Ga0501035_0017073 | |||
| 841 | Ga0501035_0097516 | |||
| 842 | Ga0501035_0120029 | |||
| 843 | Ga0501035_0316147 | |||
| 844 | Ga0501044_0015803 | |||
| 845 | Ga0501044_0110419 | |||
| 846 | Ga0501045_0038334 | |||
| 847 | Ga0501045_0122968 | |||
| 848 | Ga0501045_0124884 | |||
| 849 | Ga0501045_0348232 | |||
| 850 | nmdc:mga03683_7351_c1 | |||
| 851 | nmdc:mga03n38_111303_c1 | |||
| 852 | nmdc:mga03n38_3654_c1 | |||
| 853 | nmdc:mga00v17_11317_c1 | |||
| 854 | nmdc:mga00v17_174114_c1 | |||
| 855 | nmdc:mga00v17_233452_c1 | |||
| 856 | nmdc:mga00v17_32424_c1 | |||
| 857 | nmdc:mga00v17_41417_c1 | |||
| 858 | nmdc:mga00v17_4230_c1 | |||
| 859 | nmdc:mga00v17_73424_c1 | |||
| 860 | nmdc:mga0yw44_1568_c1 | |||
| 861 | nmdc:mga0yw44_19027_c1 | |||
| 862 | nmdc:mga0yw44_3212_c1 | |||
| 863 | nmdc:mga0yw44_43647_c1 | |||
| 864 | nmdc:mga0yw44_46657_c1 | |||
| 865 | nmdc:mga0yw44_527597_c1 | |||
| 866 | nmdc:mga0yw44_89911_c1 | |||
| 867 | nmdc:mga06z11_5974_c1 | |||
| 868 | nmdc:mga04h51_13994_c1 | |||
| 869 | nmdc:mga04h51_6049_c1 | |||
| 870 | nmdc:mga07m45_170309_c1 | |||
| 871 | nmdc:mga07m45_233495_c1 | |||
| 872 | nmdc:mga07m45_39833_c1 | |||
| 873 | nmdc:mga07m45_87608_c1 | |||
| 874 | nmdc:mga0qj67_137414_c1 | |||
| 875 | nmdc:mga08y16_547878_c1 | |||
| 876 | nmdc:mga0sz30_5762_c1 | |||
| 877 | Ga0495595_0189362 | |||
| 878 | Ga0495619_0265516 | |||
| 879 | Ga0500644_0000284 | |||
| 880 | Ga0500641_0008775 | |||
| 881 | Ga0500556_0000588 | |||
| 882 | Ga0500593_000190 | |||
| 883 | Ga0500573_0055780 | |||
| 884 | Ga0501084_0009366 | |||
| 885 | Ga0501084_0136865 | |||
| 886 | Ga0501084_0141961 | |||
| 887 | Ga0501084_0196397 | |||
| 888 | Ga0501084_0253590 | |||
| 889 | Ga0501084_0346419 | |||
| 890 | Ga0501082_0072179 | |||
| 891 | Ga0501082_0152282 | |||
| 892 | Ga0466962_0147119 | |||
| 893 | Ga0530510_0062271 | |||
| 894 | Ga0530510_0166180 | |||
| 895 | Ga0530510_0229527 | |||
| 896 | 2643823615 | |||
| 897 | 2643891694 | |||
| 898 | 2643960742 | |||
| 899 | 2644035746 | |||
| 900 | 2644093954 | |||
| 901 | 2644102372 | |||
| 902 | 2644115596 | |||
| 903 | 2644230362 | |||
| 904 | 2644323798 | |||
| 905 | 2644535296 | |||
| 906 | 2740168963 | |||
| 907 | 2774392881 | |||
| 908 | 2804843693 | |||
| 909 | 2809196712 | |||
| 910 | 2812333106 | |||
| 911 | 2812351155 | |||
| 912 | 2855391115 | |||
| 913 | 2857486414 | |||
| 914 | 2891971221 | |||
| 915 | 2984579979 | |||
| 916 | 2990260760 | |||
| 917 | 8025414849 | |||
| 918 | 8054611209 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1rpx-assembly1.cif.gz_A | d-ribulose-5-phosphate 3-epimerase from solanum tuberosum chloroplasts | 0.929 | 2 | 214 |
| 2fli-assembly1.cif.gz_E | the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate | 0.9289 | 3 | 214 |
| 7sbj-assembly1.cif.gz_C | crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a | 0.9274 | 4 | 218 |
| 5umf-assembly1.cif.gz_C | crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate | 0.9229 | 2 | 219 |
| 7u5y-assembly1.cif.gz_E | crystal structure of ribulose-phosphate 3-epimerase from pseudomonas aeruginosa | 0.9204 | 1 | 218 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WI51_4_223_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9322 | 2 | 217 | 3.20.20.70 |
| 2fliC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9294 | 1 | 216 | 3.20.20.70 |
| af_P0AG07_1_223_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9268 | 1 | 219 | 3.20.20.70 |
| af_A0A1D6PJ99_41_293_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9168 | 2 | 208 | 3.20.20.70 |
| 1tqjD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9163 | 1 | 214 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W4UGP6-F1-model_v4 | deleted | 0.9732 | 51 | 218 |
|
| AF-A0A519FSZ6-F1-model_v4 | Ribulose-phosphate 3-epimerase | 0.9705 | 76 | 218 |
GO:0005975
GO:0016857 |
| AF-A0A3B9SKL1-F1-model_v4 | Ribulose-phosphate 3-epimerase | 0.9664 | 46 | 213 |
GO:0005975
GO:0016857 |
| AF-A0A849FQY7-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9589 | 44 | 215 |
GO:0004750
GO:0005975 GO:0006098 |
| AF-A0A6J7N4Z0-F1-model_v4 | Unannotated protein | 0.9583 | 50 | 217 |
GO:0005975
GO:0016857 |